BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780303|ref|YP_003064716.1| DNA protecting protein DprA [Candidatus Liberibacter asiaticus str. psy62] (77 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780303|ref|YP_003064716.1| DNA protecting protein DprA [Candidatus Liberibacter asiaticus str. psy62] Length = 77 Score = 161 bits (408), Expect = 2e-42, Method: Compositional matrix adjust. Identities = 77/77 (100%), Positives = 77/77 (100%) Query: 1 MKKMNPLKGGVSLTDDQKISWLRLIRSDNISPATCRDMINYFGSAEQALEMIPELAQRGA 60 MKKMNPLKGGVSLTDDQKISWLRLIRSDNISPATCRDMINYFGSAEQALEMIPELAQRGA Sbjct: 1 MKKMNPLKGGVSLTDDQKISWLRLIRSDNISPATCRDMINYFGSAEQALEMIPELAQRGA 60 Query: 61 VYAGKRAFVQKNQQKKS 77 VYAGKRAFVQKNQQKKS Sbjct: 61 VYAGKRAFVQKNQQKKS 77 >gi|254780891|ref|YP_003065304.1| hypothetical protein CLIBASIA_03940 [Candidatus Liberibacter asiaticus str. psy62] Length = 215 Score = 22.3 bits (46), Expect = 1.4, Method: Compositional matrix adjust. Identities = 8/28 (28%), Positives = 15/28 (53%) Query: 34 TCRDMINYFGSAEQALEMIPELAQRGAV 61 C D+I+ G+ +LE++ E+ V Sbjct: 22 ICHDIISPIGAIHNSLELLDEVGIEDEV 49 >gi|255764460|ref|YP_003064605.2| recombinase A [Candidatus Liberibacter asiaticus str. psy62] Length = 363 Score = 20.4 bits (41), Expect = 5.3, Method: Compositional matrix adjust. Identities = 9/18 (50%), Positives = 12/18 (66%) Query: 44 SAEQALEMIPELAQRGAV 61 + EQALE+ L + GAV Sbjct: 129 TGEQALEITDMLVRSGAV 146 >537021.9.peg.753_1 Length = 1033 Score = 20.0 bits (40), Expect = 7.8, Method: Compositional matrix adjust. Identities = 8/22 (36%), Positives = 14/22 (63%) Query: 37 DMINYFGSAEQALEMIPELAQR 58 +M++ F +ALE E+A+R Sbjct: 259 EMVSIFSDLPEALENTVEIARR 280 >gi|254780387|ref|YP_003064800.1| C4-dicarboxylate transporter DctA [Candidatus Liberibacter asiaticus str. psy62] Length = 426 Score = 20.0 bits (40), Expect = 8.6, Method: Composition-based stats. Identities = 10/39 (25%), Positives = 19/39 (48%) Query: 7 LKGGVSLTDDQKISWLRLIRSDNISPATCRDMINYFGSA 45 L ++L I+ + LI + + CR + N+ G+A Sbjct: 363 LAATITLVPSLPIAGMTLILGVDRFMSECRSVTNFIGNA 401 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.317 0.130 0.371 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,281 Number of Sequences: 1233 Number of extensions: 1364 Number of successful extensions: 6 Number of sequences better than 100.0: 6 Number of HSP's better than 100.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of query: 77 length of database: 328,796 effective HSP length: 47 effective length of query: 30 effective length of database: 270,845 effective search space: 8125350 effective search space used: 8125350 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.2 bits) S2: 31 (16.5 bits)