BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|254780304|ref|YP_003064717.1| DNA protecting protein DprA [Candidatus Liberibacter asiaticus str. psy62] (34 letters) Database: nr 14,124,377 sequences; 4,842,793,630 total letters Searching..................................................done Results from round 1 >gi|254780304|ref|YP_003064717.1| DNA protecting protein DprA [Candidatus Liberibacter asiaticus str. psy62] gi|254039981|gb|ACT56777.1| DNA protecting protein DprA [Candidatus Liberibacter asiaticus str. psy62] Length = 34 Score = 71.6 bits (174), Expect = 3e-11, Method: Compositional matrix adjust. Identities = 34/34 (100%), Positives = 34/34 (100%) Query: 1 [protein fragment, 34 aa] 34 [protein fragment, 34 aa] Sbjct: 1 [protein fragment, 34 aa] 34 >gi|315122272|ref|YP_004062761.1| hypothetical protein CKC_02620 [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313495674|gb|ADR52273.1| hypothetical protein CKC_02620 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 298 Score = 60.8 bits (146), Expect = 6e-08, Method: Compositional matrix adjust. Identities = 29/34 (85%), Positives = 31/34 (91%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 MAGGLDCLYPPENR+LLEEIW GIAISE+PFG Sbjct: 179 MAGGLDCLYPPENRSLLEEIWHE-GIAISEMPFG 211 >gi|222085614|ref|YP_002544144.1| DNA protecting protein DprA [Agrobacterium radiobacter K84] gi|221723062|gb|ACM26218.1| DNA protecting protein DprA [Agrobacterium radiobacter K84] Length = 383 Score = 54.7 bits (130), Expect = 4e-06, Method: Composition-based stats. Identities = 24/34 (70%), Positives = 27/34 (79%) Query: 1 [protein fragment, 34 aa] 34 MAGGLD YPPEN LL EIWD G+A+SE+PFG Sbjct: 178 MAGGLDQPYPPENVGLLNEIWDGNGLAVSEMPFG 211 >gi|222148310|ref|YP_002549267.1| DNA protecting protein DprA [Agrobacterium vitis S4] gi|221735298|gb|ACM36261.1| DNA protecting protein DprA [Agrobacterium vitis S4] Length = 383 Score = 53.1 bits (126), Expect = 1e-05, Method: Compositional matrix adjust. Identities = 23/34 (67%), Positives = 29/34 (85%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YPPEN +LL++IWD G+AISE+PFG Sbjct: 178 LAGGLDRPYPPENVDLLKDIWDGKGVAISEMPFG 211 >gi|150396156|ref|YP_001326623.1| DNA protecting protein DprA [Sinorhizobium medicae WSM419] gi|150027671|gb|ABR59788.1| DNA protecting protein DprA [Sinorhizobium medicae WSM419] Length = 383 Score = 50.1 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 23/34 (67%), Positives = 27/34 (79%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YPPEN LL+EI GG+AISE+PFG Sbjct: 178 LAGGLDRPYPPENIGLLQEIVSGGGLAISEMPFG 211 >gi|319405728|emb|CBI79351.1| DNA processing chain A [Bartonella sp. AR 15-3] Length = 383 Score = 49.3 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 20/34 (58%), Positives = 26/34 (76%) Query: 1 [protein fragment, 34 aa] 34 MAGG+D +YPPEN+ L ++I NGG ISE+P G Sbjct: 167 MAGGIDYIYPPENKKLYDDILTNGGAIISEMPIG 200 >gi|49475582|ref|YP_033623.1| DNA processing chain A [Bartonella henselae str. Houston-1] gi|49238389|emb|CAF27616.1| DNA processing chain A [Bartonella henselae str. Houston-1] Length = 410 Score = 48.9 bits (115), Expect = 2e-04, Method: Composition-based stats. Identities = 21/34 (61%), Positives = 26/34 (76%) Query: 1 [protein fragment, 34 aa] 34 MAGG+D +YPPEN+ L E+I NGG ISE+P G Sbjct: 184 MAGGIDHIYPPENKKLHEDIIANGGAIISEMPIG 217 >gi|319898957|ref|YP_004159050.1| DNA processing chain A [Bartonella clarridgeiae 73] gi|319402921|emb|CBI76472.1| DNA processing chain A [Bartonella clarridgeiae 73] Length = 383 Score = 48.5 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 20/34 (58%), Positives = 26/34 (76%) Query: 1 [protein fragment, 34 aa] 34 MAGG+D +YPPEN+ L ++I NGG ISE+P G Sbjct: 157 MAGGIDHIYPPENKKLYDDILANGGAIISEMPIG 190 >gi|319408534|emb|CBI82187.1| DNA processing chain A [Bartonella schoenbuchensis R1] Length = 404 Score = 48.1 bits (113), Expect = 4e-04, Method: Composition-based stats. Identities = 20/34 (58%), Positives = 26/34 (76%) Query: 1 [protein fragment, 34 aa] 34 MAGG+D +YPPEN+ L ++I NGG ISE+P G Sbjct: 178 MAGGIDHIYPPENKKLYDDIITNGGAIISEMPVG 211 >gi|319407290|emb|CBI80931.1| DNA processing chain A [Bartonella sp. 1-1C] Length = 383 Score = 48.1 bits (113), Expect = 4e-04, Method: Composition-based stats. Identities = 20/34 (58%), Positives = 26/34 (76%) Query: 1 [protein fragment, 34 aa] 34 MAGG+D +YPPEN+ L ++I NGG ISE+P G Sbjct: 167 MAGGIDYIYPPENQKLYDDILANGGAIISEMPIG 200 >gi|319404285|emb|CBI77878.1| DNA processing chain A [Bartonella rochalimae ATCC BAA-1498] Length = 383 Score = 47.8 bits (112), Expect = 5e-04, Method: Composition-based stats. Identities = 20/34 (58%), Positives = 26/34 (76%) Query: 1 [protein fragment, 34 aa] 34 MAGG+D +YPPEN+ L ++I NGG ISE+P G Sbjct: 167 MAGGIDHIYPPENQKLYDDILANGGAIISEMPIG 200 >gi|328543466|ref|YP_004303575.1| DNA protecting protein DprA [polymorphum gilvum SL003B-26A1] gi|326413210|gb|ADZ70273.1| DNA protecting protein DprA, putative [Polymorphum gilvum SL003B-26A1] Length = 380 Score = 47.4 bits (111), Expect = 7e-04, Method: Composition-based stats. Identities = 22/33 (66%), Positives = 25/33 (75%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGG+D LYPPE+ LL I D GG AISE+PFG Sbjct: 179 AGGIDILYPPEHDGLLARILDAGGSAISEMPFG 211 >gi|209548899|ref|YP_002280816.1| DNA protecting protein DprA [Rhizobium leguminosarum bv. trifolii WSM2304] gi|209534655|gb|ACI54590.1| DNA protecting protein DprA [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 380 Score = 47.4 bits (111), Expect = 7e-04, Method: Compositional matrix adjust. Identities = 22/34 (64%), Positives = 26/34 (76%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YPPEN LLEEI G+A+SE+PFG Sbjct: 178 LAGGLDQPYPPENIGLLEEITSGNGLAVSEMPFG 211 >gi|218674768|ref|ZP_03524437.1| DNA processing chain A protein [Rhizobium etli GR56] Length = 380 Score = 47.4 bits (111), Expect = 7e-04, Method: Composition-based stats. Identities = 21/34 (61%), Positives = 26/34 (76%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YPPEN L+EEI G+A+SE+PFG Sbjct: 178 LAGGLDKPYPPENHGLIEEIAGGNGLAVSEMPFG 211 >gi|116251502|ref|YP_767340.1| smf protein [Rhizobium leguminosarum bv. viciae 3841] gi|115256150|emb|CAK07231.1| putative smf protein [Rhizobium leguminosarum bv. viciae 3841] Length = 380 Score = 47.4 bits (111), Expect = 7e-04, Method: Composition-based stats. Identities = 22/34 (64%), Positives = 26/34 (76%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YPPEN LLEEI G+A+SE+PFG Sbjct: 178 LAGGLDQPYPPENIGLLEEITGGNGLAVSEMPFG 211 >gi|27380215|ref|NP_771744.1| DNA processing protein [Bradyrhizobium japonicum USDA 110] gi|27353369|dbj|BAC50369.1| DNA processing protein [Bradyrhizobium japonicum USDA 110] Length = 380 Score = 47.4 bits (111), Expect = 7e-04, Method: Composition-based stats. Identities = 20/34 (58%), Positives = 26/34 (76%) Query: 1 [protein fragment, 34 aa] 34 +AGG DC+YPPE+ +LL I D+ G AISE+P G Sbjct: 183 LAGGHDCIYPPEHGDLLTSILDHAGAAISEMPLG 216 >gi|86357273|ref|YP_469165.1| DNA processing chain A protein [Rhizobium etli CFN 42] gi|86281375|gb|ABC90438.1| probable DNA processing chain A protein [Rhizobium etli CFN 42] Length = 380 Score = 47.0 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 21/34 (61%), Positives = 26/34 (76%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YPPEN L+EEI G+A+SE+PFG Sbjct: 178 LAGGLDKPYPPENLGLIEEITGGNGLAVSEMPFG 211 >gi|307301126|ref|ZP_07580895.1| DNA protecting protein DprA [Sinorhizobium meliloti BL225C] gi|306904081|gb|EFN34667.1| DNA protecting protein DprA [Sinorhizobium meliloti BL225C] Length = 383 Score = 47.0 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 21/34 (61%), Positives = 26/34 (76%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YPPEN LL+EI G+A+SE+PFG Sbjct: 178 LAGGLDRPYPPENLGLLQEIVSGEGLAVSEMPFG 211 >gi|240850661|ref|YP_002972061.1| DNA processing chain A [Bartonella grahamii as4aup] gi|240267784|gb|ACS51372.1| DNA processing chain A [Bartonella grahamii as4aup] Length = 404 Score = 46.6 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 20/32 (62%), Positives = 25/32 (78%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIP 32 MAGG+D +YPPEN+ L E+I NGG ISE+P Sbjct: 178 MAGGIDHIYPPENKRLYEDIIANGGAIISEMP 209 >gi|241204123|ref|YP_002975219.1| DNA protecting protein DprA [Rhizobium leguminosarum bv. trifolii WSM1325] gi|240858013|gb|ACS55680.1| DNA protecting protein DprA [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 380 Score = 46.6 bits (109), Expect = 0.001, Method: Compositional matrix adjust. Identities = 22/34 (64%), Positives = 26/34 (76%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YPPEN LLEEI G+A+SE+PFG Sbjct: 178 LAGGLDQPYPPENIGLLEEITGGNGLAVSEMPFG 211 >gi|15888630|ref|NP_354311.1| DNA processing chain A [Agrobacterium tumefaciens str. C58] gi|15156358|gb|AAK87096.1| DNA processing chain A [Agrobacterium tumefaciens str. C58] Length = 380 Score = 46.6 bits (109), Expect = 0.001, Method: Compositional matrix adjust. Identities = 21/34 (61%), Positives = 26/34 (76%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YP EN LL++I+D GG ISE+PFG Sbjct: 178 LAGGLDRPYPQENFGLLQDIYDQGGATISEMPFG 211 >gi|15965054|ref|NP_385407.1| hypothetical protein SMc01363 [Sinorhizobium meliloti 1021] gi|15074233|emb|CAC45880.1| Conserved hypothetical protein [Sinorhizobium meliloti 1021] Length = 383 Score = 46.2 bits (108), Expect = 0.001, Method: Composition-based stats. Identities = 21/34 (61%), Positives = 26/34 (76%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YPPEN LL+EI G+A+SE+PFG Sbjct: 178 LAGGLDRPYPPENLGLLQEIVSGEGLAVSEMPFG 211 >gi|307317859|ref|ZP_07597297.1| DNA protecting protein DprA [Sinorhizobium meliloti AK83] gi|306896621|gb|EFN27369.1| DNA protecting protein DprA [Sinorhizobium meliloti AK83] Length = 383 Score = 46.2 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 21/34 (61%), Positives = 26/34 (76%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YPPEN LL+EI G+A+SE+PFG Sbjct: 178 LAGGLDRPYPPENLGLLQEIVSGEGLAVSEMPFG 211 >gi|260424749|ref|ZP_05733144.2| DNA processing protein DprA [Dialister invisus DSM 15470] gi|260403042|gb|EEW96589.1| DNA processing protein DprA [Dialister invisus DSM 15470] Length = 363 Score = 45.8 bits (107), Expect = 0.002, Method: Compositional matrix adjust. Identities = 21/34 (61%), Positives = 26/34 (76%) Query: 1 [protein fragment, 34 aa] 34 +A GLD +YPPEN+NL ++I DNGG ISE P G Sbjct: 170 LACGLDHVYPPENKNLFQKIIDNGGTIISEYPPG 203 >gi|190891322|ref|YP_001977864.1| DNA processing chain A protein [Rhizobium etli CIAT 652] gi|190696601|gb|ACE90686.1| DNA processing chain A protein [Rhizobium etli CIAT 652] Length = 380 Score = 45.8 bits (107), Expect = 0.002, Method: Compositional matrix adjust. Identities = 21/34 (61%), Positives = 26/34 (76%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YPPEN L+EEI G+A+SE+PFG Sbjct: 178 LAGGLDRPYPPENLGLIEEIAGGNGLAVSEMPFG 211 >gi|218513189|ref|ZP_03510029.1| DNA processing chain A protein [Rhizobium etli 8C-3] Length = 352 Score = 45.8 bits (107), Expect = 0.002, Method: Compositional matrix adjust. Identities = 21/34 (61%), Positives = 26/34 (76%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YPPEN L+EEI G+A+SE+PFG Sbjct: 165 LAGGLDRPYPPENLGLIEEIAGGNGLAVSEMPFG 198 >gi|227821656|ref|YP_002825626.1| DNA processing chain A [Sinorhizobium fredii NGR234] gi|227340655|gb|ACP24873.1| DNA processing chain A [Sinorhizobium fredii NGR234] Length = 386 Score = 45.4 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 22/34 (64%), Positives = 26/34 (76%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YPPEN LL+EI G+AISE+PFG Sbjct: 178 LAGGLDRPYPPENIGLLQEITAGEGLAISEMPFG 211 >gi|163868294|ref|YP_001609503.1| DNA processing chain A [Bartonella tribocorum CIP 105476] gi|161017950|emb|CAK01508.1| DNA processing chain A [Bartonella tribocorum CIP 105476] Length = 404 Score = 45.1 bits (105), Expect = 0.003, Method: Composition-based stats. Identities = 19/32 (59%), Positives = 25/32 (78%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIP 32 MAGG++ +YPPEN+ L E+I NGG ISE+P Sbjct: 178 MAGGINHIYPPENKKLYEDIIANGGAIISEMP 209 >gi|49474246|ref|YP_032288.1| DNA processing chain A [Bartonella quintana str. Toulouse] gi|49239750|emb|CAF26132.1| DNA processing chain A [Bartonella quintana str. Toulouse] Length = 410 Score = 45.1 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 19/32 (59%), Positives = 25/32 (78%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIP 32 MAGG+D +YPPEN+ L E+I +GG ISE+P Sbjct: 184 MAGGVDHIYPPENKKLHEDIITHGGAIISEMP 215 >gi|114707187|ref|ZP_01440085.1| DNA processing chain A [Fulvimarina pelagi HTCC2506] gi|114537383|gb|EAU40509.1| DNA processing chain A [Fulvimarina pelagi HTCC2506] Length = 377 Score = 44.7 bits (104), Expect = 0.004, Method: Composition-based stats. Identities = 21/33 (63%), Positives = 23/33 (69%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGGLD YPPENR+L+ I D GG IS PFG Sbjct: 177 AGGLDMPYPPENRSLMRRIVDEGGCLISARPFG 209 >gi|304391708|ref|ZP_07373650.1| DNA protecting protein DprA [Ahrensia sp. R2A130] gi|303295937|gb|EFL90295.1| DNA protecting protein DprA [Ahrensia sp. R2A130] Length = 378 Score = 44.7 bits (104), Expect = 0.004, Method: Composition-based stats. Identities = 21/33 (63%), Positives = 24/33 (72%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGG+D LYPPEN LL+ I GG AISE+P G Sbjct: 178 AGGVDHLYPPENGPLLDAILATGGAAISEMPLG 210 >gi|325292667|ref|YP_004278531.1| DNA processing chain A [Agrobacterium sp. H13-3] gi|325060520|gb|ADY64211.1| DNA processing chain A [Agrobacterium sp. H13-3] Length = 379 Score = 44.7 bits (104), Expect = 0.005, Method: Compositional matrix adjust. Identities = 20/34 (58%), Positives = 26/34 (76%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YP EN LL++I++ GG ISE+PFG Sbjct: 178 LAGGLDRPYPQENFGLLQDIYEEGGATISEMPFG 211 >gi|290968766|ref|ZP_06560303.1| DNA protecting protein DprA [Megasphaera genomosp. type_1 str. 28L] gi|290781062|gb|EFD93653.1| DNA protecting protein DprA [Megasphaera genomosp. type_1 str. 28L] Length = 363 Score = 44.7 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 21/34 (61%), Positives = 23/34 (67%) Query: 1 [protein fragment, 34 aa] 34 +A GLD YP EN+ L EEI NGG ISE PFG Sbjct: 172 VASGLDITYPRENKKLFEEIAANGGGIISEYPFG 205 >gi|121602381|ref|YP_989130.1| DNA protecting protein DprA [Bartonella bacilliformis KC583] gi|120614558|gb|ABM45159.1| DNA protecting protein DprA [Bartonella bacilliformis KC583] Length = 396 Score = 44.7 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 19/32 (59%), Positives = 24/32 (75%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIP 32 MAGG+D +YP EN+ L +I DNGG ISE+P Sbjct: 172 MAGGIDHIYPSENKKLYNDIIDNGGAIISEMP 203 >gi|218506638|ref|ZP_03504516.1| DNA processing chain A protein [Rhizobium etli Brasil 5] Length = 167 Score = 43.5 bits (101), Expect = 0.011, Method: Compositional matrix adjust. Identities = 20/34 (58%), Positives = 25/34 (73%) Query: 1 [protein fragment, 34 aa] 34 + GGLD YPPEN L+EEI G+A+SE+PFG Sbjct: 39 LPGGLDRPYPPENLGLIEEIAGGNGLAVSEMPFG 72 >gi|307946437|ref|ZP_07661772.1| DNA protecting protein DprA [Roseibium sp. TrichSKD4] gi|307770101|gb|EFO29327.1| DNA protecting protein DprA [Roseibium sp. TrichSKD4] Length = 378 Score = 43.1 bits (100), Expect = 0.012, Method: Composition-based stats. Identities = 18/33 (54%), Positives = 25/33 (75%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGG+D LYPP++ LL + + GG AI+E+PFG Sbjct: 177 AGGIDILYPPDHAGLLSSLLERGGNAITEMPFG 209 >gi|153010990|ref|YP_001372204.1| DNA protecting protein DprA [Ochrobactrum anthropi ATCC 49188] gi|151562878|gb|ABS16375.1| DNA protecting protein DprA [Ochrobactrum anthropi ATCC 49188] Length = 388 Score = 42.7 bits (99), Expect = 0.015, Method: Compositional matrix adjust. Identities = 20/34 (58%), Positives = 23/34 (67%) Query: 1 [protein fragment, 34 aa] 34 +AGGLDC YPPEN L I + GG ISE+P G Sbjct: 178 LAGGLDCPYPPENLPLYHAIPEQGGALISEMPMG 211 >gi|163759336|ref|ZP_02166422.1| putative smf protein [Hoeflea phototrophica DFL-43] gi|162283740|gb|EDQ34025.1| putative smf protein [Hoeflea phototrophica DFL-43] Length = 383 Score = 42.7 bits (99), Expect = 0.017, Method: Composition-based stats. Identities = 20/34 (58%), Positives = 25/34 (73%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YPPEN +L +EI G+AISE+P G Sbjct: 178 LAGGLDQPYPPENLDLYDEIRAGKGLAISEMPMG 211 >gi|115525378|ref|YP_782289.1| DNA processing protein DprA, putative [Rhodopseudomonas palustris BisA53] gi|115519325|gb|ABJ07309.1| DNA protecting protein DprA [Rhodopseudomonas palustris BisA53] Length = 372 Score = 42.7 bits (99), Expect = 0.018, Method: Composition-based stats. Identities = 19/34 (55%), Positives = 25/34 (73%) Query: 1 [protein fragment, 34 aa] 34 +AGG D +YPPE+ +LL +I GG AISE+P G Sbjct: 175 LAGGHDRIYPPEHEDLLADILAQGGAAISEMPLG 208 >gi|319783706|ref|YP_004143182.1| DNA protecting protein DprA [Mesorhizobium ciceri biovar biserrulae WSM1271] gi|317169594|gb|ADV13132.1| DNA protecting protein DprA [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 379 Score = 42.4 bits (98), Expect = 0.020, Method: Compositional matrix adjust. Identities = 22/34 (64%), Positives = 25/34 (73%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YPPEN L EEI + G I ISE+PFG Sbjct: 175 LAGGLDQPYPPENAGLCEEIAERGAI-ISEMPFG 207 >gi|299135144|ref|ZP_07028335.1| DNA protecting protein DprA [Afipia sp. 1NLS2] gi|298590121|gb|EFI50325.1| DNA protecting protein DprA [Afipia sp. 1NLS2] Length = 373 Score = 42.4 bits (98), Expect = 0.022, Method: Compositional matrix adjust. Identities = 20/34 (58%), Positives = 24/34 (70%) Query: 1 [protein fragment, 34 aa] 34 +AGG D +YPPE+ LL I D GG AISE+P G Sbjct: 176 LAGGHDRIYPPEHEGLLAAIIDAGGGAISEMPLG 209 >gi|325290385|ref|YP_004266566.1| DNA protecting protein DprA [Syntrophobotulus glycolicus DSM 8271] gi|324965786|gb|ADY56565.1| DNA protecting protein DprA [Syntrophobotulus glycolicus DSM 8271] Length = 383 Score = 41.6 bits (96), Expect = 0.039, Method: Compositional matrix adjust. Identities = 21/34 (61%), Positives = 25/34 (73%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD +YPPENR L EI +NG + ISE P G Sbjct: 172 LAGGLDRIYPPENRKLAAEIIENGAL-ISEYPPG 204 >gi|163792865|ref|ZP_02186841.1| Predicted Rossmann fold nucleotide-binding protein [alpha proteobacterium BAL199] gi|159181511|gb|EDP66023.1| Predicted Rossmann fold nucleotide-binding protein [alpha proteobacterium BAL199] Length = 379 Score = 41.2 bits (95), Expect = 0.043, Method: Composition-based stats. Identities = 18/34 (52%), Positives = 27/34 (79%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGG+D YPPE+ LL++I +N GIA++E+P G Sbjct: 173 LAGGIDVTYPPEHAGLLQQIVEN-GIAVAEMPVG 205 >gi|260459178|ref|ZP_05807433.1| DNA protecting protein DprA [Mesorhizobium opportunistum WSM2075] gi|259034732|gb|EEW35988.1| DNA protecting protein DprA [Mesorhizobium opportunistum WSM2075] Length = 383 Score = 41.2 bits (95), Expect = 0.047, Method: Compositional matrix adjust. Identities = 20/34 (58%), Positives = 25/34 (73%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YPPEN L +EI + G + ISE+PFG Sbjct: 182 LAGGLDLPYPPENAGLCDEIAERGAV-ISEMPFG 214 >gi|260427296|ref|ZP_05781275.1| protein smf [Citreicella sp. SE45] gi|260421788|gb|EEX15039.1| protein smf [Citreicella sp. SE45] Length = 398 Score = 41.2 bits (95), Expect = 0.048, Method: Composition-based stats. Identities = 19/34 (55%), Positives = 22/34 (64%) Query: 1 [protein fragment, 34 aa] 34 +AGG+D LYP EN L EEI GG +SE P G Sbjct: 182 LAGGVDVLYPSENTRLAEEIRAQGGAVVSEQPIG 215 >gi|118590183|ref|ZP_01547586.1| hypothetical protein SIAM614_11733 [Stappia aggregata IAM 12614] gi|118437155|gb|EAV43793.1| hypothetical protein SIAM614_11733 [Stappia aggregata IAM 12614] Length = 378 Score = 40.8 bits (94), Expect = 0.057, Method: Composition-based stats. Identities = 17/33 (51%), Positives = 23/33 (69%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGG++ LYPPE+ LL + + GG ISE+P G Sbjct: 177 AGGINVLYPPEHDRLLAAVLETGGAVISEMPLG 209 >gi|225677140|ref|ZP_03788139.1| DNA processing chain A [Wolbachia endosymbiont of Muscidifurax uniraptor] gi|225590807|gb|EEH12035.1| DNA processing chain A [Wolbachia endosymbiont of Muscidifurax uniraptor] Length = 362 Score = 40.8 bits (94), Expect = 0.059, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 25/33 (75%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 A G+D +YP EN +L ++I +NGG+ ++E+PF Sbjct: 164 ASGIDVVYPKENFDLYKKITENGGLVVTELPFA 196 >gi|254501021|ref|ZP_05113172.1| DNA protecting protein DprA, putative [Labrenzia alexandrii DFL-11] gi|222437092|gb|EEE43771.1| DNA protecting protein DprA, putative [Labrenzia alexandrii DFL-11] Length = 378 Score = 40.8 bits (94), Expect = 0.062, Method: Composition-based stats. Identities = 18/33 (54%), Positives = 22/33 (66%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGG+D LYP ++ LL I GG ISE+PFG Sbjct: 177 AGGIDVLYPSDHDRLLAAILQTGGAVISEMPFG 209 >gi|220929474|ref|YP_002506383.1| DNA protecting protein DprA [Clostridium cellulolyticum H10] gi|219999802|gb|ACL76403.1| DNA protecting protein DprA [Clostridium cellulolyticum H10] Length = 374 Score = 40.8 bits (94), Expect = 0.062, Method: Compositional matrix adjust. Identities = 18/34 (52%), Positives = 25/34 (73%) Query: 1 [protein fragment, 34 aa] 34 + GLD +YPPEN L ++I D+GG+A+SE P G Sbjct: 171 LGSGLDNIYPPENAGLFKDIIDSGGLALSEYPPG 204 >gi|303231443|ref|ZP_07318174.1| DNA protecting protein DprA [Veillonella atypica ACS-049-V-Sch6] gi|302513880|gb|EFL55891.1| DNA protecting protein DprA [Veillonella atypica ACS-049-V-Sch6] Length = 378 Score = 40.8 bits (94), Expect = 0.071, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 22/34 (64%) Query: 1 [protein fragment, 34 aa] 34 M GLD +YPPEN+ L + + N G+ +SE P G Sbjct: 180 MGCGLDIVYPPENKRLFDAVLKNNGLLVSEYPPG 213 >gi|303228920|ref|ZP_07315730.1| DNA protecting protein DprA [Veillonella atypica ACS-134-V-Col7a] gi|302516334|gb|EFL58266.1| DNA protecting protein DprA [Veillonella atypica ACS-134-V-Col7a] Length = 378 Score = 40.4 bits (93), Expect = 0.073, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 22/34 (64%) Query: 1 [protein fragment, 34 aa] 34 M GLD +YPPEN+ L + + N G+ +SE P G Sbjct: 180 MGCGLDIVYPPENKRLFDAVLKNNGLLVSEYPPG 213 >gi|294678614|ref|YP_003579229.1| DNA protecting protein DprA [Rhodobacter capsulatus SB 1003] gi|294477434|gb|ADE86822.1| DNA protecting protein DprA [Rhodobacter capsulatus SB 1003] Length = 383 Score = 40.4 bits (93), Expect = 0.078, Method: Composition-based stats. Identities = 19/34 (55%), Positives = 25/34 (73%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 MAGGLD +YPPENR+L I GG+ ++E+P G Sbjct: 180 MAGGLDVIYPPENRDLASRI-ATGGLLLAELPPG 212 >gi|90423747|ref|YP_532117.1| DNA processing protein DprA, putative [Rhodopseudomonas palustris BisB18] gi|90105761|gb|ABD87798.1| DNA processing protein DprA, putative [Rhodopseudomonas palustris BisB18] Length = 372 Score = 40.4 bits (93), Expect = 0.085, Method: Composition-based stats. Identities = 19/34 (55%), Positives = 23/34 (67%) Query: 1 [protein fragment, 34 aa] 34 +AGG D +YPPE+ LL I GG AISE+P G Sbjct: 175 LAGGHDKIYPPEHDELLAAILGEGGAAISEMPLG 208 >gi|13470875|ref|NP_102444.1| DNA processing chain A [Mesorhizobium loti MAFF303099] gi|14021618|dbj|BAB48230.1| DNA processing chain A [Mesorhizobium loti MAFF303099] Length = 377 Score = 40.4 bits (93), Expect = 0.086, Method: Compositional matrix adjust. Identities = 20/34 (58%), Positives = 24/34 (70%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YPPEN L EI + G + ISE+PFG Sbjct: 175 LAGGLDLPYPPENAGLCAEIAERGAV-ISEMPFG 207 >gi|58698108|ref|ZP_00373031.1| DNA processing chain A [Wolbachia endosymbiont of Drosophila ananassae] gi|58535354|gb|EAL59430.1| DNA processing chain A [Wolbachia endosymbiont of Drosophila ananassae] Length = 346 Score = 40.4 bits (93), Expect = 0.088, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 24/33 (72%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 A G+D +YP EN +L ++I NGG+ I+E+PF Sbjct: 148 ASGIDVVYPKENFDLYKKITGNGGLVITELPFA 180 >gi|58696725|ref|ZP_00372270.1| DNA processing chain A [Wolbachia endosymbiont of Drosophila simulans] gi|225630004|ref|YP_002726795.1| DNA processing chain A [Wolbachia sp. wRi] gi|58537093|gb|EAL60213.1| DNA processing chain A [Wolbachia endosymbiont of Drosophila simulans] gi|225591985|gb|ACN95004.1| DNA processing chain A [Wolbachia sp. wRi] Length = 362 Score = 40.4 bits (93), Expect = 0.089, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 24/33 (72%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 A G+D +YP EN +L ++I NGG+ I+E+PF Sbjct: 164 ASGIDVVYPKENFDLYKKITGNGGLVITELPFA 196 >gi|254796757|ref|YP_003081593.1| DNA processing chain A [Neorickettsia risticii str. Illinois] gi|254590002|gb|ACT69364.1| DNA processing chain A [Neorickettsia risticii str. Illinois] Length = 375 Score = 40.0 bits (92), Expect = 0.099, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 22/31 (70%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D YP EN+ L E I + GG+ ++E+PFG Sbjct: 170 GIDQCYPTENQKLQERIIERGGLVVTEVPFG 200 >gi|163844754|ref|YP_001622409.1| DNA protecting protein DprA [Brucella suis ATCC 23445] gi|163675477|gb|ABY39587.1| DNA protecting protein DprA [Brucella suis ATCC 23445] Length = 393 Score = 40.0 bits (92), Expect = 0.10, Method: Compositional matrix adjust. Identities = 19/34 (55%), Positives = 23/34 (67%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YPPEN L I +NGG I+E+P G Sbjct: 178 LAGGLDRPYPPENLPLYRAIPENGGALITEVPMG 211 >gi|255263932|ref|ZP_05343274.1| DNA protecting protein DprA [Thalassiobium sp. R2A62] gi|255106267|gb|EET48941.1| DNA protecting protein DprA [Thalassiobium sp. R2A62] Length = 197 Score = 40.0 bits (92), Expect = 0.11, Method: Composition-based stats. Identities = 18/34 (52%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 MAGG+DC+YP EN L +I N G+ +SE P G Sbjct: 153 MAGGVDCIYPSENTELARKIAQN-GVRVSEQPIG 185 >gi|73666848|ref|YP_302864.1| SMF protein [Ehrlichia canis str. Jake] gi|72393989|gb|AAZ68266.1| SMF protein [Ehrlichia canis str. Jake] Length = 374 Score = 40.0 bits (92), Expect = 0.11, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 23/34 (67%) Query: 1 [protein fragment, 34 aa] 34 MA G++ +YP EN +L + I D GG+ I+E PF Sbjct: 174 MASGINIVYPQENTHLYKTIIDKGGLIITEFPFA 207 >gi|42520001|ref|NP_965916.1| DNA processing chain A [Wolbachia endosymbiont of Drosophila melanogaster] gi|42409738|gb|AAS13850.1| DNA processing chain A [Wolbachia endosymbiont of Drosophila melanogaster] Length = 362 Score = 40.0 bits (92), Expect = 0.11, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 24/33 (72%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 A G+D +YP EN +L ++I NGG+ I+E+PF Sbjct: 164 ASGIDVVYPKENFDLYKKITGNGGLVITELPFA 196 >gi|258541853|ref|YP_003187286.1| DNA processing chain A SMF [Acetobacter pasteurianus IFO 3283-01] gi|256632931|dbj|BAH98906.1| DNA processing chain A SMF [Acetobacter pasteurianus IFO 3283-01] gi|256635988|dbj|BAI01957.1| DNA processing chain A SMF [Acetobacter pasteurianus IFO 3283-03] gi|256639043|dbj|BAI05005.1| DNA processing chain A SMF [Acetobacter pasteurianus IFO 3283-07] gi|256642097|dbj|BAI08052.1| DNA processing chain A SMF [Acetobacter pasteurianus IFO 3283-22] gi|256645152|dbj|BAI11100.1| DNA processing chain A SMF [Acetobacter pasteurianus IFO 3283-26] gi|256648207|dbj|BAI14148.1| DNA processing chain A SMF [Acetobacter pasteurianus IFO 3283-32] gi|256651260|dbj|BAI17194.1| DNA processing chain A SMF [Acetobacter pasteurianus IFO 3283-01-42C] gi|256654251|dbj|BAI20178.1| DNA processing chain A SMF [Acetobacter pasteurianus IFO 3283-12] Length = 208 Score = 39.7 bits (91), Expect = 0.13, Method: Composition-based stats. Identities = 18/34 (52%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGGLDC YPPEN +L EI G + ++E P G Sbjct: 164 IAGGLDCPYPPENASLQAEIAQKGAV-VTEAPLG 196 >gi|329114375|ref|ZP_08243137.1| Protein Smf [Acetobacter pomorum DM001] gi|326696451|gb|EGE48130.1| Protein Smf [Acetobacter pomorum DM001] Length = 412 Score = 39.7 bits (91), Expect = 0.14, Method: Composition-based stats. Identities = 18/34 (52%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGGLDC YPPEN +L EI G + ++E P G Sbjct: 164 IAGGLDCPYPPENASLQAEIAQKGAV-VTEAPLG 196 >gi|92117808|ref|YP_577537.1| DNA processing protein DprA, putative [Nitrobacter hamburgensis X14] gi|91800702|gb|ABE63077.1| DNA processing protein DprA, putative [Nitrobacter hamburgensis X14] Length = 372 Score = 39.7 bits (91), Expect = 0.14, Method: Compositional matrix adjust. Identities = 19/34 (55%), Positives = 26/34 (76%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGG D +YPPE+ +LL I ++GG AISE+P G Sbjct: 175 LAGGHDRIYPPEHEDLLAAILEDGG-AISEMPMG 207 >gi|190571736|ref|YP_001976094.1| DNA processing chain A [Wolbachia endosymbiont of Culex quinquefasciatus Pel] gi|213019224|ref|ZP_03335031.1| DNA processing chain A [Wolbachia endosymbiont of Culex quinquefasciatus JHB] gi|190358008|emb|CAQ55476.1| DNA processing chain A [Wolbachia endosymbiont of Culex quinquefasciatus Pel] gi|212995333|gb|EEB55974.1| DNA processing chain A [Wolbachia endosymbiont of Culex quinquefasciatus JHB] Length = 361 Score = 39.7 bits (91), Expect = 0.14, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 25/33 (75%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 A G+D +YP EN +L ++I +NGG+ ++E+PF Sbjct: 163 ASGIDVVYPRENFDLYKKITENGGLVMTELPFA 195 >gi|306841750|ref|ZP_07474436.1| DNA protecting protein DprA [Brucella sp. BO2] gi|306288155|gb|EFM59542.1| DNA protecting protein DprA [Brucella sp. BO2] Length = 345 Score = 39.7 bits (91), Expect = 0.15, Method: Compositional matrix adjust. Identities = 19/34 (55%), Positives = 23/34 (67%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YPPEN L I +NGG I+E+P G Sbjct: 130 LAGGLDRPYPPENLPLYRAIPENGGALITEMPMG 163 >gi|260756634|ref|ZP_05868982.1| DNA protecting protein DprA [Brucella abortus bv. 6 str. 870] gi|260676742|gb|EEX63563.1| DNA protecting protein DprA [Brucella abortus bv. 6 str. 870] Length = 343 Score = 39.7 bits (91), Expect = 0.15, Method: Compositional matrix adjust. Identities = 19/34 (55%), Positives = 23/34 (67%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YPPEN L I +NGG I+E+P G Sbjct: 128 LAGGLDRPYPPENLPLYRAIPENGGALITEMPMG 161 >gi|294853600|ref|ZP_06794272.1| DNA processing protein [Brucella sp. NVSL 07-0026] gi|294819255|gb|EFG36255.1| DNA processing protein [Brucella sp. NVSL 07-0026] Length = 393 Score = 39.3 bits (90), Expect = 0.16, Method: Compositional matrix adjust. Identities = 19/34 (55%), Positives = 23/34 (67%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YPPEN L I +NGG I+E+P G Sbjct: 178 LAGGLDRPYPPENLPLYRAIPENGGALITEMPMG 211 >gi|256111481|ref|ZP_05452495.1| SMF protein [Brucella melitensis bv. 3 str. Ether] gi|265992978|ref|ZP_06105535.1| DNA protecting protein DprA [Brucella melitensis bv. 3 str. Ether] gi|262763848|gb|EEZ09880.1| DNA protecting protein DprA [Brucella melitensis bv. 3 str. Ether] Length = 388 Score = 39.3 bits (90), Expect = 0.17, Method: Compositional matrix adjust. Identities = 19/34 (55%), Positives = 23/34 (67%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YPPEN L I +NGG I+E+P G Sbjct: 178 LAGGLDRPYPPENLPLYRAIPENGGALITEMPMG 211 >gi|254695655|ref|ZP_05157483.1| SMF protein [Brucella abortus bv. 3 str. Tulya] gi|261216055|ref|ZP_05930336.1| DNA protecting protein DprA [Brucella abortus bv. 3 str. Tulya] gi|260917662|gb|EEX84523.1| DNA protecting protein DprA [Brucella abortus bv. 3 str. Tulya] Length = 393 Score = 39.3 bits (90), Expect = 0.17, Method: Compositional matrix adjust. Identities = 19/34 (55%), Positives = 23/34 (67%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YPPEN L I +NGG I+E+P G Sbjct: 178 LAGGLDRPYPPENLPLYRAIPENGGALITEMPMG 211 >gi|17989012|ref|NP_541645.1| SMF protein [Brucella melitensis bv. 1 str. 16M] gi|62317541|ref|YP_223394.1| DNA processing protein DprA [Brucella abortus bv. 1 str. 9-941] gi|83269522|ref|YP_418813.1| SMF protein [Brucella melitensis biovar Abortus 2308] gi|189022796|ref|YP_001932537.1| SMF protein [Brucella abortus S19] gi|225629094|ref|ZP_03787127.1| DNA protecting protein DprA [Brucella ceti str. Cudo] gi|237817089|ref|ZP_04596081.1| DNA protecting protein DprA [Brucella abortus str. 2308 A] gi|254698822|ref|ZP_05160650.1| SMF protein [Brucella abortus bv. 2 str. 86/8/59] gi|254705901|ref|ZP_05167729.1| SMF protein [Brucella pinnipedialis M163/99/10] gi|254711129|ref|ZP_05172940.1| SMF protein [Brucella pinnipedialis B2/94] gi|254712412|ref|ZP_05174223.1| SMF protein [Brucella ceti M644/93/1] gi|254715484|ref|ZP_05177295.1| SMF protein [Brucella ceti M13/05/1] gi|254732269|ref|ZP_05190847.1| SMF protein [Brucella abortus bv. 4 str. 292] gi|256015379|ref|YP_003105388.1| DNA processing protein DprA, putative [Brucella microti CCM 4915] gi|256029510|ref|ZP_05443124.1| SMF protein [Brucella pinnipedialis M292/94/1] gi|256043499|ref|ZP_05446426.1| SMF protein [Brucella melitensis bv. 1 str. Rev.1] gi|256059205|ref|ZP_05449411.1| SMF protein [Brucella neotomae 5K33] gi|256157705|ref|ZP_05455623.1| SMF protein [Brucella ceti M490/95/1] gi|256253323|ref|ZP_05458859.1| SMF protein [Brucella ceti B1/94] gi|256256223|ref|ZP_05461759.1| SMF protein [Brucella abortus bv. 9 str. C68] gi|260167399|ref|ZP_05754210.1| DNA processing protein DprA, putative [Brucella sp. F5/99] gi|260544777|ref|ZP_05820598.1| SMF protein [Brucella abortus NCTC 8038] gi|260564694|ref|ZP_05835179.1| SMF protein [Brucella melitensis bv. 1 str. 16M] gi|260760064|ref|ZP_05872412.1| DNA protecting protein DprA [Brucella abortus bv. 4 str. 292] gi|260763303|ref|ZP_05875635.1| DNA protecting protein DprA [Brucella abortus bv. 2 str. 86/8/59] gi|260882451|ref|ZP_05894065.1| DNA protecting protein DprA [Brucella abortus bv. 9 str. C68] gi|261217219|ref|ZP_05931500.1| DNA protecting protein DprA [Brucella ceti M13/05/1] gi|261220439|ref|ZP_05934720.1| DNA protecting protein DprA [Brucella ceti B1/94] gi|261313331|ref|ZP_05952528.1| DNA protecting protein DprA [Brucella pinnipedialis M163/99/10] gi|261318720|ref|ZP_05957917.1| DNA protecting protein DprA [Brucella pinnipedialis B2/94] gi|261320090|ref|ZP_05959287.1| DNA protecting protein DprA [Brucella ceti M644/93/1] gi|261323154|ref|ZP_05962351.1| DNA protecting protein DprA [Brucella neotomae 5K33] gi|261756809|ref|ZP_06000518.1| SMF protein [Brucella sp. F5/99] gi|265986518|ref|ZP_06099075.1| DNA protecting protein DprA [Brucella pinnipedialis M292/94/1] gi|265989917|ref|ZP_06102474.1| DNA protecting protein DprA [Brucella melitensis bv. 1 str. Rev.1] gi|265996210|ref|ZP_06108767.1| DNA protecting protein DprA [Brucella ceti M490/95/1] gi|297249580|ref|ZP_06933281.1| DNA processing protein [Brucella abortus bv. 5 str. B3196] gi|17984851|gb|AAL53909.1| smf protein [Brucella melitensis bv. 1 str. 16M] gi|62197734|gb|AAX76033.1| hypothetical DprA, DNA processing protein [Brucella abortus bv. 1 str. 9-941] gi|82939796|emb|CAJ12804.1| SMF protein [Brucella melitensis biovar Abortus 2308] gi|189021370|gb|ACD74091.1| SMF protein [Brucella abortus S19] gi|225615590|gb|EEH12639.1| DNA protecting protein DprA [Brucella ceti str. Cudo] gi|237787902|gb|EEP62118.1| DNA protecting protein DprA [Brucella abortus str. 2308 A] gi|255998039|gb|ACU49726.1| DNA processing protein DprA, putative [Brucella microti CCM 4915] gi|260098048|gb|EEW81922.1| SMF protein [Brucella abortus NCTC 8038] gi|260152337|gb|EEW87430.1| SMF protein [Brucella melitensis bv. 1 str. 16M] gi|260670382|gb|EEX57322.1| DNA protecting protein DprA [Brucella abortus bv. 4 str. 292] gi|260673724|gb|EEX60545.1| DNA protecting protein DprA [Brucella abortus bv. 2 str. 86/8/59] gi|260871979|gb|EEX79048.1| DNA protecting protein DprA [Brucella abortus bv. 9 str. C68] gi|260919023|gb|EEX85676.1| DNA protecting protein DprA [Brucella ceti B1/94] gi|260922308|gb|EEX88876.1| DNA protecting protein DprA [Brucella ceti M13/05/1] gi|261292780|gb|EEX96276.1| DNA protecting protein DprA [Brucella ceti M644/93/1] gi|261297943|gb|EEY01440.1| DNA protecting protein DprA [Brucella pinnipedialis B2/94] gi|261299134|gb|EEY02631.1| DNA protecting protein DprA [Brucella neotomae 5K33] gi|261302357|gb|EEY05854.1| DNA protecting protein DprA [Brucella pinnipedialis M163/99/10] gi|261736793|gb|EEY24789.1| SMF protein [Brucella sp. F5/99] gi|262550507|gb|EEZ06668.1| DNA protecting protein DprA [Brucella ceti M490/95/1] gi|263000586|gb|EEZ13276.1| DNA protecting protein DprA [Brucella melitensis bv. 1 str. Rev.1] gi|264658715|gb|EEZ28976.1| DNA protecting protein DprA [Brucella pinnipedialis M292/94/1] gi|297173449|gb|EFH32813.1| DNA processing protein [Brucella abortus bv. 5 str. B3196] Length = 393 Score = 39.3 bits (90), Expect = 0.17, Method: Compositional matrix adjust. Identities = 19/34 (55%), Positives = 23/34 (67%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YPPEN L I +NGG I+E+P G Sbjct: 178 LAGGLDRPYPPENLPLYRAIPENGGALITEMPMG 211 >gi|259046716|ref|ZP_05737117.1| DNA processing chain A [Granulicatella adiacens ATCC 49175] gi|259036612|gb|EEW37867.1| DNA processing chain A [Granulicatella adiacens ATCC 49175] Length = 288 Score = 39.3 bits (90), Expect = 0.17, Method: Composition-based stats. Identities = 19/34 (55%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + GLD +YPPEN NL +EI + G I ISE P G Sbjct: 169 IGSGLDVVYPPENANLYKEIGEKGLI-ISEYPLG 201 >gi|254699839|ref|ZP_05161667.1| SMF protein [Brucella suis bv. 5 str. 513] gi|261750312|ref|ZP_05994021.1| DNA protecting protein DprA [Brucella suis bv. 5 str. 513] gi|261740065|gb|EEY27991.1| DNA protecting protein DprA [Brucella suis bv. 5 str. 513] Length = 393 Score = 39.3 bits (90), Expect = 0.17, Method: Compositional matrix adjust. Identities = 19/34 (55%), Positives = 23/34 (67%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YPPEN L I +NGG I+E+P G Sbjct: 178 LAGGLDRPYPPENLPLYRAIPENGGALITEMPMG 211 >gi|225686388|ref|YP_002734360.1| DNA protecting protein DprA [Brucella melitensis ATCC 23457] gi|256262471|ref|ZP_05465003.1| SMF protein [Brucella melitensis bv. 2 str. 63/9] gi|225642493|gb|ACO02406.1| DNA protecting protein DprA [Brucella melitensis ATCC 23457] gi|263092207|gb|EEZ16504.1| SMF protein [Brucella melitensis bv. 2 str. 63/9] Length = 393 Score = 39.3 bits (90), Expect = 0.17, Method: Compositional matrix adjust. Identities = 19/34 (55%), Positives = 23/34 (67%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YPPEN L I +NGG I+E+P G Sbjct: 178 LAGGLDRPYPPENLPLYRAIPENGGALITEMPMG 211 >gi|23500346|ref|NP_699786.1| DNA processing protein DprA [Brucella suis 1330] gi|161620664|ref|YP_001594550.1| DNA protecting protein DprA [Brucella canis ATCC 23365] gi|254702977|ref|ZP_05164805.1| DNA protecting protein DprA [Brucella suis bv. 3 str. 686] gi|260568110|ref|ZP_05838579.1| SMF protein [Brucella suis bv. 4 str. 40] gi|261753586|ref|ZP_05997295.1| DNA protecting protein DprA [Brucella suis bv. 3 str. 686] gi|23463962|gb|AAN33791.1| DNA processing protein DprA, putative [Brucella suis 1330] gi|161337475|gb|ABX63779.1| DNA protecting protein DprA [Brucella canis ATCC 23365] gi|260154775|gb|EEW89856.1| SMF protein [Brucella suis bv. 4 str. 40] gi|261743339|gb|EEY31265.1| DNA protecting protein DprA [Brucella suis bv. 3 str. 686] Length = 393 Score = 39.3 bits (90), Expect = 0.17, Method: Compositional matrix adjust. Identities = 19/34 (55%), Positives = 23/34 (67%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YPPEN L I +NGG I+E+P G Sbjct: 178 LAGGLDRPYPPENLPLYRAIPENGGALITEMPMG 211 >gi|254691038|ref|ZP_05154292.1| SMF protein [Brucella abortus bv. 6 str. 870] Length = 381 Score = 39.3 bits (90), Expect = 0.17, Method: Compositional matrix adjust. Identities = 19/34 (55%), Positives = 23/34 (67%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YPPEN L I +NGG I+E+P G Sbjct: 166 LAGGLDRPYPPENLPLYRAIPENGGALITEMPMG 199 >gi|88608661|ref|YP_506277.1| putative DNA processing protein DprA [Neorickettsia sennetsu str. Miyayama] gi|88600830|gb|ABD46298.1| putative DNA processing protein DprA [Neorickettsia sennetsu str. Miyayama] Length = 378 Score = 39.3 bits (90), Expect = 0.17, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 22/31 (70%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D YP EN+ L E I + GG+ ++E+PFG Sbjct: 170 GIDQCYPIENQRLQERIIERGGLVVTEVPFG 200 >gi|254720411|ref|ZP_05182222.1| SMF protein [Brucella sp. 83/13] gi|265985430|ref|ZP_06098165.1| DNA protecting protein DprA [Brucella sp. 83/13] gi|306839012|ref|ZP_07471833.1| DNA protecting protein DprA [Brucella sp. NF 2653] gi|264664022|gb|EEZ34283.1| DNA protecting protein DprA [Brucella sp. 83/13] gi|306405918|gb|EFM62176.1| DNA protecting protein DprA [Brucella sp. NF 2653] Length = 393 Score = 39.3 bits (90), Expect = 0.17, Method: Compositional matrix adjust. Identities = 19/34 (55%), Positives = 23/34 (67%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YPPEN L I +NGG I+E+P G Sbjct: 178 LAGGLDRPYPPENLPLYRAIPENGGALITEMPMG 211 >gi|306845936|ref|ZP_07478503.1| DNA protecting protein DprA [Brucella sp. BO1] gi|306273571|gb|EFM55416.1| DNA protecting protein DprA [Brucella sp. BO1] Length = 393 Score = 39.3 bits (90), Expect = 0.18, Method: Compositional matrix adjust. Identities = 19/34 (55%), Positives = 23/34 (67%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YPPEN L I +NGG I+E+P G Sbjct: 178 LAGGLDRPYPPENLPLYRAIPENGGALITEMPMG 211 >gi|225849802|ref|YP_002730036.1| protein smf (DNA-processing chain A) [Persephonella marina EX-H1] gi|225645083|gb|ACO03269.1| protein smf (DNA-processing chain A) [Persephonella marina EX-H1] Length = 352 Score = 39.3 bits (90), Expect = 0.21, Method: Composition-based stats. Identities = 17/31 (54%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D YPPEN+ L E I +NG + ISE P G Sbjct: 172 GIDIAYPPENKKLYERIIENGAV-ISEFPMG 201 >gi|237795718|ref|YP_002863270.1| DNA uptake protein [Clostridium botulinum Ba4 str. 657] gi|229261789|gb|ACQ52822.1| DNA uptake protein [Clostridium botulinum Ba4 str. 657] Length = 385 Score = 39.3 bits (90), Expect = 0.21, Method: Composition-based stats. Identities = 18/34 (52%), Positives = 22/34 (64%) Query: 1 [protein fragment, 34 aa] 34 +A GLD +YP EN L + I +NGG ISE P G Sbjct: 178 LAHGLDMIYPRENIELSKSILNNGGTLISEYPVG 211 >gi|91977499|ref|YP_570158.1| DNA processing protein DprA, putative [Rhodopseudomonas palustris BisB5] gi|91683955|gb|ABE40257.1| DNA processing protein DprA, putative [Rhodopseudomonas palustris BisB5] Length = 422 Score = 38.9 bits (89), Expect = 0.22, Method: Composition-based stats. Identities = 18/34 (52%), Positives = 25/34 (73%) Query: 1 [protein fragment, 34 aa] 34 +AGG D +YPPE+ +LL +I + G AISE+P G Sbjct: 225 LAGGHDKIYPPEHEDLLLDIVEARGAAISEMPLG 258 >gi|91205528|ref|YP_537883.1| putative DNA processing protein DprA [Rickettsia bellii RML369-C] gi|91069072|gb|ABE04794.1| Putative DNA processing protein DprA [Rickettsia bellii RML369-C] Length = 225 Score = 38.9 bits (89), Expect = 0.23, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 25/34 (73%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGG+D +YPPEN+ L E + + G I I+E+P G Sbjct: 13 IAGGIDHIYPPENKKLFENLAEEGLI-IAELPVG 45 >gi|157827244|ref|YP_001496308.1| putative DNA processing protein DprA [Rickettsia bellii OSU 85-389] gi|157802548|gb|ABV79271.1| Putative DNA processing protein DprA [Rickettsia bellii OSU 85-389] Length = 223 Score = 38.9 bits (89), Expect = 0.24, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 25/34 (73%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGG+D +YPPEN+ L E + + G I I+E+P G Sbjct: 13 IAGGIDHIYPPENKKLFENLAEEGLI-IAELPVG 45 >gi|326410760|gb|ADZ67824.1| DNA protecting protein DprA [Brucella melitensis M28] gi|326554052|gb|ADZ88691.1| DNA protecting protein DprA [Brucella melitensis M5-90] Length = 393 Score = 38.9 bits (89), Expect = 0.24, Method: Compositional matrix adjust. Identities = 19/34 (55%), Positives = 22/34 (64%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YPPEN L I NGG I+E+P G Sbjct: 178 LAGGLDRPYPPENLPLYRAIPKNGGALITEMPMG 211 >gi|148256077|ref|YP_001240662.1| DNA processing chain A (DprA/Smf) [Bradyrhizobium sp. BTAi1] gi|146408250|gb|ABQ36756.1| DNA processing chain A (DprA/Smf) [Bradyrhizobium sp. BTAi1] Length = 372 Score = 38.9 bits (89), Expect = 0.27, Method: Composition-based stats. Identities = 18/34 (52%), Positives = 24/34 (70%) Query: 1 [protein fragment, 34 aa] 34 +AGG D +YPPE+ +LL I + G AISE+P G Sbjct: 175 LAGGHDRIYPPEHIDLLGAIVERNGAAISEMPLG 208 >gi|315648145|ref|ZP_07901246.1| DNA protecting protein DprA [Paenibacillus vortex V453] gi|315276791|gb|EFU40134.1| DNA protecting protein DprA [Paenibacillus vortex V453] Length = 391 Score = 38.5 bits (88), Expect = 0.33, Method: Composition-based stats. Identities = 18/34 (52%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YPPENR+L EEI G+ ISE P G Sbjct: 190 LGAGIDVIYPPENRSLYEEIAAK-GLVISEYPPG 222 >gi|320108287|ref|YP_004183877.1| DNA protecting protein DprA [Terriglobus saanensis SP1PR4] gi|319926808|gb|ADV83883.1| DNA protecting protein DprA [Terriglobus saanensis SP1PR4] Length = 410 Score = 38.5 bits (88), Expect = 0.34, Method: Composition-based stats. Identities = 16/31 (51%), Positives = 20/31 (64%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP EN+ L EEI GG +SE P G Sbjct: 201 GIDVIYPKENKRLAEEILQGGGAIVSEYPLG 231 >gi|88657722|ref|YP_507678.1| putative DNA processing protein DprA [Ehrlichia chaffeensis str. Arkansas] gi|88599179|gb|ABD44648.1| putative DNA processing protein DprA [Ehrlichia chaffeensis str. Arkansas] Length = 375 Score = 38.5 bits (88), Expect = 0.35, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 22/33 (66%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 MA G++ +YP EN +L I D GG+ I+E PF Sbjct: 174 MASGVNIVYPQENIHLYNTIVDKGGLIITEFPF 206 >gi|312897996|ref|ZP_07757405.1| DNA protecting protein DprA [Megasphaera micronuciformis F0359] gi|310620921|gb|EFQ04472.1| DNA protecting protein DprA [Megasphaera micronuciformis F0359] Length = 367 Score = 38.1 bits (87), Expect = 0.39, Method: Composition-based stats. Identities = 17/33 (51%), Positives = 18/33 (54%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD YPPEN L I GG+ SE PFG Sbjct: 177 GAGLDKTYPPENAALFRRIIGAGGVVCSEFPFG 209 >gi|262089745|gb|ACY24839.1| Smf protein [uncultured organism] Length = 382 Score = 38.1 bits (87), Expect = 0.41, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 22/34 (64%) Query: 1 [protein fragment, 34 aa] 34 M GLD +YP +R L ++I D GG +SE+P G Sbjct: 179 MGTGLDMIYPSRHRALAQQIVDIGGALVSELPLG 212 >gi|255002940|ref|ZP_05277904.1| DNA processing protein, chain A dprA (smf) [Anaplasma marginale str. Puerto Rico] gi|255004065|ref|ZP_05278866.1| DNA processing protein, chain A dprA (smf) [Anaplasma marginale str. Virginia] Length = 354 Score = 38.1 bits (87), Expect = 0.41, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 22/32 (68%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 A G+D +YP +N +L I NGG+ ++E+PF Sbjct: 153 ASGIDVVYPKDNLHLYRAIVHNGGVVVTELPF 184 >gi|56416598|ref|YP_153672.1| DNA processing protein, chain A [Anaplasma marginale str. St. Maries] gi|222474964|ref|YP_002563379.1| DNA processing protein, chain A dprA (smf) [Anaplasma marginale str. Florida] gi|56387830|gb|AAV86417.1| DNA processing protein, chain A [Anaplasma marginale str. St. Maries] gi|222419100|gb|ACM49123.1| DNA processing protein, chain A dprA (smf) [Anaplasma marginale str. Florida] Length = 377 Score = 38.1 bits (87), Expect = 0.41, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 22/32 (68%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 A G+D +YP +N +L I NGG+ ++E+PF Sbjct: 176 ASGIDVVYPKDNLHLYRAIVHNGGVVVTELPF 207 >gi|269958987|ref|YP_003328776.1| putativeDNA recombination-mediator protein A [Anaplasma centrale str. Israel] gi|269848818|gb|ACZ49462.1| putativeDNA recombination-mediator protein A [Anaplasma centrale str. Israel] Length = 378 Score = 38.1 bits (87), Expect = 0.43, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 22/32 (68%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 A G+D +YP +N +L I NGG+ ++E+PF Sbjct: 176 ANGIDVVYPKDNLHLYRAIVHNGGVVVTELPF 207 >gi|67458923|ref|YP_246547.1| putative DNA processing protein DprA [Rickettsia felis URRWXCal2] gi|67004456|gb|AAY61382.1| Putatie DNA processing protein DprA [Rickettsia felis URRWXCal2] Length = 382 Score = 38.1 bits (87), Expect = 0.43, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 25/34 (73%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGG+D +YPPEN+ L E + + G I ++E+P G Sbjct: 177 IAGGIDHIYPPENKKLFENLAEEGLI-LAELPIG 209 >gi|58616939|ref|YP_196138.1| Smf protein (DNA processing chain A) [Ehrlichia ruminantium str. Gardel] gi|58416551|emb|CAI27664.1| Smf protein (DNA processing chain A) [Ehrlichia ruminantium str. Gardel] Length = 375 Score = 38.1 bits (87), Expect = 0.43, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 20/34 (58%) Query: 1 [protein fragment, 34 aa] 34 M G++ +YP EN L I DNGG+ +E PF Sbjct: 174 MGNGINIVYPEENTTLYNAITDNGGLIATEFPFA 207 >gi|57238947|ref|YP_180083.1| Smf protein (DNA processing chain A) [Ehrlichia ruminantium str. Welgevonden] gi|58578880|ref|YP_197092.1| Smf protein (DNA processing chain A) [Ehrlichia ruminantium str. Welgevonden] gi|57161026|emb|CAH57932.1| putative DNA processing protein chain A [Ehrlichia ruminantium str. Welgevonden] gi|58417506|emb|CAI26710.1| Smf protein (DNA processing chain A) [Ehrlichia ruminantium str. Welgevonden] Length = 375 Score = 38.1 bits (87), Expect = 0.43, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 20/34 (58%) Query: 1 [protein fragment, 34 aa] 34 M G++ +YP EN L I DNGG+ +E PF Sbjct: 174 MGNGINIVYPEENTTLYNAITDNGGLIATEFPFA 207 >gi|253579631|ref|ZP_04856900.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39B_FAA] gi|251849132|gb|EES77093.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39BFAA] Length = 305 Score = 38.1 bits (87), Expect = 0.45, Method: Composition-based stats. Identities = 19/35 (54%), Positives = 22/35 (62%), Gaps = 2/35 (5%) Query: 1 MAGGLDCLYPPENRNLLEEI-WDNGGIAISEIPFG 34 + G+D YP NR L E I W+NGGI ISE P G Sbjct: 114 LGSGVDVCYPKSNRKLYERILWENGGI-ISECPLG 147 >gi|299138372|ref|ZP_07031551.1| DNA protecting protein DprA [Acidobacterium sp. MP5ACTX8] gi|298599618|gb|EFI55777.1| DNA protecting protein DprA [Acidobacterium sp. MP5ACTX8] Length = 403 Score = 37.7 bits (86), Expect = 0.51, Method: Composition-based stats. Identities = 16/31 (51%), Positives = 20/31 (64%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP EN+ L E+I GG ISE P G Sbjct: 180 GIDVIYPKENKKLAEQIVQQGGALISEFPMG 210 >gi|188996508|ref|YP_001930759.1| DNA protecting protein DprA [Sulfurihydrogenibium sp. YO3AOP1] gi|188931575|gb|ACD66205.1| DNA protecting protein DprA [Sulfurihydrogenibium sp. YO3AOP1] Length = 356 Score = 37.7 bits (86), Expect = 0.54, Method: Composition-based stats. Identities = 18/34 (52%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YP EN+ L EEI + G I ISE PFG Sbjct: 171 LGNGIDIVYPYENKKLYEEISEKGCI-ISEFPFG 203 >gi|331007628|ref|ZP_08330770.1| Rossmann fold nucleotide-binding protein [gamma proteobacterium IMCC1989] gi|330418568|gb|EGG93092.1| Rossmann fold nucleotide-binding protein [gamma proteobacterium IMCC1989] Length = 391 Score = 37.7 bits (86), Expect = 0.55, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 24/32 (75%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIP 32 MA G++ +YP ++NL E+I ++GG+ I+E P Sbjct: 194 MATGINSVYPKRHQNLAEQIVEDGGVLITEFP 225 >gi|322436363|ref|YP_004218575.1| DNA protecting protein DprA [Acidobacterium sp. MP5ACTX9] gi|321164090|gb|ADW69795.1| DNA protecting protein DprA [Acidobacterium sp. MP5ACTX9] Length = 404 Score = 37.7 bits (86), Expect = 0.55, Method: Composition-based stats. Identities = 17/31 (54%), Positives = 20/31 (64%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP EN+ L EEI GG +SE P G Sbjct: 187 GLDVVYPKENKRLAEEIVTGGGAIVSEYPLG 217 >gi|90417726|ref|ZP_01225638.1| DNA processing protein DprA, putative [Aurantimonas manganoxydans SI85-9A1] gi|90337398|gb|EAS51049.1| DNA processing protein DprA, putative [Aurantimonas manganoxydans SI85-9A1] Length = 376 Score = 37.7 bits (86), Expect = 0.55, Method: Compositional matrix adjust. Identities = 19/33 (57%), Positives = 21/33 (63%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGGLD YP ENR L+ I D GG +SE FG Sbjct: 177 AGGLDRPYPDENRPLMRRIVDEGGCLLSERAFG 209 >gi|169830783|ref|YP_001716765.1| DNA protecting protein DprA [Candidatus Desulforudis audaxviator MP104C] gi|169637627|gb|ACA59133.1| DNA protecting protein DprA [Candidatus Desulforudis audaxviator MP104C] Length = 394 Score = 37.7 bits (86), Expect = 0.56, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 23/34 (67%) Query: 1 [protein fragment, 34 aa] 34 + GLD +YP EN L+E+I +GG+ ++E P G Sbjct: 195 LGSGLDVVYPRENAGLMEKIAASGGLVLTEFPLG 228 >gi|146341416|ref|YP_001206464.1| DNA processing chain A (DprA/Smf) [Bradyrhizobium sp. ORS278] gi|146194222|emb|CAL78244.1| DNA processing chain A (DprA/Smf) [Bradyrhizobium sp. ORS278] Length = 371 Score = 37.7 bits (86), Expect = 0.57, Method: Composition-based stats. Identities = 18/34 (52%), Positives = 24/34 (70%) Query: 1 [protein fragment, 34 aa] 34 +AGG D +YPPE+ +LL I + G AISE+P G Sbjct: 174 LAGGHDRIYPPEHVDLLGAIIGSHGAAISEMPLG 207 >gi|237755691|ref|ZP_04584300.1| DNA protecting protein DprA [Sulfurihydrogenibium yellowstonense SS-5] gi|237692141|gb|EEP61140.1| DNA protecting protein DprA [Sulfurihydrogenibium yellowstonense SS-5] Length = 356 Score = 37.4 bits (85), Expect = 0.62, Method: Composition-based stats. Identities = 18/34 (52%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YP EN+ L EEI + G I ISE PFG Sbjct: 171 LGNGIDIVYPYENKKLYEEISEKGCI-ISEFPFG 203 >gi|153005554|ref|YP_001379879.1| DNA protecting protein DprA [Anaeromyxobacter sp. Fw109-5] gi|152029127|gb|ABS26895.1| DNA protecting protein DprA [Anaeromyxobacter sp. Fw109-5] Length = 287 Score = 37.4 bits (85), Expect = 0.65, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 22/34 (64%) Query: 1 [protein fragment, 34 aa] 34 + G+D LYP NR LLE + + GG +SE+P G Sbjct: 97 LGTGVDVLYPASNRALLERVLEQGGAILSELPDG 130 >gi|114763467|ref|ZP_01442874.1| DNA processing protein DprA, putative [Pelagibaca bermudensis HTCC2601] gi|114544005|gb|EAU47016.1| DNA processing protein DprA, putative [Roseovarius sp. HTCC2601] Length = 375 Score = 37.4 bits (85), Expect = 0.65, Method: Composition-based stats. Identities = 19/34 (55%), Positives = 21/34 (61%) Query: 1 [protein fragment, 34 aa] 34 MAGG+D LYP EN L EEI GG +SE G Sbjct: 153 MAGGVDILYPSENTRLGEEIRARGGALVSEHAMG 186 >gi|241667272|ref|ZP_04754850.1| DNA processing protein DprA [Francisella philomiragia subsp. philomiragia ATCC 25015] gi|254875823|ref|ZP_05248533.1| DNA processing protein dprA [Francisella philomiragia subsp. philomiragia ATCC 25015] gi|254841844|gb|EET20258.1| DNA processing protein dprA [Francisella philomiragia subsp. philomiragia ATCC 25015] Length = 366 Score = 37.4 bits (85), Expect = 0.70, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 19/31 (61%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP NR L I N G+ ISE+P G Sbjct: 175 GVDIIYPSSNRELYSNIISNNGLIISELPLG 205 >gi|167626698|ref|YP_001677198.1| DNA processing protein DprA [Francisella philomiragia subsp. philomiragia ATCC 25017] gi|167596699|gb|ABZ86697.1| DNA processing protein DprA [Francisella philomiragia subsp. philomiragia ATCC 25017] Length = 288 Score = 37.4 bits (85), Expect = 0.72, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 19/31 (61%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP NR L I N G+ ISE+P G Sbjct: 97 GVDIIYPSSNRELYSNIISNNGLIISELPLG 127 >gi|329929328|ref|ZP_08283081.1| DNA protecting protein DprA [Paenibacillus sp. HGF5] gi|328936697|gb|EGG33140.1| DNA protecting protein DprA [Paenibacillus sp. HGF5] Length = 391 Score = 37.4 bits (85), Expect = 0.73, Method: Composition-based stats. Identities = 19/34 (55%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YPPENR+L EEI G I ISE P G Sbjct: 190 LGAGIDVIYPPENRSLYEEIAAKGLI-ISEYPPG 222 >gi|256832232|ref|YP_003160959.1| DNA protecting protein DprA [Jonesia denitrificans DSM 20603] gi|256685763|gb|ACV08656.1| DNA protecting protein DprA [Jonesia denitrificans DSM 20603] Length = 395 Score = 37.4 bits (85), Expect = 0.74, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 25/34 (73%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGG+D LYP N+ LL+ + D+G + +SE+P G Sbjct: 163 LAGGVDRLYPQGNKKLLQRLIDHGAL-VSEMPVG 195 >gi|261407992|ref|YP_003244233.1| DNA protecting protein DprA [Paenibacillus sp. Y412MC10] gi|261284455|gb|ACX66426.1| DNA protecting protein DprA [Paenibacillus sp. Y412MC10] Length = 391 Score = 37.4 bits (85), Expect = 0.77, Method: Composition-based stats. Identities = 19/34 (55%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YPPENR+L EEI G I ISE P G Sbjct: 190 LGAGIDVIYPPENRSLYEEIAAKGLI-ISEYPPG 222 >gi|150005910|ref|YP_001300654.1| putative DNA processing enzyme DprA [Bacteroides vulgatus ATCC 8482] gi|149934334|gb|ABR41032.1| putative DNA processing enzyme DprA [Bacteroides vulgatus ATCC 8482] Length = 326 Score = 37.0 bits (84), Expect = 0.81, Method: Composition-based stats. Identities = 18/36 (50%), Positives = 24/36 (66%), Gaps = 2/36 (5%) Query: 1 MAGGLD--CLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD +YP EN +L +EI NGG+ +SE P G Sbjct: 180 LANGLDWASIYPKENLSLAKEIVSNGGLLLSEYPVG 215 >gi|83309780|ref|YP_420044.1| Rossmann fold nucleotide-binding protein [Magnetospirillum magneticum AMB-1] gi|82944621|dbj|BAE49485.1| Predicted Rossmann fold nucleotide-binding protein [Magnetospirillum magneticum AMB-1] Length = 383 Score = 37.0 bits (84), Expect = 0.81, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 24/34 (70%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGG+D +YPPEN +L EI G + +SE+P G Sbjct: 181 LAGGVDVVYPPENTDLWREIGAAGAV-VSEMPVG 213 >gi|325297496|ref|YP_004257413.1| SMF family protein [Bacteroides salanitronis DSM 18170] gi|324317049|gb|ADY34940.1| SMF family protein [Bacteroides salanitronis DSM 18170] Length = 343 Score = 37.0 bits (84), Expect = 0.84, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 21/34 (61%) Query: 1 [protein fragment, 34 aa] 34 +A GLD +P N+ L EEI GG +SE PFG Sbjct: 199 VASGLDITHPKVNKTLQEEIVAKGGTIVSEHPFG 232 >gi|260752380|ref|YP_003225273.1| DNA protecting protein DprA [Zymomonas mobilis subsp. mobilis NCIMB 11163] gi|258551743|gb|ACV74689.1| DNA protecting protein DprA [Zymomonas mobilis subsp. mobilis NCIMB 11163] Length = 385 Score = 37.0 bits (84), Expect = 0.89, Method: Composition-based stats. Identities = 16/32 (50%), Positives = 23/32 (71%), Gaps = 1/32 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIP 32 +AGGLD YPPEN+ L + I + G+ +SE+P Sbjct: 173 IAGGLDSFYPPENKELQQAISEK-GLVVSEMP 203 >gi|56750836|ref|YP_171537.1| DNA processing protein [Synechococcus elongatus PCC 6301] gi|56685795|dbj|BAD79017.1| DNA processing protein [Synechococcus elongatus PCC 6301] Length = 406 Score = 37.0 bits (84), Expect = 0.91, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 23/34 (67%) Query: 1 [protein fragment, 34 aa] 34 + G++ +YPP+NR L E I + GG+ +SE P G Sbjct: 204 LGTGVNVIYPPQNRALYEAILEQGGLILSEQPSG 237 >gi|81299514|ref|YP_399722.1| DNA processing protein DprA, putative [Synechococcus elongatus PCC 7942] gi|81168395|gb|ABB56735.1| DNA processing protein DprA, putative [Synechococcus elongatus PCC 7942] Length = 402 Score = 37.0 bits (84), Expect = 0.92, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 23/34 (67%) Query: 1 [protein fragment, 34 aa] 34 + G++ +YPP+NR L E I + GG+ +SE P G Sbjct: 200 LGTGVNVIYPPQNRALYEAILEQGGLILSEQPSG 233 >gi|292670827|ref|ZP_06604253.1| DNA protecting protein DprA [Selenomonas noxia ATCC 43541] gi|292647448|gb|EFF65420.1| DNA protecting protein DprA [Selenomonas noxia ATCC 43541] Length = 363 Score = 37.0 bits (84), Expect = 0.93, Method: Composition-based stats. Identities = 15/27 (55%), Positives = 20/27 (74%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISE 30 G+D YPPENR LL +I ++GG +SE Sbjct: 175 GVDIAYPPENRRLLSQIVESGGAVLSE 201 >gi|89895301|ref|YP_518788.1| hypothetical protein DSY2555 [Desulfitobacterium hafniense Y51] gi|219669735|ref|YP_002460170.1| DNA protecting protein DprA [Desulfitobacterium hafniense DCB-2] gi|89334749|dbj|BAE84344.1| hypothetical protein [Desulfitobacterium hafniense Y51] gi|219539995|gb|ACL21734.1| DNA protecting protein DprA [Desulfitobacterium hafniense DCB-2] Length = 389 Score = 37.0 bits (84), Expect = 0.95, Method: Composition-based stats. Identities = 18/34 (52%), Positives = 21/34 (61%) Query: 1 [protein fragment, 34 aa] 34 M GL+ +YPPEN+ L EEI GG SE P G Sbjct: 182 MGCGLNHMYPPENQKLAEEILAKGGALWSEFPPG 215 >gi|56552090|ref|YP_162929.1| DNA protecting protein DprA [Zymomonas mobilis subsp. mobilis ZM4] gi|56543664|gb|AAV89818.1| DNA protecting protein DprA [Zymomonas mobilis subsp. mobilis ZM4] Length = 385 Score = 37.0 bits (84), Expect = 0.96, Method: Composition-based stats. Identities = 16/32 (50%), Positives = 23/32 (71%), Gaps = 1/32 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIP 32 +AGGLD YPPEN+ L + I + G+ +SE+P Sbjct: 173 IAGGLDSFYPPENKELQQAISEK-GLVVSEMP 203 >gi|241762041|ref|ZP_04760125.1| DNA protecting protein DprA [Zymomonas mobilis subsp. mobilis ATCC 10988] gi|241373507|gb|EER63094.1| DNA protecting protein DprA [Zymomonas mobilis subsp. mobilis ATCC 10988] Length = 385 Score = 37.0 bits (84), Expect = 0.96, Method: Composition-based stats. Identities = 16/32 (50%), Positives = 23/32 (71%), Gaps = 1/32 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIP 32 +AGGLD YPPEN+ L + I + G+ +SE+P Sbjct: 173 IAGGLDSFYPPENKELQQAISEK-GLVVSEMP 203 >gi|4511994|gb|AAD21554.1| DNA processing chain A [Zymomonas mobilis subsp. mobilis ZM4] Length = 385 Score = 37.0 bits (84), Expect = 0.98, Method: Composition-based stats. Identities = 16/32 (50%), Positives = 23/32 (71%), Gaps = 1/32 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIP 32 +AGGLD YPPEN+ L + I + G+ +SE+P Sbjct: 173 IAGGLDSFYPPENKELQQAISEK-GLVVSEMP 203 >gi|148558431|ref|YP_001257589.1| SMF protein [Brucella ovis ATCC 25840] gi|148369716|gb|ABQ62588.1| SMF protein [Brucella ovis ATCC 25840] Length = 393 Score = 37.0 bits (84), Expect = 1.00, Method: Compositional matrix adjust. Identities = 18/34 (52%), Positives = 22/34 (64%) Query: 1 [protein fragment, 34 aa] 34 +AG LD YPPEN L I +NGG I+E+P G Sbjct: 178 LAGRLDRPYPPENLPLYRAIPENGGALITEMPMG 211 >gi|238019258|ref|ZP_04599684.1| hypothetical protein VEIDISOL_01122 [Veillonella dispar ATCC 17748] gi|237863957|gb|EEP65247.1| hypothetical protein VEIDISOL_01122 [Veillonella dispar ATCC 17748] Length = 408 Score = 37.0 bits (84), Expect = 1.0, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 20/34 (58%) Query: 1 [protein fragment, 34 aa] 34 M GLD +YP EN L + I N G+ +SE P G Sbjct: 179 MGCGLDIVYPRENTKLFDRILQNNGLLVSEYPPG 212 >gi|313892558|ref|ZP_07826145.1| DNA protecting protein DprA [Dialister microaerophilus UPII 345-E] gi|313118955|gb|EFR42160.1| DNA protecting protein DprA [Dialister microaerophilus UPII 345-E] Length = 363 Score = 37.0 bits (84), Expect = 1.0, Method: Composition-based stats. Identities = 18/29 (62%), Positives = 20/29 (68%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISE 30 A GLD YP ENRNL E+I +GG ISE Sbjct: 170 ACGLDKTYPAENRNLFEKIIAHGGCIISE 198 >gi|68536255|ref|YP_250960.1| putative DNA processing protein [Corynebacterium jeikeium K411] gi|260578955|ref|ZP_05846858.1| DNA processing protein [Corynebacterium jeikeium ATCC 43734] gi|68263854|emb|CAI37342.1| putative DNA processing protein [Corynebacterium jeikeium K411] gi|258602929|gb|EEW16203.1| DNA processing protein [Corynebacterium jeikeium ATCC 43734] Length = 396 Score = 37.0 bits (84), Expect = 1.0, Method: Composition-based stats. Identities = 18/34 (52%), Positives = 22/34 (64%) Query: 1 [protein fragment, 34 aa] 34 MA GLD YP + NL E+I +GG+ ISE P G Sbjct: 198 MACGLDVSYPKAHANLFEQIVGSGGMLISEYPPG 231 >gi|329121225|ref|ZP_08249852.1| DNA processing protein DprA [Dialister micraerophilus DSM 19965] gi|327470159|gb|EGF15622.1| DNA processing protein DprA [Dialister micraerophilus DSM 19965] Length = 363 Score = 37.0 bits (84), Expect = 1.0, Method: Composition-based stats. Identities = 18/29 (62%), Positives = 20/29 (68%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISE 30 A GLD YP ENRNL E+I +GG ISE Sbjct: 170 ACGLDKTYPAENRNLFEKIIAHGGCIISE 198 >gi|85859218|ref|YP_461420.1| SMF family protein involved in DNA uptake [Syntrophus aciditrophicus SB] gi|85722309|gb|ABC77252.1| SMF family protein involved in DNA uptake [Syntrophus aciditrophicus SB] Length = 394 Score = 37.0 bits (84), Expect = 1.0, Method: Compositional matrix adjust. Identities = 17/31 (54%), Positives = 23/31 (74%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YPPEN+NL E+I +G + ISE+ G Sbjct: 176 GLDIVYPPENKNLYEKIAADGAV-ISELALG 205 >gi|225874954|ref|YP_002756413.1| DNA protecting protein DprA [Acidobacterium capsulatum ATCC 51196] gi|225792046|gb|ACO32136.1| DNA protecting protein DprA [Acidobacterium capsulatum ATCC 51196] Length = 401 Score = 36.6 bits (83), Expect = 1.1, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 21/31 (67%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP EN+ L E+I GG +SE+P G Sbjct: 192 GVDVIYPKENKALAEQIVATGGAIVSELPLG 222 >gi|46200754|ref|ZP_00056433.2| COG0758: Predicted Rossmann fold nucleotide-binding protein involved in DNA uptake [Magnetospirillum magnetotacticum MS-1] Length = 383 Score = 36.6 bits (83), Expect = 1.1, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGG+D +YPPEN +L EI G +SE+P G Sbjct: 181 LAGGVDVVYPPENTDLWREIC-AAGTVVSEMPVG 213 >gi|88606798|ref|YP_505506.1| putative DNA processing protein DprA [Anaplasma phagocytophilum HZ] gi|88597861|gb|ABD43331.1| putative DNA processing protein DprA [Anaplasma phagocytophilum HZ] Length = 344 Score = 36.6 bits (83), Expect = 1.2, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 22/33 (66%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +A G++ +YP EN L + I GG+ ISE+PF Sbjct: 143 IANGINVIYPRENAKLYKSIVREGGLLISELPF 175 >gi|291533226|emb|CBL06339.1| DNA protecting protein DprA [Megamonas hypermegale ART12/1] Length = 368 Score = 36.6 bits (83), Expect = 1.2, Method: Composition-based stats. Identities = 17/30 (56%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 GLD +YP EN+ LLE I NG + ISE P Sbjct: 172 GLDIIYPKENKQLLEAIAQNGAV-ISEYPL 200 >gi|325294278|ref|YP_004280792.1| DNA protecting protein DprA [Desulfurobacterium thermolithotrophum DSM 11699] gi|325064726|gb|ADY72733.1| DNA protecting protein DprA [Desulfurobacterium thermolithotrophum DSM 11699] Length = 337 Score = 36.6 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 20/34 (58%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YP N +L E I D GG ISE P G Sbjct: 154 LGSGVDSIYPRGNFSLAERIVDTGGAIISEFPLG 187 >gi|313892683|ref|ZP_07826266.1| DNA protecting protein DprA [Veillonella sp. oral taxon 158 str. F0412] gi|313442774|gb|EFR61183.1| DNA protecting protein DprA [Veillonella sp. oral taxon 158 str. F0412] Length = 408 Score = 36.6 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 20/34 (58%) Query: 1 [protein fragment, 34 aa] 34 M GLD +YP EN L + I N G+ +SE P G Sbjct: 179 MGCGLDIVYPRENTKLFDRILQNNGLLLSEYPPG 212 >gi|254294345|ref|YP_003060368.1| DNA protecting protein DprA [Hirschia baltica ATCC 49814] gi|254042876|gb|ACT59671.1| DNA protecting protein DprA [Hirschia baltica ATCC 49814] Length = 373 Score = 36.6 bits (83), Expect = 1.4, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGG+D +YPPE+ L + I + G I +SE P G Sbjct: 175 LAGGVDAIYPPEHAKLYDAILERGAI-VSESPLG 207 >gi|222054654|ref|YP_002537016.1| DNA protecting protein DprA [Geobacter sp. FRC-32] gi|221563943|gb|ACM19915.1| DNA protecting protein DprA [Geobacter sp. FRC-32] Length = 359 Score = 36.2 bits (82), Expect = 1.4, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 22/31 (70%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPPENR L +E+ + G + +SE P G Sbjct: 173 GIDIVYPPENRPLFKEMEEKGAL-VSEFPMG 202 >gi|313895732|ref|ZP_07829288.1| DNA protecting protein DprA [Selenomonas sp. oral taxon 137 str. F0430] gi|320528987|ref|ZP_08030079.1| DNA protecting protein DprA [Selenomonas artemidis F0399] gi|312975858|gb|EFR41317.1| DNA protecting protein DprA [Selenomonas sp. oral taxon 137 str. F0430] gi|320138617|gb|EFW30507.1| DNA protecting protein DprA [Selenomonas artemidis F0399] Length = 363 Score = 36.2 bits (82), Expect = 1.5, Method: Compositional matrix adjust. Identities = 15/27 (55%), Positives = 19/27 (70%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISE 30 G+D YPPENR L+ +I D GG +SE Sbjct: 175 GVDIAYPPENRRLIAQIIDAGGAVLSE 201 >gi|225163857|ref|ZP_03726152.1| DNA protecting protein DprA [Opitutaceae bacterium TAV2] gi|224801538|gb|EEG19839.1| DNA protecting protein DprA [Opitutaceae bacterium TAV2] Length = 388 Score = 36.2 bits (82), Expect = 1.5, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 20/33 (60%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G+D +YPPEN +L I + GG SE PF Sbjct: 173 LGTGIDIIYPPENLDLYRRIENEGGAICSEFPF 205 >gi|39997645|ref|NP_953596.1| DNA processing protein DprA [Geobacter sulfurreducens PCA] gi|39984537|gb|AAR35923.1| DNA processing protein DprA [Geobacter sulfurreducens PCA] gi|298506585|gb|ADI85308.1| DNA uptake/processing protein SMF [Geobacter sulfurreducens KN400] Length = 356 Score = 36.2 bits (82), Expect = 1.5, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPPENR L + D G + +SE P G Sbjct: 171 GIDVVYPPENRALFARVADRGAL-VSEFPLG 200 >gi|187734950|ref|YP_001877062.1| DNA protecting protein DprA [Akkermansia muciniphila ATCC BAA-835] gi|187425002|gb|ACD04281.1| DNA protecting protein DprA [Akkermansia muciniphila ATCC BAA-835] Length = 375 Score = 36.2 bits (82), Expect = 1.5, Method: Compositional matrix adjust. Identities = 16/33 (48%), Positives = 20/33 (60%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ LYP ENRNL + I D G +SE P Sbjct: 173 IGAGLNKLYPRENRNLAQRIADGHGAVVSEFPM 205 >gi|84501686|ref|ZP_00999858.1| DNA processing protein DprA, putative [Oceanicola batsensis HTCC2597] gi|84390307|gb|EAQ02866.1| DNA processing protein DprA, putative [Oceanicola batsensis HTCC2597] Length = 372 Score = 36.2 bits (82), Expect = 1.5, Method: Composition-based stats. Identities = 18/34 (52%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 MAGG+D LYPPEN L + I G +SE+P G Sbjct: 153 MAGGVDALYPPENATLADAI-PGTGARLSEMPMG 185 >gi|269836418|ref|YP_003318646.1| DNA protecting protein DprA [Sphaerobacter thermophilus DSM 20745] gi|269785681|gb|ACZ37824.1| DNA protecting protein DprA [Sphaerobacter thermophilus DSM 20745] Length = 359 Score = 36.2 bits (82), Expect = 1.6, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YPPE+R L E++ G + +SE P G Sbjct: 171 LGSGVDVIYPPEHRQLAEQVAQQGAL-VSEFPLG 203 >gi|192291901|ref|YP_001992506.1| DNA protecting protein DprA [Rhodopseudomonas palustris TIE-1] gi|192285650|gb|ACF02031.1| DNA protecting protein DprA [Rhodopseudomonas palustris TIE-1] Length = 378 Score = 36.2 bits (82), Expect = 1.6, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 23/34 (67%) Query: 1 [protein fragment, 34 aa] 34 +AGG D +YP E+ +LL +I G AISE+P G Sbjct: 181 LAGGHDKIYPAEHEDLLLDIIQTRGAAISEMPLG 214 >gi|208780407|ref|ZP_03247748.1| DNA protecting protein DprA, putative [Francisella novicida FTG] gi|208743775|gb|EDZ90078.1| DNA protecting protein DprA, putative [Francisella novicida FTG] Length = 368 Score = 36.2 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 20/31 (64%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP NR L +I + G+ ISE+P G Sbjct: 177 GVDVVYPSSNRELYNKIINTNGLIISELPLG 207 >gi|148265710|ref|YP_001232416.1| DNA protecting protein DprA [Geobacter uraniireducens Rf4] gi|146399210|gb|ABQ27843.1| DNA protecting protein DprA [Geobacter uraniireducens Rf4] Length = 359 Score = 36.2 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 22/31 (70%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPPEN+ L +E+ + G + +SE P G Sbjct: 173 GIDVVYPPENQRLFKEMAEKGAL-VSEFPMG 202 >gi|157413603|ref|YP_001484469.1| DNA uptake Rossmann fold nucleotide-binding protein [Prochlorococcus marinus str. MIT 9215] gi|157388178|gb|ABV50883.1| Predicted Rossmann fold nucleotide-binding protein involved in DNA uptake [Prochlorococcus marinus str. MIT 9215] Length = 311 Score = 36.2 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 20/34 (58%) Query: 1 [protein fragment, 34 aa] 34 + GLD +YP EN NL EI D GG +SE G Sbjct: 169 LPNGLDEIYPKENANLASEIIDYGGCLVSEYLIG 202 >gi|39936183|ref|NP_948459.1| DNA processing protein DprA [Rhodopseudomonas palustris CGA009] gi|39650038|emb|CAE28561.1| DNA processing chain A [Rhodopseudomonas palustris CGA009] Length = 380 Score = 35.8 bits (81), Expect = 1.8, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 23/34 (67%) Query: 1 [protein fragment, 34 aa] 34 +AGG D +YP E+ +LL +I G AISE+P G Sbjct: 183 LAGGHDKIYPAEHEDLLLDIIQTRGAAISEMPLG 216 >gi|110633709|ref|YP_673917.1| DNA protecting protein DprA [Mesorhizobium sp. BNC1] gi|110284693|gb|ABG62752.1| DNA protecting protein DprA [Chelativorans sp. BNC1] Length = 378 Score = 35.8 bits (81), Expect = 1.8, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YPPEN L I + G+ ++E+PFG Sbjct: 176 LAGGLDRPYPPENDGLFRAIGER-GVVLTEMPFG 208 >gi|255659254|ref|ZP_05404663.1| DNA processing protein DprA [Mitsuokella multacida DSM 20544] gi|260848709|gb|EEX68716.1| DNA processing protein DprA [Mitsuokella multacida DSM 20544] Length = 365 Score = 35.8 bits (81), Expect = 1.9, Method: Composition-based stats. Identities = 16/27 (59%), Positives = 19/27 (70%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISE 30 G+D YP ENR LL EI ++GG ISE Sbjct: 177 GIDVAYPAENRRLLMEIAESGGAVISE 203 >gi|144898216|emb|CAM75080.1| DNA processing chain A [Magnetospirillum gryphiswaldense MSR-1] Length = 377 Score = 35.8 bits (81), Expect = 1.9, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 25/34 (73%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGG+D +YPPEN+ L ++I G A+SE+P G Sbjct: 173 LAGGVDVVYPPENQRLYDDIVAM-GCAVSEMPPG 205 >gi|77918023|ref|YP_355838.1| Rossmann-fold nucleotide-binding protein [Pelobacter carbinolicus DSM 2380] gi|77544106|gb|ABA87668.1| DNA protecting protein DprA [Pelobacter carbinolicus DSM 2380] Length = 366 Score = 35.8 bits (81), Expect = 1.9, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 20/31 (64%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP EN+ L +I D GG +SE P G Sbjct: 174 GIDRIYPAENKQLFNDILDQGGAILSEYPPG 204 >gi|118578968|ref|YP_900218.1| DNA protecting protein DprA [Pelobacter propionicus DSM 2379] gi|118501678|gb|ABK98160.1| DNA protecting protein DprA [Pelobacter propionicus DSM 2379] Length = 371 Score = 35.8 bits (81), Expect = 2.0, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 23/31 (74%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPPENR+L +E+ + G + +SE P G Sbjct: 180 GIDRIYPPENRDLFDEMAERGCL-VSEFPLG 209 >gi|302392405|ref|YP_003828225.1| DNA protecting protein DprA [Acetohalobium arabaticum DSM 5501] gi|302204482|gb|ADL13160.1| DNA protecting protein DprA [Acetohalobium arabaticum DSM 5501] Length = 367 Score = 35.8 bits (81), Expect = 2.2, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YPPEN L+ EI ++G + IS P G Sbjct: 171 LGSGIDVIYPPENDELVTEIEESGAV-ISSFPLG 203 >gi|225848022|ref|YP_002728185.1| DNA protecting protein DprA [Sulfurihydrogenibium azorense Az-Fu1] gi|225643199|gb|ACN98249.1| DNA protecting protein DprA [Sulfurihydrogenibium azorense Az-Fu1] Length = 356 Score = 35.8 bits (81), Expect = 2.2, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YP ENR L ++I +NG + ISE P G Sbjct: 171 LGSGIDVVYPFENRKLYDKITENGCV-ISEFPIG 203 >gi|86749541|ref|YP_486037.1| DNA processing protein DprA, putative [Rhodopseudomonas palustris HaA2] gi|86572569|gb|ABD07126.1| DNA processing protein DprA, putative [Rhodopseudomonas palustris HaA2] Length = 378 Score = 35.8 bits (81), Expect = 2.2, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 24/34 (70%) Query: 1 [protein fragment, 34 aa] 34 +AGG D +YP E+ +LL +I + G AISE+P G Sbjct: 181 LAGGHDKIYPAEHEDLLLDIIEARGAAISEMPLG 214 >gi|316933647|ref|YP_004108629.1| DNA protecting protein DprA [Rhodopseudomonas palustris DX-1] gi|315601361|gb|ADU43896.1| DNA protecting protein DprA [Rhodopseudomonas palustris DX-1] Length = 378 Score = 35.8 bits (81), Expect = 2.2, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 24/34 (70%) Query: 1 [protein fragment, 34 aa] 34 +AGG D +YP E+ +LL +I + G AISE+P G Sbjct: 181 LAGGHDKIYPAEHEDLLLDIVQSRGAAISEMPLG 214 >gi|209884919|ref|YP_002288776.1| SMF protein [Oligotropha carboxidovorans OM5] gi|209873115|gb|ACI92911.1| SMF protein [Oligotropha carboxidovorans OM5] Length = 377 Score = 35.8 bits (81), Expect = 2.2, Method: Compositional matrix adjust. Identities = 17/34 (50%), Positives = 23/34 (67%) Query: 1 [protein fragment, 34 aa] 34 +AGG D +YPPE+ +LL+ I G AISE+ G Sbjct: 176 LAGGHDRIYPPEHESLLDAILAANGGAISEMQLG 209 >gi|308177311|ref|YP_003916717.1| smf family protein [Arthrobacter arilaitensis Re117] gi|307744774|emb|CBT75746.1| putative smf family protein [Arthrobacter arilaitensis Re117] Length = 414 Score = 35.8 bits (81), Expect = 2.3, Method: Composition-based stats. Identities = 18/34 (52%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 MAGG+D LYP N NLL +I G+ +SE+P G Sbjct: 216 MAGGIDRLYPSGNSNLLNQIVAR-GVLLSEVPPG 248 >gi|255689876|ref|ZP_05413551.1| putative DNA processing protein DprA [Bacteroides finegoldii DSM 17565] gi|260624481|gb|EEX47352.1| putative DNA processing protein DprA [Bacteroides finegoldii DSM 17565] Length = 309 Score = 35.8 bits (81), Expect = 2.3, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 22/34 (64%) Query: 1 [protein fragment, 34 aa] 34 +A GLD +P N++L +EI GG +SE PFG Sbjct: 178 VASGLDITHPKVNKSLQDEIIAKGGTILSEHPFG 211 >gi|91763089|ref|ZP_01265053.1| DNA processing chain A [Candidatus Pelagibacter ubique HTCC1002] gi|91717502|gb|EAS84153.1| DNA processing chain A [Candidatus Pelagibacter ubique HTCC1002] Length = 306 Score = 35.4 bits (80), Expect = 2.4, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +A GLD +YP ENR L + I N GI ++E FG Sbjct: 190 LANGLDTIYPSENRELAKNIL-NKGILLTEYTFG 222 >gi|251772341|gb|EES52909.1| putative DNA processing protein DprA [Leptospirillum ferrodiazotrophum] Length = 292 Score = 35.4 bits (80), Expect = 2.4, Method: Composition-based stats. Identities = 17/31 (54%), Positives = 20/31 (64%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YPPEN L EI GG+ +SE P G Sbjct: 177 GLDRVYPPENVGLAREIERTGGLILSEYPPG 207 >gi|253700153|ref|YP_003021342.1| DNA protecting protein DprA [Geobacter sp. M21] gi|251775003|gb|ACT17584.1| DNA protecting protein DprA [Geobacter sp. M21] Length = 359 Score = 35.4 bits (80), Expect = 2.5, Method: Composition-based stats. Identities = 16/31 (51%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPPEN L + + DNG + ISE P G Sbjct: 173 GIDLVYPPENGALYQALADNGAL-ISEFPMG 202 >gi|296117478|ref|ZP_06836065.1| putative DNA processing chain A [Gluconacetobacter hansenii ATCC 23769] gi|295975999|gb|EFG82790.1| putative DNA processing chain A [Gluconacetobacter hansenii ATCC 23769] Length = 375 Score = 35.4 bits (80), Expect = 2.5, Method: Composition-based stats. Identities = 18/34 (52%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGGLDC YPPE+ L +EI G + I+E P G Sbjct: 164 IAGGLDCPYPPEHGRLHDEIAQQGAL-ITEAPPG 196 >gi|317063578|ref|ZP_07928063.1| conserved hypothetical protein [Fusobacterium ulcerans ATCC 49185] gi|313689254|gb|EFS26089.1| conserved hypothetical protein [Fusobacterium ulcerans ATCC 49185] Length = 355 Score = 35.4 bits (80), Expect = 2.6, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + GLD +YP ENR L E+I + G+ ISE P G Sbjct: 169 VGSGLDIIYPKENRILWEQI-ERSGLIISEYPLG 201 >gi|257469331|ref|ZP_05633425.1| Smf protein [Fusobacterium ulcerans ATCC 49185] Length = 352 Score = 35.4 bits (80), Expect = 2.6, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + GLD +YP ENR L E+I + G+ ISE P G Sbjct: 166 VGSGLDIIYPKENRILWEQI-ERSGLIISEYPLG 198 >gi|326204632|ref|ZP_08194488.1| DNA protecting protein DprA [Clostridium papyrosolvens DSM 2782] gi|325985199|gb|EGD46039.1| DNA protecting protein DprA [Clostridium papyrosolvens DSM 2782] Length = 374 Score = 35.4 bits (80), Expect = 2.7, Method: Compositional matrix adjust. Identities = 16/34 (47%), Positives = 22/34 (64%) Query: 1 [protein fragment, 34 aa] 34 + GLD +YP EN L +EI D+ G+ +SE P G Sbjct: 171 LGSGLDNIYPQENAGLFKEIIDSKGLVLSEYPPG 204 >gi|328676429|gb|AEB27299.1| Rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Francisella cf. novicida Fx1] Length = 368 Score = 35.4 bits (80), Expect = 2.8, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 19/31 (61%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP NR L +I + G+ ISE P G Sbjct: 177 GVDVVYPSSNRELYNKIINTNGLIISEFPLG 207 >gi|254372325|ref|ZP_04987816.1| DNA uptake protein [Francisella tularensis subsp. novicida GA99-3549] gi|151570054|gb|EDN35708.1| DNA uptake protein [Francisella novicida GA99-3549] Length = 368 Score = 35.4 bits (80), Expect = 2.8, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 19/31 (61%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP NR L +I + G+ ISE P G Sbjct: 177 GVDVVYPSSNRELYNKIINTNGLIISEFPLG 207 >gi|167009201|ref|ZP_02274132.1| DNA processing protein DprA [Francisella tularensis subsp. holarctica FSC200] gi|254367122|ref|ZP_04983155.1| DNA uptake protein, SMF family [Francisella tularensis subsp. holarctica 257] gi|134252945|gb|EBA52039.1| DNA uptake protein, SMF family [Francisella tularensis subsp. holarctica 257] Length = 245 Score = 35.4 bits (80), Expect = 2.8, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 19/31 (61%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP NR L +I + G+ ISE P G Sbjct: 77 GVDVVYPSSNRELYNKIINTNGLIISEFPLG 107 >gi|134302268|ref|YP_001122237.1| DNA processing protein DprA [Francisella tularensis subsp. tularensis WY96-3418] gi|134050045|gb|ABO47116.1| DNA processing protein DprA [Francisella tularensis subsp. tularensis WY96-3418] Length = 368 Score = 35.4 bits (80), Expect = 2.8, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 19/31 (61%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP NR L +I + G+ ISE P G Sbjct: 177 GVDVVYPSSNRELYNKIINTNGLIISEFPLG 207 >gi|25028474|ref|NP_738528.1| putative DNA processing protein [Corynebacterium efficiens YS-314] gi|259507533|ref|ZP_05750433.1| Rossmann-fold nucleotide-binding protein [Corynebacterium efficiens YS-314] gi|23493759|dbj|BAC18728.1| putative DNA processing protein [Corynebacterium efficiens YS-314] gi|259164918|gb|EEW49472.1| Rossmann-fold nucleotide-binding protein [Corynebacterium efficiens YS-314] Length = 403 Score = 35.4 bits (80), Expect = 2.8, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 20/33 (60%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 A GLD YP NR L EE+ + GG ++E P G Sbjct: 194 ACGLDRSYPAHNRGLFEEVVNRGGAIVTEYPPG 226 >gi|290954217|ref|ZP_06558838.1| DNA processing protein DprA [Francisella tularensis subsp. holarctica URFT1] gi|295312381|ref|ZP_06803163.1| DNA processing protein DprA [Francisella tularensis subsp. holarctica URFT1] Length = 268 Score = 35.4 bits (80), Expect = 2.9, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 19/31 (61%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP NR L +I + G+ ISE P G Sbjct: 77 GVDVVYPSSNRELYNKIINTNGLIISEFPLG 107 >gi|118496955|ref|YP_898005.1| SMF family DNA uptake protein [Francisella tularensis subsp. novicida U112] gi|194324184|ref|ZP_03057958.1| DNA protecting protein DprA, putative [Francisella tularensis subsp. novicida FTE] gi|118422861|gb|ABK89251.1| DNA uptake protein, SMF family [Francisella novicida U112] gi|194321631|gb|EDX19115.1| DNA protecting protein DprA, putative [Francisella tularensis subsp. novicida FTE] Length = 368 Score = 35.4 bits (80), Expect = 2.9, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 19/31 (61%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP NR L +I + G+ ISE P G Sbjct: 177 GVDVVYPSSNRELYNKIINTNGLIISEFPLG 207 >gi|294791910|ref|ZP_06757058.1| DNA processing protein DprA [Veillonella sp. 6_1_27] gi|294457140|gb|EFG25502.1| DNA processing protein DprA [Veillonella sp. 6_1_27] Length = 408 Score = 35.4 bits (80), Expect = 2.9, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 19/34 (55%) Query: 1 [protein fragment, 34 aa] 34 M GLD YP EN L + I N G+ +SE P G Sbjct: 179 MGCGLDITYPRENAKLFDRILQNNGLLLSEYPPG 212 >gi|110832994|ref|YP_691853.1| peptide deformylase, DNA processing protein [Alcanivorax borkumensis SK2] gi|110646105|emb|CAL15581.1| peptide deformylase, DNA processing protein [Alcanivorax borkumensis SK2] Length = 353 Score = 35.4 bits (80), Expect = 3.0, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 20/34 (58%) Query: 1 [protein fragment, 34 aa] 34 M G D +YPP N +L EEI D GG +SE G Sbjct: 165 MGNGPDRIYPPRNGSLAEEIVDTGGALVSEFAPG 198 >gi|269795658|ref|YP_003315113.1| DNA protecting protein DprA [Sanguibacter keddieii DSM 10542] gi|269097843|gb|ACZ22279.1| DNA protecting protein DprA [Sanguibacter keddieii DSM 10542] Length = 399 Score = 35.4 bits (80), Expect = 3.0, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 22/34 (64%) Query: 1 [protein fragment, 34 aa] 34 +AGG D LYP N +LL + D G+ +SE+P G Sbjct: 192 LAGGPDRLYPAGNADLLRGVLDGAGLVLSELPPG 225 >gi|332670025|ref|YP_004453033.1| SMF family protein [Cellulomonas fimi ATCC 484] gi|332339063|gb|AEE45646.1| SMF family protein [Cellulomonas fimi ATCC 484] Length = 412 Score = 35.4 bits (80), Expect = 3.0, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 22/34 (64%) Query: 1 [protein fragment, 34 aa] 34 +AGG+D YP N ++ + D+GG +SE+P G Sbjct: 190 LAGGVDRAYPVGNARMIAAVMDDGGTVVSEVPVG 223 >gi|90019672|ref|YP_525499.1| filamentous hemagglutinin-like protein [Saccharophagus degradans 2-40] gi|89949272|gb|ABD79287.1| DNA processing protein DprA, putative [Saccharophagus degradans 2-40] Length = 399 Score = 35.0 bits (79), Expect = 3.1, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 18/31 (58%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP N L EI NGG +SE P G Sbjct: 200 GIDSVYPQRNSALASEIIANGGAIVSEFPLG 230 >gi|164687263|ref|ZP_02211291.1| hypothetical protein CLOBAR_00904 [Clostridium bartlettii DSM 16795] gi|164603687|gb|EDQ97152.1| hypothetical protein CLOBAR_00904 [Clostridium bartlettii DSM 16795] Length = 304 Score = 35.0 bits (79), Expect = 3.2, Method: Composition-based stats. Identities = 17/31 (54%), Positives = 20/31 (64%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD YPPEN +L +EI +N G ISE G Sbjct: 178 GLDKYYPPENCDLGDEILENEGCLISEYKIG 208 >gi|254370428|ref|ZP_04986433.1| predicted protein [Francisella tularensis subsp. tularensis FSC033] gi|151568671|gb|EDN34325.1| predicted protein [Francisella tularensis subsp. tularensis FSC033] Length = 228 Score = 35.0 bits (79), Expect = 3.2, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 19/31 (61%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP NR L +I + G+ ISE P G Sbjct: 177 GVDVVYPSSNRELYNKIINTNGLIISEFPLG 207 >gi|254446574|ref|ZP_05060050.1| DNA protecting protein DprA, putative [Verrucomicrobiae bacterium DG1235] gi|198260882|gb|EDY85190.1| DNA protecting protein DprA, putative [Verrucomicrobiae bacterium DG1235] Length = 376 Score = 35.0 bits (79), Expect = 3.3, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPPEN +L + NG + +SE PFG Sbjct: 180 GIDIVYPPENVDLFRQAQVNGAV-VSEFPFG 209 >gi|254373799|ref|ZP_04989282.1| DNA processing protein DprA [Francisella novicida GA99-3548] gi|151571520|gb|EDN37174.1| DNA processing protein DprA [Francisella novicida GA99-3548] Length = 368 Score = 35.0 bits (79), Expect = 3.3, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 19/31 (61%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP NR L +I + G+ ISE P G Sbjct: 177 GVDVVYPSSNRELYNKIINTNGLIISEFPLG 207 >gi|85716403|ref|ZP_01047375.1| SMF protein [Nitrobacter sp. Nb-311A] gi|85696760|gb|EAQ34646.1| SMF protein [Nitrobacter sp. Nb-311A] Length = 372 Score = 35.0 bits (79), Expect = 3.4, Method: Compositional matrix adjust. Identities = 17/34 (50%), Positives = 25/34 (73%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGG D +YP E+ +LL + ++GG AISE+P G Sbjct: 175 LAGGHDRIYPLEHEDLLAAVLEDGG-AISEMPMG 207 >gi|75676200|ref|YP_318621.1| SMF protein [Nitrobacter winogradskyi Nb-255] gi|74421070|gb|ABA05269.1| SMF protein [Nitrobacter winogradskyi Nb-255] Length = 372 Score = 35.0 bits (79), Expect = 3.4, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 25/34 (73%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGG D +YP E+ +LL + ++GG AISE+P G Sbjct: 175 LAGGHDRIYPLEHEDLLAAVLESGG-AISEMPMG 207 >gi|328954307|ref|YP_004371641.1| DNA protecting protein DprA [Desulfobacca acetoxidans DSM 11109] gi|328454631|gb|AEB10460.1| DNA protecting protein DprA [Desulfobacca acetoxidans DSM 11109] Length = 366 Score = 35.0 bits (79), Expect = 3.4, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 22/31 (70%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP EN+ L ++I +NG + +SE P G Sbjct: 178 GLDVIYPQENKALYQQISENGAL-VSEFPLG 207 >gi|206890890|ref|YP_002248891.1| DNA processing protein DprA [Thermodesulfovibrio yellowstonii DSM 11347] gi|206742828|gb|ACI21885.1| DNA processing protein DprA [Thermodesulfovibrio yellowstonii DSM 11347] Length = 368 Score = 35.0 bits (79), Expect = 3.4, Method: Compositional matrix adjust. Identities = 16/30 (53%), Positives = 21/30 (70%), Gaps = 1/30 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISE 30 + G+ C+YPPEN+ L E+I NG I ISE Sbjct: 174 LGSGVSCIYPPENKMLAEKIIKNGAI-ISE 202 >gi|294055361|ref|YP_003549019.1| DNA protecting protein DprA [Coraliomargarita akajimensis DSM 45221] gi|293614694|gb|ADE54849.1| DNA protecting protein DprA [Coraliomargarita akajimensis DSM 45221] Length = 373 Score = 35.0 bits (79), Expect = 3.5, Method: Composition-based stats. Identities = 16/31 (51%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YPPEN +L I G + +SE PFG Sbjct: 179 GLDIVYPPENLDLYRAIVAKGAV-VSEFPFG 208 >gi|189426316|ref|YP_001953493.1| DNA protecting protein DprA [Geobacter lovleyi SZ] gi|189422575|gb|ACD96973.1| DNA protecting protein DprA [Geobacter lovleyi SZ] Length = 364 Score = 35.0 bits (79), Expect = 3.6, Method: Composition-based stats. Identities = 18/29 (62%), Positives = 20/29 (68%), Gaps = 1/29 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIP 32 G+D YPPENR L E+I NG I ISE P Sbjct: 173 GVDVDYPPENRQLAEQISGNGCI-ISEFP 200 >gi|295982522|pdb|3MAJ|A Chain A, Crystal Structure Of Putative Dna Processing Protein Dpra Fr Rhodopseudomonas Palustris Cga009 Length = 382 Score = 35.0 bits (79), Expect = 3.8, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 22/34 (64%) Query: 1 [protein fragment, 34 aa] 34 +AGG D +YP E+ +LL +I G AISE P G Sbjct: 185 LAGGHDKIYPAEHEDLLLDIIQTRGAAISEXPLG 218 >gi|94266973|ref|ZP_01290622.1| SMF protein [delta proteobacterium MLMS-1] gi|93452328|gb|EAT02959.1| SMF protein [delta proteobacterium MLMS-1] Length = 381 Score = 35.0 bits (79), Expect = 3.8, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 18/31 (58%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YPP+NR L I G+ + E P G Sbjct: 179 GLDVVYPPQNRQLFHTIGRQRGLLLGEYPLG 209 >gi|225175754|ref|ZP_03729747.1| DNA protecting protein DprA [Dethiobacter alkaliphilus AHT 1] gi|225168678|gb|EEG77479.1| DNA protecting protein DprA [Dethiobacter alkaliphilus AHT 1] Length = 361 Score = 35.0 bits (79), Expect = 3.9, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + GLD YPPE+ L+E I +NG + ISE P G Sbjct: 162 LGHGLDLCYPPEHLELMEAIVENGAV-ISEYPPG 194 >gi|126729116|ref|ZP_01744930.1| DNA processing protein DprA, putative [Sagittula stellata E-37] gi|126710106|gb|EBA09158.1| DNA processing protein DprA, putative [Sagittula stellata E-37] Length = 372 Score = 35.0 bits (79), Expect = 3.9, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 21/34 (61%) Query: 1 [protein fragment, 34 aa] 34 +AGG+D LYP EN L ++I G ISE P G Sbjct: 159 LAGGVDVLYPAENAGLADDIVTCHGARISEQPMG 192 >gi|240140065|ref|YP_002964542.1| DNA protecting protein DprA [Methylobacterium extorquens AM1] gi|240010039|gb|ACS41265.1| DNA protecting protein DprA [Methylobacterium extorquens AM1] Length = 397 Score = 35.0 bits (79), Expect = 3.9, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 22/34 (64%) Query: 1 [protein fragment, 34 aa] 34 +AGG D +YP + L+EEI GG ++E+P G Sbjct: 166 LAGGQDRIYPENHAGLVEEIVGAGGAVVAEMPMG 199 >gi|260599605|ref|YP_003212176.1| hypothetical protein CTU_38130 [Cronobacter turicensis z3032] gi|260218782|emb|CBA34130.1| Protein smf [Cronobacter turicensis z3032] Length = 381 Score = 34.7 bits (78), Expect = 4.0, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 20/33 (60%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP +R L EEI + GG +SE PF Sbjct: 178 LGNGLAQVYPARHRKLAEEIIEQGGAVVSEFPF 210 >gi|296129327|ref|YP_003636577.1| DNA protecting protein DprA [Cellulomonas flavigena DSM 20109] gi|296021142|gb|ADG74378.1| DNA protecting protein DprA [Cellulomonas flavigena DSM 20109] Length = 402 Score = 34.7 bits (78), Expect = 4.2, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 21/34 (61%) Query: 1 [protein fragment, 34 aa] 34 +AGG+D YP N LLEE+ GG SE+P G Sbjct: 203 LAGGVDRAYPAGNARLLEEVVRAGGSLFSEVPPG 236 >gi|94263095|ref|ZP_01286914.1| SMF protein [delta proteobacterium MLMS-1] gi|93456638|gb|EAT06746.1| SMF protein [delta proteobacterium MLMS-1] Length = 381 Score = 34.7 bits (78), Expect = 4.2, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 18/31 (58%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YPP+NR L I G+ + E P G Sbjct: 179 GLDVVYPPQNRQLFHTIGRQRGLLLGEYPLG 209 >gi|220923237|ref|YP_002498539.1| DNA protecting protein DprA [Methylobacterium nodulans ORS 2060] gi|219947844|gb|ACL58236.1| DNA protecting protein DprA [Methylobacterium nodulans ORS 2060] Length = 391 Score = 34.7 bits (78), Expect = 4.3, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 22/34 (64%) Query: 1 [protein fragment, 34 aa] 34 +AGG D +YP E+ L I D+GG ++E+P G Sbjct: 166 LAGGHDRIYPAEHEPLAARILDHGGAIVAEMPLG 199 >gi|253583758|ref|ZP_04860956.1| smf protein [Fusobacterium varium ATCC 27725] gi|251834330|gb|EES62893.1| smf protein [Fusobacterium varium ATCC 27725] Length = 352 Score = 34.7 bits (78), Expect = 4.4, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + GLD +YP ENR L E I + G+ ISE P G Sbjct: 166 VGSGLDVIYPKENRILWENI-EKSGLIISEYPLG 198 >gi|330994161|ref|ZP_08318089.1| Protein smf [Gluconacetobacter sp. SXCC-1] gi|329758628|gb|EGG75144.1| Protein smf [Gluconacetobacter sp. SXCC-1] Length = 390 Score = 34.7 bits (78), Expect = 4.4, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGGLDC YPPE+ +L I G + ++E P G Sbjct: 168 IAGGLDCPYPPEHADLQARIAGTGAV-VTEAPLG 200 >gi|254562490|ref|YP_003069585.1| DNA protecting protein DprA [Methylobacterium extorquens DM4] gi|254269768|emb|CAX25740.1| DNA protecting protein DprA [Methylobacterium extorquens DM4] Length = 397 Score = 34.7 bits (78), Expect = 4.4, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 22/34 (64%) Query: 1 [protein fragment, 34 aa] 34 +AGG D +YP + L+EEI GG ++E+P G Sbjct: 166 LAGGQDQIYPENHAGLVEEIVGAGGAVVAEMPMG 199 >gi|218531570|ref|YP_002422386.1| DNA protecting protein DprA [Methylobacterium chloromethanicum CM4] gi|218523873|gb|ACK84458.1| DNA protecting protein DprA [Methylobacterium chloromethanicum CM4] Length = 397 Score = 34.7 bits (78), Expect = 4.5, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 22/34 (64%) Query: 1 [protein fragment, 34 aa] 34 +AGG D +YP + L+EEI GG ++E+P G Sbjct: 166 LAGGQDRIYPENHAGLVEEIVGAGGAVVAEMPMG 199 >gi|163852730|ref|YP_001640773.1| DNA protecting protein DprA [Methylobacterium extorquens PA1] gi|163664335|gb|ABY31702.1| DNA protecting protein DprA [Methylobacterium extorquens PA1] Length = 397 Score = 34.7 bits (78), Expect = 4.5, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 22/34 (64%) Query: 1 [protein fragment, 34 aa] 34 +AGG D +YP + L+EEI GG ++E+P G Sbjct: 166 LAGGQDRIYPENHAGLVEEIVGAGGAVVAEMPMG 199 >gi|238926948|ref|ZP_04658708.1| SMF family DNA processing protein [Selenomonas flueggei ATCC 43531] gi|238885182|gb|EEQ48820.1| SMF family DNA processing protein [Selenomonas flueggei ATCC 43531] Length = 369 Score = 34.7 bits (78), Expect = 4.5, Method: Composition-based stats. Identities = 15/27 (55%), Positives = 18/27 (66%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISE 30 G+D YP ENR LL EI +GG +SE Sbjct: 181 GVDVAYPSENRRLLAEICTSGGAVLSE 207 >gi|16329968|ref|NP_440696.1| hypothetical protein slr1197 [Synechocystis sp. PCC 6803] gi|3914979|sp|P73345|SMF_SYNY3 RecName: Full=Protein smf gi|1652454|dbj|BAA17376.1| slr1197 [Synechocystis sp. PCC 6803] Length = 398 Score = 34.7 bits (78), Expect = 4.8, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + GLD +YPP+NR L E+I G I +SE P G Sbjct: 178 LGTGLDLIYPPQNRQLFEQIAAEGLI-LSEYPVG 210 >gi|254474217|ref|ZP_05087608.1| DNA processing chain A [Pseudovibrio sp. JE062] gi|211956747|gb|EEA91956.1| DNA processing chain A [Pseudovibrio sp. JE062] Length = 397 Score = 34.7 bits (78), Expect = 5.1, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 19/31 (61%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIP 32 AGG+D +YP EN L + G AISE+P Sbjct: 182 AGGIDTVYPKENLELFSSMIATNGAAISEMP 212 >gi|237736954|ref|ZP_04567435.1| topoisomerase [Fusobacterium mortiferum ATCC 9817] gi|229420816|gb|EEO35863.1| topoisomerase [Fusobacterium mortiferum ATCC 9817] Length = 356 Score = 34.7 bits (78), Expect = 5.1, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + GLD +YP ENR + EEI + G+ +SE P G Sbjct: 169 VGSGLDIIYPYENRKIWEEIGEK-GLLLSEYPMG 201 >gi|145300984|ref|YP_001143825.1| DNA processing chain A [Aeromonas salmonicida subsp. salmonicida A449] gi|142853756|gb|ABO92077.1| DNA processing chain A [Aeromonas salmonicida subsp. salmonicida A449] Length = 371 Score = 34.3 bits (77), Expect = 5.5, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 22/31 (70%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GLDCLYP ++ L +I ++GG+ ISE+ Sbjct: 174 LGSGLDCLYPKRHQGLAGQILESGGLLISEL 204 >gi|330831508|ref|YP_004394460.1| DNA processing chain A [Aeromonas veronii B565] gi|328806644|gb|AEB51843.1| DNA processing chain A [Aeromonas veronii B565] Length = 371 Score = 34.3 bits (77), Expect = 5.7, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 21/31 (67%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GLDCLYP ++ L +I + GG+ ISE+ Sbjct: 174 LGSGLDCLYPKRHQGLAGQILEKGGLLISEL 204 >gi|290512103|ref|ZP_06551471.1| DNA processing protein [Klebsiella sp. 1_1_55] gi|289775893|gb|EFD83893.1| DNA processing protein [Klebsiella sp. 1_1_55] Length = 374 Score = 34.3 bits (77), Expect = 5.7, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 21/33 (63%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ +YP + NL ++I DNGG +SE P Sbjct: 167 LGNGLEQVYPRRHANLAQQIIDNGGTLVSEFPL 199 >gi|126733565|ref|ZP_01749312.1| DNA processing protein DprA, putative [Roseobacter sp. CCS2] gi|126716431|gb|EBA13295.1| DNA processing protein DprA, putative [Roseobacter sp. CCS2] Length = 379 Score = 34.3 bits (77), Expect = 5.7, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 MAGG+D +YP EN L +I G+ +SE+P G Sbjct: 180 MAGGVDIIYPAENTQLAHDIAKR-GLRLSEMPMG 212 >gi|288933301|ref|YP_003437360.1| DNA protecting protein DprA [Klebsiella variicola At-22] gi|288888030|gb|ADC56348.1| DNA protecting protein DprA [Klebsiella variicola At-22] Length = 374 Score = 34.3 bits (77), Expect = 5.8, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 21/33 (63%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ +YP + NL ++I DNGG +SE P Sbjct: 167 LGNGLEQVYPRRHANLAQQIIDNGGTLVSEFPL 199 >gi|154253273|ref|YP_001414097.1| DNA protecting protein DprA [Parvibaculum lavamentivorans DS-1] gi|154157223|gb|ABS64440.1| DNA protecting protein DprA [Parvibaculum lavamentivorans DS-1] Length = 372 Score = 34.3 bits (77), Expect = 6.1, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD +YP ENR L I G + +SE+P G Sbjct: 170 LAGGLDIVYPEENRELQTAIASQGAL-VSEMPPG 202 >gi|85705143|ref|ZP_01036243.1| DNA processing protein DprA, putative [Roseovarius sp. 217] gi|85670465|gb|EAQ25326.1| DNA processing protein DprA, putative [Roseovarius sp. 217] Length = 342 Score = 34.3 bits (77), Expect = 6.2, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 MAGG+D +YP EN L +I N G+ +SE P G Sbjct: 139 MAGGVDVIYPAENSKLASDILAN-GLRLSEQPIG 171 >gi|333030447|ref|ZP_08458508.1| SMF family protein [Bacteroides coprosuis DSM 18011] gi|332741044|gb|EGJ71526.1| SMF family protein [Bacteroides coprosuis DSM 18011] Length = 310 Score = 33.9 bits (76), Expect = 6.9, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 23/34 (67%) Query: 1 [protein fragment, 34 aa] 34 +A GL+ +YP +N +L + I +GG+ +SE P G Sbjct: 186 LAHGLEKVYPYKNSSLADRILASGGVVLSEYPIG 219 >gi|313887109|ref|ZP_07820805.1| DNA protecting protein DprA [Porphyromonas asaccharolytica PR426713P-I] gi|312923338|gb|EFR34151.1| DNA protecting protein DprA [Porphyromonas asaccharolytica PR426713P-I] Length = 384 Score = 33.9 bits (76), Expect = 7.3, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 21/34 (61%) Query: 1 [protein fragment, 34 aa] 34 +A GL +YP +RNL I ++GG +SE P G Sbjct: 179 LAHGLHMIYPSNHRNLARNIVNHGGALLSEYPAG 212 >gi|114327469|ref|YP_744626.1| DNA processing protein [Granulibacter bethesdensis CGDNIH1] gi|114315643|gb|ABI61703.1| DNA processing protein [Granulibacter bethesdensis CGDNIH1] Length = 378 Score = 33.9 bits (76), Expect = 7.3, Method: Composition-based stats. Identities = 18/34 (52%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGGLDC YP EN L I G + ISE+P G Sbjct: 163 VAGGLDCPYPRENIRLQSVIAKRGAV-ISELPLG 195 >gi|146305098|ref|YP_001185563.1| DNA protecting protein DprA [Pseudomonas mendocina ymp] gi|145573299|gb|ABP82831.1| DNA protecting protein DprA [Pseudomonas mendocina ymp] Length = 368 Score = 33.9 bits (76), Expect = 7.4, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 21/33 (63%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+CLYP ++ L +I + GG +SE+P Sbjct: 179 LGTGLECLYPARHKRLAAQIIEQGGALVSELPL 211 >gi|206579194|ref|YP_002236312.1| DNA protecting protein DprA [Klebsiella pneumoniae 342] gi|206568252|gb|ACI10028.1| DNA protecting protein DprA [Klebsiella pneumoniae 342] Length = 360 Score = 33.9 bits (76), Expect = 7.6, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 21/33 (63%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ +YP + NL ++I DNGG +SE P Sbjct: 167 LGNGLEQVYPRRHANLAQQIIDNGGTLVSEFPL 199 >gi|95929065|ref|ZP_01311810.1| DNA processing protein DprA, putative [Desulfuromonas acetoxidans DSM 684] gi|95134966|gb|EAT16620.1| DNA processing protein DprA, putative [Desulfuromonas acetoxidans DSM 684] Length = 363 Score = 33.9 bits (76), Expect = 7.6, Method: Composition-based stats. Identities = 16/31 (51%), Positives = 22/31 (70%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP ENR+L E+I + GI +SE P G Sbjct: 173 GIDLIYPKENRHLFEQIGEK-GIIVSEYPPG 202 >gi|188582755|ref|YP_001926200.1| DNA protecting protein DprA [Methylobacterium populi BJ001] gi|179346253|gb|ACB81665.1| DNA protecting protein DprA [Methylobacterium populi BJ001] Length = 397 Score = 33.9 bits (76), Expect = 7.7, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 22/34 (64%) Query: 1 [protein fragment, 34 aa] 34 +AGG D +YP + L++ I D GG ++E+P G Sbjct: 166 LAGGQDKIYPETHAGLVDAIVDAGGAVVAEMPMG 199 >gi|188586006|ref|YP_001917551.1| DNA protecting protein DprA [Natranaerobius thermophilus JW/NM-WN-LF] gi|179350693|gb|ACB84963.1| DNA protecting protein DprA [Natranaerobius thermophilus JW/NM-WN-LF] Length = 349 Score = 33.9 bits (76), Expect = 8.0, Method: Compositional matrix adjust. Identities = 16/32 (50%), Positives = 22/32 (68%), Gaps = 1/32 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIP 32 + GLD +YPPENR L ++I + G+ ISE P Sbjct: 163 LGNGLDIIYPPENRELYKQISEK-GLLISEYP 193 >gi|117621477|ref|YP_854788.1| DNA protecting protein DprA [Aeromonas hydrophila subsp. hydrophila ATCC 7966] gi|117562884|gb|ABK39832.1| DNA protecting protein DprA [Aeromonas hydrophila subsp. hydrophila ATCC 7966] Length = 371 Score = 33.9 bits (76), Expect = 8.1, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 20/31 (64%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GLDCLYP ++ L EI GG+ ISE+ Sbjct: 174 LGSGLDCLYPKRHQGLAMEILVRGGLLISEL 204 >gi|254463787|ref|ZP_05077198.1| DNA protecting protein DprA [Rhodobacterales bacterium Y4I] gi|206684695|gb|EDZ45177.1| DNA protecting protein DprA [Rhodobacterales bacterium Y4I] Length = 365 Score = 33.9 bits (76), Expect = 8.4, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGG D +YP EN L EEI G+ +SE P G Sbjct: 153 LAGGADVIYPAENTRLAEEICKT-GLRLSEQPMG 185 >gi|218263971|ref|ZP_03477902.1| hypothetical protein PRABACTJOHN_03592 [Parabacteroides johnsonii DSM 18315] gi|218222382|gb|EEC95032.1| hypothetical protein PRABACTJOHN_03592 [Parabacteroides johnsonii DSM 18315] Length = 322 Score = 33.9 bits (76), Expect = 8.5, Method: Composition-based stats. Identities = 16/36 (44%), Positives = 23/36 (63%), Gaps = 2/36 (5%) Query: 1 MAGGLD--CLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD +YP EN L ++I + GG+ +SE P G Sbjct: 179 LANGLDWESIYPKENLELAKDIVEKGGLLLSEYPVG 214 >gi|156932269|ref|YP_001436185.1| DNA protecting protein DprA [Cronobacter sakazakii ATCC BAA-894] gi|156530523|gb|ABU75349.1| hypothetical protein ESA_00040 [Cronobacter sakazakii ATCC BAA-894] Length = 370 Score = 33.9 bits (76), Expect = 8.8, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 20/33 (60%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP +R L EEI + GG +SE PF Sbjct: 167 LGNGLAQVYPTRHRKLAEEIVERGGALVSEFPF 199 >gi|261378982|ref|ZP_05983555.1| putative DNA processing protein DprA [Neisseria cinerea ATCC 14685] gi|269144597|gb|EEZ71015.1| putative DNA processing protein DprA [Neisseria cinerea ATCC 14685] Length = 397 Score = 33.5 bits (75), Expect = 9.2, Method: Compositional matrix adjust. Identities = 16/31 (51%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI + G I +SE P G Sbjct: 180 GIDRIYPPSNKNLAYEIAEKGLI-VSEFPIG 209 >gi|296315164|ref|ZP_06865105.1| putative DNA processing protein DprA [Neisseria polysaccharea ATCC 43768] gi|296837973|gb|EFH21911.1| putative DNA processing protein DprA [Neisseria polysaccharea ATCC 43768] Length = 397 Score = 33.5 bits (75), Expect = 9.4, Method: Compositional matrix adjust. Identities = 16/31 (51%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI + G I +SE P G Sbjct: 180 GIDRIYPPSNKNLAYEIAEKGLI-VSEFPIG 209 >gi|257063753|ref|YP_003143425.1| DNA protecting protein DprA [Slackia heliotrinireducens DSM 20476] gi|256791406|gb|ACV22076.1| DNA protecting protein DprA [Slackia heliotrinireducens DSM 20476] Length = 319 Score = 33.5 bits (75), Expect = 9.4, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 21/33 (63%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GG D YP EN +L +++ D GG +SE P+ Sbjct: 109 LGGGCDMPYPVENFDLFQQVVDAGGAVVSEHPW 141 Searching..................................................done Results from round 2 >gi|150396156|ref|YP_001326623.1| DNA protecting protein DprA [Sinorhizobium medicae WSM419] gi|150027671|gb|ABR59788.1| DNA protecting protein DprA [Sinorhizobium medicae WSM419] Length = 383 Score = 64.4 bits (156), Expect = 5e-09, Method: Composition-based stats. Identities = 23/34 (67%), Positives = 27/34 (79%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YPPEN LL+EI GG+AISE+PFG Sbjct: 178 LAGGLDRPYPPENIGLLQEIVSGGGLAISEMPFG 211 >gi|222085614|ref|YP_002544144.1| DNA protecting protein DprA [Agrobacterium radiobacter K84] gi|221723062|gb|ACM26218.1| DNA protecting protein DprA [Agrobacterium radiobacter K84] Length = 383 Score = 64.0 bits (155), Expect = 7e-09, Method: Composition-based stats. Identities = 24/34 (70%), Positives = 27/34 (79%) Query: 1 [protein fragment, 34 aa] 34 MAGGLD YPPEN LL EIWD G+A+SE+PFG Sbjct: 178 MAGGLDQPYPPENVGLLNEIWDGNGLAVSEMPFG 211 >gi|49475582|ref|YP_033623.1| DNA processing chain A [Bartonella henselae str. Houston-1] gi|49238389|emb|CAF27616.1| DNA processing chain A [Bartonella henselae str. Houston-1] Length = 410 Score = 63.3 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 21/34 (61%), Positives = 26/34 (76%) Query: 1 [protein fragment, 34 aa] 34 MAGG+D +YPPEN+ L E+I NGG ISE+P G Sbjct: 184 MAGGIDHIYPPENKKLHEDIIANGGAIISEMPIG 217 >gi|222148310|ref|YP_002549267.1| DNA protecting protein DprA [Agrobacterium vitis S4] gi|221735298|gb|ACM36261.1| DNA protecting protein DprA [Agrobacterium vitis S4] Length = 383 Score = 63.3 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 23/34 (67%), Positives = 29/34 (85%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YPPEN +LL++IWD G+AISE+PFG Sbjct: 178 LAGGLDRPYPPENVDLLKDIWDGKGVAISEMPFG 211 >gi|319408534|emb|CBI82187.1| DNA processing chain A [Bartonella schoenbuchensis R1] Length = 404 Score = 63.3 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 20/34 (58%), Positives = 26/34 (76%) Query: 1 [protein fragment, 34 aa] 34 MAGG+D +YPPEN+ L ++I NGG ISE+P G Sbjct: 178 MAGGIDHIYPPENKKLYDDIITNGGAIISEMPVG 211 >gi|307301126|ref|ZP_07580895.1| DNA protecting protein DprA [Sinorhizobium meliloti BL225C] gi|306904081|gb|EFN34667.1| DNA protecting protein DprA [Sinorhizobium meliloti BL225C] Length = 383 Score = 62.1 bits (150), Expect = 2e-08, Method: Composition-based stats. Identities = 21/34 (61%), Positives = 26/34 (76%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YPPEN LL+EI G+A+SE+PFG Sbjct: 178 LAGGLDRPYPPENLGLLQEIVSGEGLAVSEMPFG 211 >gi|319898957|ref|YP_004159050.1| DNA processing chain A [Bartonella clarridgeiae 73] gi|319402921|emb|CBI76472.1| DNA processing chain A [Bartonella clarridgeiae 73] Length = 383 Score = 62.1 bits (150), Expect = 2e-08, Method: Composition-based stats. Identities = 20/34 (58%), Positives = 26/34 (76%) Query: 1 [protein fragment, 34 aa] 34 MAGG+D +YPPEN+ L ++I NGG ISE+P G Sbjct: 157 MAGGIDHIYPPENKKLYDDILANGGAIISEMPIG 190 >gi|319404285|emb|CBI77878.1| DNA processing chain A [Bartonella rochalimae ATCC BAA-1498] Length = 383 Score = 61.7 bits (149), Expect = 3e-08, Method: Composition-based stats. Identities = 20/34 (58%), Positives = 26/34 (76%) Query: 1 [protein fragment, 34 aa] 34 MAGG+D +YPPEN+ L ++I NGG ISE+P G Sbjct: 167 MAGGIDHIYPPENQKLYDDILANGGAIISEMPIG 200 >gi|319405728|emb|CBI79351.1| DNA processing chain A [Bartonella sp. AR 15-3] Length = 383 Score = 61.7 bits (149), Expect = 3e-08, Method: Composition-based stats. Identities = 20/34 (58%), Positives = 26/34 (76%) Query: 1 [protein fragment, 34 aa] 34 MAGG+D +YPPEN+ L ++I NGG ISE+P G Sbjct: 167 MAGGIDYIYPPENKKLYDDILTNGGAIISEMPIG 200 >gi|15965054|ref|NP_385407.1| hypothetical protein SMc01363 [Sinorhizobium meliloti 1021] gi|15074233|emb|CAC45880.1| Conserved hypothetical protein [Sinorhizobium meliloti 1021] Length = 383 Score = 61.3 bits (148), Expect = 4e-08, Method: Composition-based stats. Identities = 21/34 (61%), Positives = 26/34 (76%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YPPEN LL+EI G+A+SE+PFG Sbjct: 178 LAGGLDRPYPPENLGLLQEIVSGEGLAVSEMPFG 211 >gi|307317859|ref|ZP_07597297.1| DNA protecting protein DprA [Sinorhizobium meliloti AK83] gi|306896621|gb|EFN27369.1| DNA protecting protein DprA [Sinorhizobium meliloti AK83] Length = 383 Score = 61.0 bits (147), Expect = 5e-08, Method: Composition-based stats. Identities = 21/34 (61%), Positives = 26/34 (76%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YPPEN LL+EI G+A+SE+PFG Sbjct: 178 LAGGLDRPYPPENLGLLQEIVSGEGLAVSEMPFG 211 >gi|15888630|ref|NP_354311.1| DNA processing chain A [Agrobacterium tumefaciens str. C58] gi|15156358|gb|AAK87096.1| DNA processing chain A [Agrobacterium tumefaciens str. C58] Length = 380 Score = 60.6 bits (146), Expect = 7e-08, Method: Composition-based stats. Identities = 21/34 (61%), Positives = 26/34 (76%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YP EN LL++I+D GG ISE+PFG Sbjct: 178 LAGGLDRPYPQENFGLLQDIYDQGGATISEMPFG 211 >gi|240850661|ref|YP_002972061.1| DNA processing chain A [Bartonella grahamii as4aup] gi|240267784|gb|ACS51372.1| DNA processing chain A [Bartonella grahamii as4aup] Length = 404 Score = 60.6 bits (146), Expect = 7e-08, Method: Composition-based stats. Identities = 20/33 (60%), Positives = 25/33 (75%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 MAGG+D +YPPEN+ L E+I NGG ISE+P Sbjct: 178 MAGGIDHIYPPENKRLYEDIIANGGAIISEMPI 210 >gi|319407290|emb|CBI80931.1| DNA processing chain A [Bartonella sp. 1-1C] Length = 383 Score = 60.6 bits (146), Expect = 8e-08, Method: Composition-based stats. Identities = 20/34 (58%), Positives = 26/34 (76%) Query: 1 [protein fragment, 34 aa] 34 MAGG+D +YPPEN+ L ++I NGG ISE+P G Sbjct: 167 MAGGIDYIYPPENQKLYDDILANGGAIISEMPIG 200 >gi|260424749|ref|ZP_05733144.2| DNA processing protein DprA [Dialister invisus DSM 15470] gi|260403042|gb|EEW96589.1| DNA processing protein DprA [Dialister invisus DSM 15470] Length = 363 Score = 60.2 bits (145), Expect = 9e-08, Method: Composition-based stats. Identities = 21/34 (61%), Positives = 26/34 (76%) Query: 1 [protein fragment, 34 aa] 34 +A GLD +YPPEN+NL ++I DNGG ISE P G Sbjct: 170 LACGLDHVYPPENKNLFQKIIDNGGTIISEYPPG 203 >gi|209548899|ref|YP_002280816.1| DNA protecting protein DprA [Rhizobium leguminosarum bv. trifolii WSM2304] gi|209534655|gb|ACI54590.1| DNA protecting protein DprA [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 380 Score = 60.2 bits (145), Expect = 9e-08, Method: Composition-based stats. Identities = 22/34 (64%), Positives = 26/34 (76%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YPPEN LLEEI G+A+SE+PFG Sbjct: 178 LAGGLDQPYPPENIGLLEEITSGNGLAVSEMPFG 211 >gi|227821656|ref|YP_002825626.1| DNA processing chain A [Sinorhizobium fredii NGR234] gi|227340655|gb|ACP24873.1| DNA processing chain A [Sinorhizobium fredii NGR234] Length = 386 Score = 59.8 bits (144), Expect = 1e-07, Method: Composition-based stats. Identities = 22/34 (64%), Positives = 26/34 (76%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YPPEN LL+EI G+AISE+PFG Sbjct: 178 LAGGLDRPYPPENIGLLQEITAGEGLAISEMPFG 211 >gi|49474246|ref|YP_032288.1| DNA processing chain A [Bartonella quintana str. Toulouse] gi|49239750|emb|CAF26132.1| DNA processing chain A [Bartonella quintana str. Toulouse] Length = 410 Score = 59.8 bits (144), Expect = 1e-07, Method: Composition-based stats. Identities = 19/33 (57%), Positives = 25/33 (75%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 MAGG+D +YPPEN+ L E+I +GG ISE+P Sbjct: 184 MAGGVDHIYPPENKKLHEDIITHGGAIISEMPI 216 >gi|116251502|ref|YP_767340.1| smf protein [Rhizobium leguminosarum bv. viciae 3841] gi|115256150|emb|CAK07231.1| putative smf protein [Rhizobium leguminosarum bv. viciae 3841] Length = 380 Score = 59.8 bits (144), Expect = 1e-07, Method: Composition-based stats. Identities = 22/34 (64%), Positives = 26/34 (76%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YPPEN LLEEI G+A+SE+PFG Sbjct: 178 LAGGLDQPYPPENIGLLEEITGGNGLAVSEMPFG 211 >gi|325292667|ref|YP_004278531.1| DNA processing chain A [Agrobacterium sp. H13-3] gi|325060520|gb|ADY64211.1| DNA processing chain A [Agrobacterium sp. H13-3] Length = 379 Score = 59.4 bits (143), Expect = 1e-07, Method: Composition-based stats. Identities = 20/34 (58%), Positives = 26/34 (76%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YP EN LL++I++ GG ISE+PFG Sbjct: 178 LAGGLDRPYPQENFGLLQDIYEEGGATISEMPFG 211 >gi|241204123|ref|YP_002975219.1| DNA protecting protein DprA [Rhizobium leguminosarum bv. trifolii WSM1325] gi|240858013|gb|ACS55680.1| DNA protecting protein DprA [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 380 Score = 59.4 bits (143), Expect = 2e-07, Method: Composition-based stats. Identities = 22/34 (64%), Positives = 26/34 (76%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YPPEN LLEEI G+A+SE+PFG Sbjct: 178 LAGGLDQPYPPENIGLLEEITGGNGLAVSEMPFG 211 >gi|218513189|ref|ZP_03510029.1| DNA processing chain A protein [Rhizobium etli 8C-3] Length = 352 Score = 59.0 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 21/34 (61%), Positives = 26/34 (76%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YPPEN L+EEI G+A+SE+PFG Sbjct: 165 LAGGLDRPYPPENLGLIEEIAGGNGLAVSEMPFG 198 >gi|190891322|ref|YP_001977864.1| DNA processing chain A protein [Rhizobium etli CIAT 652] gi|190696601|gb|ACE90686.1| DNA processing chain A protein [Rhizobium etli CIAT 652] Length = 380 Score = 59.0 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 21/34 (61%), Positives = 26/34 (76%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YPPEN L+EEI G+A+SE+PFG Sbjct: 178 LAGGLDRPYPPENLGLIEEIAGGNGLAVSEMPFG 211 >gi|163868294|ref|YP_001609503.1| DNA processing chain A [Bartonella tribocorum CIP 105476] gi|161017950|emb|CAK01508.1| DNA processing chain A [Bartonella tribocorum CIP 105476] Length = 404 Score = 58.6 bits (141), Expect = 2e-07, Method: Composition-based stats. Identities = 19/33 (57%), Positives = 25/33 (75%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 MAGG++ +YPPEN+ L E+I NGG ISE+P Sbjct: 178 MAGGINHIYPPENKKLYEDIIANGGAIISEMPI 210 >gi|86357273|ref|YP_469165.1| DNA processing chain A protein [Rhizobium etli CFN 42] gi|86281375|gb|ABC90438.1| probable DNA processing chain A protein [Rhizobium etli CFN 42] Length = 380 Score = 58.6 bits (141), Expect = 3e-07, Method: Composition-based stats. Identities = 21/34 (61%), Positives = 26/34 (76%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YPPEN L+EEI G+A+SE+PFG Sbjct: 178 LAGGLDKPYPPENLGLIEEITGGNGLAVSEMPFG 211 >gi|218674768|ref|ZP_03524437.1| DNA processing chain A protein [Rhizobium etli GR56] Length = 380 Score = 58.6 bits (141), Expect = 3e-07, Method: Composition-based stats. Identities = 21/34 (61%), Positives = 26/34 (76%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YPPEN L+EEI G+A+SE+PFG Sbjct: 178 LAGGLDKPYPPENHGLIEEIAGGNGLAVSEMPFG 211 >gi|315122272|ref|YP_004062761.1| hypothetical protein CKC_02620 [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313495674|gb|ADR52273.1| hypothetical protein CKC_02620 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 298 Score = 58.6 bits (141), Expect = 3e-07, Method: Composition-based stats. Identities = 29/34 (85%), Positives = 32/34 (94%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 MAGGLDCLYPPENR+LLEEIW + GIAISE+PFG Sbjct: 179 MAGGLDCLYPPENRSLLEEIW-HEGIAISEMPFG 211 >gi|121602381|ref|YP_989130.1| DNA protecting protein DprA [Bartonella bacilliformis KC583] gi|120614558|gb|ABM45159.1| DNA protecting protein DprA [Bartonella bacilliformis KC583] Length = 396 Score = 57.9 bits (139), Expect = 5e-07, Method: Composition-based stats. Identities = 19/33 (57%), Positives = 24/33 (72%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 MAGG+D +YP EN+ L +I DNGG ISE+P Sbjct: 172 MAGGIDHIYPSENKKLYNDIIDNGGAIISEMPI 204 >gi|27380215|ref|NP_771744.1| DNA processing protein [Bradyrhizobium japonicum USDA 110] gi|27353369|dbj|BAC50369.1| DNA processing protein [Bradyrhizobium japonicum USDA 110] Length = 380 Score = 56.7 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 20/34 (58%), Positives = 26/34 (76%) Query: 1 [protein fragment, 34 aa] 34 +AGG DC+YPPE+ +LL I D+ G AISE+P G Sbjct: 183 LAGGHDCIYPPEHGDLLTSILDHAGAAISEMPLG 216 >gi|254780304|ref|YP_003064717.1| DNA protecting protein DprA [Candidatus Liberibacter asiaticus str. psy62] gi|254039981|gb|ACT56777.1| DNA protecting protein DprA [Candidatus Liberibacter asiaticus str. psy62] Length = 34 Score = 56.3 bits (135), Expect = 1e-06, Method: Composition-based stats. Identities = 34/34 (100%), Positives = 34/34 (100%) Query: 1 [protein fragment, 34 aa] 34 [protein fragment, 34 aa] Sbjct: 1 [protein fragment, 34 aa] 34 >gi|115525378|ref|YP_782289.1| DNA processing protein DprA, putative [Rhodopseudomonas palustris BisA53] gi|115519325|gb|ABJ07309.1| DNA protecting protein DprA [Rhodopseudomonas palustris BisA53] Length = 372 Score = 55.9 bits (134), Expect = 2e-06, Method: Composition-based stats. Identities = 19/34 (55%), Positives = 25/34 (73%) Query: 1 [protein fragment, 34 aa] 34 +AGG D +YPPE+ +LL +I GG AISE+P G Sbjct: 175 LAGGHDRIYPPEHEDLLADILAQGGAAISEMPLG 208 >gi|328543466|ref|YP_004303575.1| DNA protecting protein DprA [polymorphum gilvum SL003B-26A1] gi|326413210|gb|ADZ70273.1| DNA protecting protein DprA, putative [Polymorphum gilvum SL003B-26A1] Length = 380 Score = 55.6 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 22/33 (66%), Positives = 25/33 (75%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGG+D LYPPE+ LL I D GG AISE+PFG Sbjct: 179 AGGIDILYPPEHDGLLARILDAGGSAISEMPFG 211 >gi|163759336|ref|ZP_02166422.1| putative smf protein [Hoeflea phototrophica DFL-43] gi|162283740|gb|EDQ34025.1| putative smf protein [Hoeflea phototrophica DFL-43] Length = 383 Score = 55.6 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 20/34 (58%), Positives = 25/34 (73%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YPPEN +L +EI G+AISE+P G Sbjct: 178 LAGGLDQPYPPENLDLYDEIRAGKGLAISEMPMG 211 >gi|218506638|ref|ZP_03504516.1| DNA processing chain A protein [Rhizobium etli Brasil 5] Length = 167 Score = 55.6 bits (133), Expect = 2e-06, Method: Composition-based stats. Identities = 20/34 (58%), Positives = 25/34 (73%) Query: 1 [protein fragment, 34 aa] 34 + GGLD YPPEN L+EEI G+A+SE+PFG Sbjct: 39 LPGGLDRPYPPENLGLIEEIAGGNGLAVSEMPFG 72 >gi|299135144|ref|ZP_07028335.1| DNA protecting protein DprA [Afipia sp. 1NLS2] gi|298590121|gb|EFI50325.1| DNA protecting protein DprA [Afipia sp. 1NLS2] Length = 373 Score = 54.0 bits (129), Expect = 7e-06, Method: Composition-based stats. Identities = 20/34 (58%), Positives = 24/34 (70%) Query: 1 [protein fragment, 34 aa] 34 +AGG D +YPPE+ LL I D GG AISE+P G Sbjct: 176 LAGGHDRIYPPEHEGLLAAIIDAGGGAISEMPLG 209 >gi|304391708|ref|ZP_07373650.1| DNA protecting protein DprA [Ahrensia sp. R2A130] gi|303295937|gb|EFL90295.1| DNA protecting protein DprA [Ahrensia sp. R2A130] Length = 378 Score = 53.6 bits (128), Expect = 9e-06, Method: Composition-based stats. Identities = 21/33 (63%), Positives = 24/33 (72%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGG+D LYPPEN LL+ I GG AISE+P G Sbjct: 178 AGGVDHLYPPENGPLLDAILATGGAAISEMPLG 210 >gi|148256077|ref|YP_001240662.1| DNA processing chain A (DprA/Smf) [Bradyrhizobium sp. BTAi1] gi|146408250|gb|ABQ36756.1| DNA processing chain A (DprA/Smf) [Bradyrhizobium sp. BTAi1] Length = 372 Score = 52.5 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 18/34 (52%), Positives = 24/34 (70%) Query: 1 [protein fragment, 34 aa] 34 +AGG D +YPPE+ +LL I + G AISE+P G Sbjct: 175 LAGGHDRIYPPEHIDLLGAIVERNGAAISEMPLG 208 >gi|220929474|ref|YP_002506383.1| DNA protecting protein DprA [Clostridium cellulolyticum H10] gi|219999802|gb|ACL76403.1| DNA protecting protein DprA [Clostridium cellulolyticum H10] Length = 374 Score = 52.5 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 18/34 (52%), Positives = 25/34 (73%) Query: 1 [protein fragment, 34 aa] 34 + GLD +YPPEN L ++I D+GG+A+SE P G Sbjct: 171 LGSGLDNIYPPENAGLFKDIIDSGGLALSEYPPG 204 >gi|153010990|ref|YP_001372204.1| DNA protecting protein DprA [Ochrobactrum anthropi ATCC 49188] gi|151562878|gb|ABS16375.1| DNA protecting protein DprA [Ochrobactrum anthropi ATCC 49188] Length = 388 Score = 52.1 bits (124), Expect = 3e-05, Method: Composition-based stats. Identities = 20/34 (58%), Positives = 23/34 (67%) Query: 1 [protein fragment, 34 aa] 34 +AGGLDC YPPEN L I + GG ISE+P G Sbjct: 178 LAGGLDCPYPPENLPLYHAIPEQGGALISEMPMG 211 >gi|90423747|ref|YP_532117.1| DNA processing protein DprA, putative [Rhodopseudomonas palustris BisB18] gi|90105761|gb|ABD87798.1| DNA processing protein DprA, putative [Rhodopseudomonas palustris BisB18] Length = 372 Score = 51.7 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 19/34 (55%), Positives = 23/34 (67%) Query: 1 [protein fragment, 34 aa] 34 +AGG D +YPPE+ LL I GG AISE+P G Sbjct: 175 LAGGHDKIYPPEHDELLAAILGEGGAAISEMPLG 208 >gi|146341416|ref|YP_001206464.1| DNA processing chain A (DprA/Smf) [Bradyrhizobium sp. ORS278] gi|146194222|emb|CAL78244.1| DNA processing chain A (DprA/Smf) [Bradyrhizobium sp. ORS278] Length = 371 Score = 51.7 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 18/34 (52%), Positives = 24/34 (70%) Query: 1 [protein fragment, 34 aa] 34 +AGG D +YPPE+ +LL I + G AISE+P G Sbjct: 174 LAGGHDRIYPPEHVDLLGAIIGSHGAAISEMPLG 207 >gi|91977499|ref|YP_570158.1| DNA processing protein DprA, putative [Rhodopseudomonas palustris BisB5] gi|91683955|gb|ABE40257.1| DNA processing protein DprA, putative [Rhodopseudomonas palustris BisB5] Length = 422 Score = 51.3 bits (122), Expect = 4e-05, Method: Composition-based stats. Identities = 18/34 (52%), Positives = 25/34 (73%) Query: 1 [protein fragment, 34 aa] 34 +AGG D +YPPE+ +LL +I + G AISE+P G Sbjct: 225 LAGGHDKIYPPEHEDLLLDIVEARGAAISEMPLG 258 >gi|306845936|ref|ZP_07478503.1| DNA protecting protein DprA [Brucella sp. BO1] gi|306273571|gb|EFM55416.1| DNA protecting protein DprA [Brucella sp. BO1] Length = 393 Score = 51.3 bits (122), Expect = 5e-05, Method: Composition-based stats. Identities = 19/34 (55%), Positives = 23/34 (67%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YPPEN L I +NGG I+E+P G Sbjct: 178 LAGGLDRPYPPENLPLYRAIPENGGALITEMPMG 211 >gi|294853600|ref|ZP_06794272.1| DNA processing protein [Brucella sp. NVSL 07-0026] gi|294819255|gb|EFG36255.1| DNA processing protein [Brucella sp. NVSL 07-0026] Length = 393 Score = 50.9 bits (121), Expect = 5e-05, Method: Composition-based stats. Identities = 19/34 (55%), Positives = 23/34 (67%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YPPEN L I +NGG I+E+P G Sbjct: 178 LAGGLDRPYPPENLPLYRAIPENGGALITEMPMG 211 >gi|254720411|ref|ZP_05182222.1| SMF protein [Brucella sp. 83/13] gi|265985430|ref|ZP_06098165.1| DNA protecting protein DprA [Brucella sp. 83/13] gi|306839012|ref|ZP_07471833.1| DNA protecting protein DprA [Brucella sp. NF 2653] gi|264664022|gb|EEZ34283.1| DNA protecting protein DprA [Brucella sp. 83/13] gi|306405918|gb|EFM62176.1| DNA protecting protein DprA [Brucella sp. NF 2653] Length = 393 Score = 50.9 bits (121), Expect = 6e-05, Method: Composition-based stats. Identities = 19/34 (55%), Positives = 23/34 (67%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YPPEN L I +NGG I+E+P G Sbjct: 178 LAGGLDRPYPPENLPLYRAIPENGGALITEMPMG 211 >gi|23500346|ref|NP_699786.1| DNA processing protein DprA [Brucella suis 1330] gi|161620664|ref|YP_001594550.1| DNA protecting protein DprA [Brucella canis ATCC 23365] gi|254702977|ref|ZP_05164805.1| DNA protecting protein DprA [Brucella suis bv. 3 str. 686] gi|260568110|ref|ZP_05838579.1| SMF protein [Brucella suis bv. 4 str. 40] gi|261753586|ref|ZP_05997295.1| DNA protecting protein DprA [Brucella suis bv. 3 str. 686] gi|23463962|gb|AAN33791.1| DNA processing protein DprA, putative [Brucella suis 1330] gi|161337475|gb|ABX63779.1| DNA protecting protein DprA [Brucella canis ATCC 23365] gi|260154775|gb|EEW89856.1| SMF protein [Brucella suis bv. 4 str. 40] gi|261743339|gb|EEY31265.1| DNA protecting protein DprA [Brucella suis bv. 3 str. 686] Length = 393 Score = 50.9 bits (121), Expect = 6e-05, Method: Composition-based stats. Identities = 19/34 (55%), Positives = 23/34 (67%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YPPEN L I +NGG I+E+P G Sbjct: 178 LAGGLDRPYPPENLPLYRAIPENGGALITEMPMG 211 >gi|254699839|ref|ZP_05161667.1| SMF protein [Brucella suis bv. 5 str. 513] gi|261750312|ref|ZP_05994021.1| DNA protecting protein DprA [Brucella suis bv. 5 str. 513] gi|261740065|gb|EEY27991.1| DNA protecting protein DprA [Brucella suis bv. 5 str. 513] Length = 393 Score = 50.9 bits (121), Expect = 6e-05, Method: Composition-based stats. Identities = 19/34 (55%), Positives = 23/34 (67%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YPPEN L I +NGG I+E+P G Sbjct: 178 LAGGLDRPYPPENLPLYRAIPENGGALITEMPMG 211 >gi|225686388|ref|YP_002734360.1| DNA protecting protein DprA [Brucella melitensis ATCC 23457] gi|256262471|ref|ZP_05465003.1| SMF protein [Brucella melitensis bv. 2 str. 63/9] gi|225642493|gb|ACO02406.1| DNA protecting protein DprA [Brucella melitensis ATCC 23457] gi|263092207|gb|EEZ16504.1| SMF protein [Brucella melitensis bv. 2 str. 63/9] Length = 393 Score = 50.9 bits (121), Expect = 6e-05, Method: Composition-based stats. Identities = 19/34 (55%), Positives = 23/34 (67%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YPPEN L I +NGG I+E+P G Sbjct: 178 LAGGLDRPYPPENLPLYRAIPENGGALITEMPMG 211 >gi|254691038|ref|ZP_05154292.1| SMF protein [Brucella abortus bv. 6 str. 870] Length = 381 Score = 50.9 bits (121), Expect = 6e-05, Method: Composition-based stats. Identities = 19/34 (55%), Positives = 23/34 (67%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YPPEN L I +NGG I+E+P G Sbjct: 166 LAGGLDRPYPPENLPLYRAIPENGGALITEMPMG 199 >gi|17989012|ref|NP_541645.1| SMF protein [Brucella melitensis bv. 1 str. 16M] gi|62317541|ref|YP_223394.1| DNA processing protein DprA [Brucella abortus bv. 1 str. 9-941] gi|83269522|ref|YP_418813.1| SMF protein [Brucella melitensis biovar Abortus 2308] gi|189022796|ref|YP_001932537.1| SMF protein [Brucella abortus S19] gi|225629094|ref|ZP_03787127.1| DNA protecting protein DprA [Brucella ceti str. Cudo] gi|237817089|ref|ZP_04596081.1| DNA protecting protein DprA [Brucella abortus str. 2308 A] gi|254698822|ref|ZP_05160650.1| SMF protein [Brucella abortus bv. 2 str. 86/8/59] gi|254705901|ref|ZP_05167729.1| SMF protein [Brucella pinnipedialis M163/99/10] gi|254711129|ref|ZP_05172940.1| SMF protein [Brucella pinnipedialis B2/94] gi|254712412|ref|ZP_05174223.1| SMF protein [Brucella ceti M644/93/1] gi|254715484|ref|ZP_05177295.1| SMF protein [Brucella ceti M13/05/1] gi|254732269|ref|ZP_05190847.1| SMF protein [Brucella abortus bv. 4 str. 292] gi|256015379|ref|YP_003105388.1| DNA processing protein DprA, putative [Brucella microti CCM 4915] gi|256029510|ref|ZP_05443124.1| SMF protein [Brucella pinnipedialis M292/94/1] gi|256043499|ref|ZP_05446426.1| SMF protein [Brucella melitensis bv. 1 str. Rev.1] gi|256059205|ref|ZP_05449411.1| SMF protein [Brucella neotomae 5K33] gi|256157705|ref|ZP_05455623.1| SMF protein [Brucella ceti M490/95/1] gi|256253323|ref|ZP_05458859.1| SMF protein [Brucella ceti B1/94] gi|256256223|ref|ZP_05461759.1| SMF protein [Brucella abortus bv. 9 str. C68] gi|260167399|ref|ZP_05754210.1| DNA processing protein DprA, putative [Brucella sp. F5/99] gi|260544777|ref|ZP_05820598.1| SMF protein [Brucella abortus NCTC 8038] gi|260564694|ref|ZP_05835179.1| SMF protein [Brucella melitensis bv. 1 str. 16M] gi|260760064|ref|ZP_05872412.1| DNA protecting protein DprA [Brucella abortus bv. 4 str. 292] gi|260763303|ref|ZP_05875635.1| DNA protecting protein DprA [Brucella abortus bv. 2 str. 86/8/59] gi|260882451|ref|ZP_05894065.1| DNA protecting protein DprA [Brucella abortus bv. 9 str. C68] gi|261217219|ref|ZP_05931500.1| DNA protecting protein DprA [Brucella ceti M13/05/1] gi|261220439|ref|ZP_05934720.1| DNA protecting protein DprA [Brucella ceti B1/94] gi|261313331|ref|ZP_05952528.1| DNA protecting protein DprA [Brucella pinnipedialis M163/99/10] gi|261318720|ref|ZP_05957917.1| DNA protecting protein DprA [Brucella pinnipedialis B2/94] gi|261320090|ref|ZP_05959287.1| DNA protecting protein DprA [Brucella ceti M644/93/1] gi|261323154|ref|ZP_05962351.1| DNA protecting protein DprA [Brucella neotomae 5K33] gi|261756809|ref|ZP_06000518.1| SMF protein [Brucella sp. F5/99] gi|265986518|ref|ZP_06099075.1| DNA protecting protein DprA [Brucella pinnipedialis M292/94/1] gi|265989917|ref|ZP_06102474.1| DNA protecting protein DprA [Brucella melitensis bv. 1 str. Rev.1] gi|265996210|ref|ZP_06108767.1| DNA protecting protein DprA [Brucella ceti M490/95/1] gi|297249580|ref|ZP_06933281.1| DNA processing protein [Brucella abortus bv. 5 str. B3196] gi|17984851|gb|AAL53909.1| smf protein [Brucella melitensis bv. 1 str. 16M] gi|62197734|gb|AAX76033.1| hypothetical DprA, DNA processing protein [Brucella abortus bv. 1 str. 9-941] gi|82939796|emb|CAJ12804.1| SMF protein [Brucella melitensis biovar Abortus 2308] gi|189021370|gb|ACD74091.1| SMF protein [Brucella abortus S19] gi|225615590|gb|EEH12639.1| DNA protecting protein DprA [Brucella ceti str. Cudo] gi|237787902|gb|EEP62118.1| DNA protecting protein DprA [Brucella abortus str. 2308 A] gi|255998039|gb|ACU49726.1| DNA processing protein DprA, putative [Brucella microti CCM 4915] gi|260098048|gb|EEW81922.1| SMF protein [Brucella abortus NCTC 8038] gi|260152337|gb|EEW87430.1| SMF protein [Brucella melitensis bv. 1 str. 16M] gi|260670382|gb|EEX57322.1| DNA protecting protein DprA [Brucella abortus bv. 4 str. 292] gi|260673724|gb|EEX60545.1| DNA protecting protein DprA [Brucella abortus bv. 2 str. 86/8/59] gi|260871979|gb|EEX79048.1| DNA protecting protein DprA [Brucella abortus bv. 9 str. C68] gi|260919023|gb|EEX85676.1| DNA protecting protein DprA [Brucella ceti B1/94] gi|260922308|gb|EEX88876.1| DNA protecting protein DprA [Brucella ceti M13/05/1] gi|261292780|gb|EEX96276.1| DNA protecting protein DprA [Brucella ceti M644/93/1] gi|261297943|gb|EEY01440.1| DNA protecting protein DprA [Brucella pinnipedialis B2/94] gi|261299134|gb|EEY02631.1| DNA protecting protein DprA [Brucella neotomae 5K33] gi|261302357|gb|EEY05854.1| DNA protecting protein DprA [Brucella pinnipedialis M163/99/10] gi|261736793|gb|EEY24789.1| SMF protein [Brucella sp. F5/99] gi|262550507|gb|EEZ06668.1| DNA protecting protein DprA [Brucella ceti M490/95/1] gi|263000586|gb|EEZ13276.1| DNA protecting protein DprA [Brucella melitensis bv. 1 str. Rev.1] gi|264658715|gb|EEZ28976.1| DNA protecting protein DprA [Brucella pinnipedialis M292/94/1] gi|297173449|gb|EFH32813.1| DNA processing protein [Brucella abortus bv. 5 str. B3196] Length = 393 Score = 50.9 bits (121), Expect = 6e-05, Method: Composition-based stats. Identities = 19/34 (55%), Positives = 23/34 (67%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YPPEN L I +NGG I+E+P G Sbjct: 178 LAGGLDRPYPPENLPLYRAIPENGGALITEMPMG 211 >gi|254695655|ref|ZP_05157483.1| SMF protein [Brucella abortus bv. 3 str. Tulya] gi|261216055|ref|ZP_05930336.1| DNA protecting protein DprA [Brucella abortus bv. 3 str. Tulya] gi|260917662|gb|EEX84523.1| DNA protecting protein DprA [Brucella abortus bv. 3 str. Tulya] Length = 393 Score = 50.9 bits (121), Expect = 6e-05, Method: Composition-based stats. Identities = 19/34 (55%), Positives = 23/34 (67%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YPPEN L I +NGG I+E+P G Sbjct: 178 LAGGLDRPYPPENLPLYRAIPENGGALITEMPMG 211 >gi|256111481|ref|ZP_05452495.1| SMF protein [Brucella melitensis bv. 3 str. Ether] gi|265992978|ref|ZP_06105535.1| DNA protecting protein DprA [Brucella melitensis bv. 3 str. Ether] gi|262763848|gb|EEZ09880.1| DNA protecting protein DprA [Brucella melitensis bv. 3 str. Ether] Length = 388 Score = 50.6 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 19/34 (55%), Positives = 23/34 (67%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YPPEN L I +NGG I+E+P G Sbjct: 178 LAGGLDRPYPPENLPLYRAIPENGGALITEMPMG 211 >gi|326410760|gb|ADZ67824.1| DNA protecting protein DprA [Brucella melitensis M28] gi|326554052|gb|ADZ88691.1| DNA protecting protein DprA [Brucella melitensis M5-90] Length = 393 Score = 50.6 bits (120), Expect = 7e-05, Method: Composition-based stats. Identities = 19/34 (55%), Positives = 22/34 (64%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YPPEN L I NGG I+E+P G Sbjct: 178 LAGGLDRPYPPENLPLYRAIPKNGGALITEMPMG 211 >gi|77918023|ref|YP_355838.1| Rossmann-fold nucleotide-binding protein [Pelobacter carbinolicus DSM 2380] gi|77544106|gb|ABA87668.1| DNA protecting protein DprA [Pelobacter carbinolicus DSM 2380] Length = 366 Score = 50.6 bits (120), Expect = 8e-05, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 21/34 (61%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YP EN+ L +I D GG +SE P G Sbjct: 171 LGCGIDRIYPAENKQLFNDILDQGGAILSEYPPG 204 >gi|306841750|ref|ZP_07474436.1| DNA protecting protein DprA [Brucella sp. BO2] gi|306288155|gb|EFM59542.1| DNA protecting protein DprA [Brucella sp. BO2] Length = 345 Score = 50.2 bits (119), Expect = 1e-04, Method: Composition-based stats. Identities = 19/34 (55%), Positives = 23/34 (67%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YPPEN L I +NGG I+E+P G Sbjct: 130 LAGGLDRPYPPENLPLYRAIPENGGALITEMPMG 163 >gi|260756634|ref|ZP_05868982.1| DNA protecting protein DprA [Brucella abortus bv. 6 str. 870] gi|260676742|gb|EEX63563.1| DNA protecting protein DprA [Brucella abortus bv. 6 str. 870] Length = 343 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 19/34 (55%), Positives = 23/34 (67%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YPPEN L I +NGG I+E+P G Sbjct: 128 LAGGLDRPYPPENLPLYRAIPENGGALITEMPMG 161 >gi|303228920|ref|ZP_07315730.1| DNA protecting protein DprA [Veillonella atypica ACS-134-V-Col7a] gi|302516334|gb|EFL58266.1| DNA protecting protein DprA [Veillonella atypica ACS-134-V-Col7a] Length = 378 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 22/34 (64%) Query: 1 [protein fragment, 34 aa] 34 M GLD +YPPEN+ L + + N G+ +SE P G Sbjct: 180 MGCGLDIVYPPENKRLFDAVLKNNGLLVSEYPPG 213 >gi|319783706|ref|YP_004143182.1| DNA protecting protein DprA [Mesorhizobium ciceri biovar biserrulae WSM1271] gi|317169594|gb|ADV13132.1| DNA protecting protein DprA [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 379 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 21/34 (61%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YPPEN L EEI G ISE+PFG Sbjct: 175 LAGGLDQPYPPENAGLCEEI-AERGAIISEMPFG 207 >gi|303231443|ref|ZP_07318174.1| DNA protecting protein DprA [Veillonella atypica ACS-049-V-Sch6] gi|302513880|gb|EFL55891.1| DNA protecting protein DprA [Veillonella atypica ACS-049-V-Sch6] Length = 378 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 22/34 (64%) Query: 1 [protein fragment, 34 aa] 34 M GLD +YPPEN+ L + + N G+ +SE P G Sbjct: 180 MGCGLDIVYPPENKRLFDAVLKNNGLLVSEYPPG 213 >gi|290968766|ref|ZP_06560303.1| DNA protecting protein DprA [Megasphaera genomosp. type_1 str. 28L] gi|290781062|gb|EFD93653.1| DNA protecting protein DprA [Megasphaera genomosp. type_1 str. 28L] Length = 363 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 21/34 (61%), Positives = 23/34 (67%) Query: 1 [protein fragment, 34 aa] 34 +A GLD YP EN+ L EEI NGG ISE PFG Sbjct: 172 VASGLDITYPRENKKLFEEIAANGGGIISEYPFG 205 >gi|325290385|ref|YP_004266566.1| DNA protecting protein DprA [Syntrophobotulus glycolicus DSM 8271] gi|324965786|gb|ADY56565.1| DNA protecting protein DprA [Syntrophobotulus glycolicus DSM 8271] Length = 383 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 21/34 (61%), Positives = 24/34 (70%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD +YPPENR L EI +N G ISE P G Sbjct: 172 LAGGLDRIYPPENRKLAAEIIEN-GALISEYPPG 204 >gi|114707187|ref|ZP_01440085.1| DNA processing chain A [Fulvimarina pelagi HTCC2506] gi|114537383|gb|EAU40509.1| DNA processing chain A [Fulvimarina pelagi HTCC2506] Length = 377 Score = 49.0 bits (116), Expect = 2e-04, Method: Composition-based stats. Identities = 21/33 (63%), Positives = 23/33 (69%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGGLD YPPENR+L+ I D GG IS PFG Sbjct: 177 AGGLDMPYPPENRSLMRRIVDEGGCLISARPFG 209 >gi|209884919|ref|YP_002288776.1| SMF protein [Oligotropha carboxidovorans OM5] gi|209873115|gb|ACI92911.1| SMF protein [Oligotropha carboxidovorans OM5] Length = 377 Score = 48.6 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 23/34 (67%) Query: 1 [protein fragment, 34 aa] 34 +AGG D +YPPE+ +LL+ I G AISE+ G Sbjct: 176 LAGGHDRIYPPEHESLLDAILAANGGAISEMQLG 209 >gi|163844754|ref|YP_001622409.1| DNA protecting protein DprA [Brucella suis ATCC 23445] gi|163675477|gb|ABY39587.1| DNA protecting protein DprA [Brucella suis ATCC 23445] Length = 393 Score = 48.6 bits (115), Expect = 3e-04, Method: Composition-based stats. Identities = 19/34 (55%), Positives = 23/34 (67%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YPPEN L I +NGG I+E+P G Sbjct: 178 LAGGLDRPYPPENLPLYRAIPENGGALITEVPMG 211 >gi|86749541|ref|YP_486037.1| DNA processing protein DprA, putative [Rhodopseudomonas palustris HaA2] gi|86572569|gb|ABD07126.1| DNA processing protein DprA, putative [Rhodopseudomonas palustris HaA2] Length = 378 Score = 48.2 bits (114), Expect = 3e-04, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 24/34 (70%) Query: 1 [protein fragment, 34 aa] 34 +AGG D +YP E+ +LL +I + G AISE+P G Sbjct: 181 LAGGHDKIYPAEHEDLLLDIIEARGAAISEMPLG 214 >gi|192291901|ref|YP_001992506.1| DNA protecting protein DprA [Rhodopseudomonas palustris TIE-1] gi|192285650|gb|ACF02031.1| DNA protecting protein DprA [Rhodopseudomonas palustris TIE-1] Length = 378 Score = 48.2 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 23/34 (67%) Query: 1 [protein fragment, 34 aa] 34 +AGG D +YP E+ +LL +I G AISE+P G Sbjct: 181 LAGGHDKIYPAEHEDLLLDIIQTRGAAISEMPLG 214 >gi|148558431|ref|YP_001257589.1| SMF protein [Brucella ovis ATCC 25840] gi|148369716|gb|ABQ62588.1| SMF protein [Brucella ovis ATCC 25840] Length = 393 Score = 47.9 bits (113), Expect = 4e-04, Method: Composition-based stats. Identities = 18/34 (52%), Positives = 22/34 (64%) Query: 1 [protein fragment, 34 aa] 34 +AG LD YPPEN L I +NGG I+E+P G Sbjct: 178 LAGRLDRPYPPENLPLYRAIPENGGALITEMPMG 211 >gi|39936183|ref|NP_948459.1| DNA processing protein DprA [Rhodopseudomonas palustris CGA009] gi|39650038|emb|CAE28561.1| DNA processing chain A [Rhodopseudomonas palustris CGA009] Length = 380 Score = 47.9 bits (113), Expect = 5e-04, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 23/34 (67%) Query: 1 [protein fragment, 34 aa] 34 +AGG D +YP E+ +LL +I G AISE+P G Sbjct: 183 LAGGHDKIYPAEHEDLLLDIIQTRGAAISEMPLG 216 >gi|220923237|ref|YP_002498539.1| DNA protecting protein DprA [Methylobacterium nodulans ORS 2060] gi|219947844|gb|ACL58236.1| DNA protecting protein DprA [Methylobacterium nodulans ORS 2060] Length = 391 Score = 47.9 bits (113), Expect = 5e-04, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 22/34 (64%) Query: 1 [protein fragment, 34 aa] 34 +AGG D +YP E+ L I D+GG ++E+P G Sbjct: 166 LAGGHDRIYPAEHEPLAARILDHGGAIVAEMPLG 199 >gi|260459178|ref|ZP_05807433.1| DNA protecting protein DprA [Mesorhizobium opportunistum WSM2075] gi|259034732|gb|EEW35988.1| DNA protecting protein DprA [Mesorhizobium opportunistum WSM2075] Length = 383 Score = 47.9 bits (113), Expect = 6e-04, Method: Composition-based stats. Identities = 20/34 (58%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YPPEN L +EI G ISE+PFG Sbjct: 182 LAGGLDLPYPPENAGLCDEI-AERGAVISEMPFG 214 >gi|329121225|ref|ZP_08249852.1| DNA processing protein DprA [Dialister micraerophilus DSM 19965] gi|327470159|gb|EGF15622.1| DNA processing protein DprA [Dialister micraerophilus DSM 19965] Length = 363 Score = 47.5 bits (112), Expect = 6e-04, Method: Composition-based stats. Identities = 19/33 (57%), Positives = 21/33 (63%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 A GLD YP ENRNL E+I +GG ISE G Sbjct: 170 ACGLDKTYPAENRNLFEKIIAHGGCIISEYAPG 202 >gi|254501021|ref|ZP_05113172.1| DNA protecting protein DprA, putative [Labrenzia alexandrii DFL-11] gi|222437092|gb|EEE43771.1| DNA protecting protein DprA, putative [Labrenzia alexandrii DFL-11] Length = 378 Score = 47.5 bits (112), Expect = 6e-04, Method: Composition-based stats. Identities = 18/33 (54%), Positives = 22/33 (66%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGG+D LYP ++ LL I GG ISE+PFG Sbjct: 177 AGGIDVLYPSDHDRLLAAILQTGGAVISEMPFG 209 >gi|307946437|ref|ZP_07661772.1| DNA protecting protein DprA [Roseibium sp. TrichSKD4] gi|307770101|gb|EFO29327.1| DNA protecting protein DprA [Roseibium sp. TrichSKD4] Length = 378 Score = 47.5 bits (112), Expect = 6e-04, Method: Composition-based stats. Identities = 18/33 (54%), Positives = 25/33 (75%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGG+D LYPP++ LL + + GG AI+E+PFG Sbjct: 177 AGGIDILYPPDHAGLLSSLLERGGNAITEMPFG 209 >gi|256832232|ref|YP_003160959.1| DNA protecting protein DprA [Jonesia denitrificans DSM 20603] gi|256685763|gb|ACV08656.1| DNA protecting protein DprA [Jonesia denitrificans DSM 20603] Length = 395 Score = 47.5 bits (112), Expect = 6e-04, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 24/34 (70%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGG+D LYP N+ LL+ + D+ G +SE+P G Sbjct: 163 LAGGVDRLYPQGNKKLLQRLIDH-GALVSEMPVG 195 >gi|163792865|ref|ZP_02186841.1| Predicted Rossmann fold nucleotide-binding protein [alpha proteobacterium BAL199] gi|159181511|gb|EDP66023.1| Predicted Rossmann fold nucleotide-binding protein [alpha proteobacterium BAL199] Length = 379 Score = 47.5 bits (112), Expect = 6e-04, Method: Composition-based stats. Identities = 18/34 (52%), Positives = 27/34 (79%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGG+D YPPE+ LL++I +N GIA++E+P G Sbjct: 173 LAGGIDVTYPPEHAGLLQQIVEN-GIAVAEMPVG 205 >gi|316933647|ref|YP_004108629.1| DNA protecting protein DprA [Rhodopseudomonas palustris DX-1] gi|315601361|gb|ADU43896.1| DNA protecting protein DprA [Rhodopseudomonas palustris DX-1] Length = 378 Score = 47.5 bits (112), Expect = 7e-04, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 24/34 (70%) Query: 1 [protein fragment, 34 aa] 34 +AGG D +YP E+ +LL +I + G AISE+P G Sbjct: 181 LAGGHDKIYPAEHEDLLLDIVQSRGAAISEMPLG 214 >gi|313892558|ref|ZP_07826145.1| DNA protecting protein DprA [Dialister microaerophilus UPII 345-E] gi|313118955|gb|EFR42160.1| DNA protecting protein DprA [Dialister microaerophilus UPII 345-E] Length = 363 Score = 47.1 bits (111), Expect = 7e-04, Method: Composition-based stats. Identities = 19/33 (57%), Positives = 21/33 (63%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 A GLD YP ENRNL E+I +GG ISE G Sbjct: 170 ACGLDKTYPAENRNLFEKIIAHGGCIISEYAPG 202 >gi|237795718|ref|YP_002863270.1| DNA uptake protein [Clostridium botulinum Ba4 str. 657] gi|229261789|gb|ACQ52822.1| DNA uptake protein [Clostridium botulinum Ba4 str. 657] Length = 385 Score = 47.1 bits (111), Expect = 7e-04, Method: Composition-based stats. Identities = 18/34 (52%), Positives = 22/34 (64%) Query: 1 [protein fragment, 34 aa] 34 +A GLD +YP EN L + I +NGG ISE P G Sbjct: 178 LAHGLDMIYPRENIELSKSILNNGGTLISEYPVG 211 >gi|92117808|ref|YP_577537.1| DNA processing protein DprA, putative [Nitrobacter hamburgensis X14] gi|91800702|gb|ABE63077.1| DNA processing protein DprA, putative [Nitrobacter hamburgensis X14] Length = 372 Score = 47.1 bits (111), Expect = 8e-04, Method: Composition-based stats. Identities = 19/34 (55%), Positives = 26/34 (76%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGG D +YPPE+ +LL I ++GG AISE+P G Sbjct: 175 LAGGHDRIYPPEHEDLLAAILEDGG-AISEMPMG 207 >gi|25028474|ref|NP_738528.1| putative DNA processing protein [Corynebacterium efficiens YS-314] gi|259507533|ref|ZP_05750433.1| Rossmann-fold nucleotide-binding protein [Corynebacterium efficiens YS-314] gi|23493759|dbj|BAC18728.1| putative DNA processing protein [Corynebacterium efficiens YS-314] gi|259164918|gb|EEW49472.1| Rossmann-fold nucleotide-binding protein [Corynebacterium efficiens YS-314] Length = 403 Score = 47.1 bits (111), Expect = 8e-04, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 20/33 (60%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 A GLD YP NR L EE+ + GG ++E P G Sbjct: 194 ACGLDRSYPAHNRGLFEEVVNRGGAIVTEYPPG 226 >gi|118590183|ref|ZP_01547586.1| hypothetical protein SIAM614_11733 [Stappia aggregata IAM 12614] gi|118437155|gb|EAV43793.1| hypothetical protein SIAM614_11733 [Stappia aggregata IAM 12614] Length = 378 Score = 47.1 bits (111), Expect = 8e-04, Method: Composition-based stats. Identities = 17/33 (51%), Positives = 23/33 (69%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGG++ LYPPE+ LL + + GG ISE+P G Sbjct: 177 AGGINVLYPPEHDRLLAAVLETGGAVISEMPLG 209 >gi|144898216|emb|CAM75080.1| DNA processing chain A [Magnetospirillum gryphiswaldense MSR-1] Length = 377 Score = 47.1 bits (111), Expect = 8e-04, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 25/34 (73%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGG+D +YPPEN+ L ++I G A+SE+P G Sbjct: 173 LAGGVDVVYPPENQRLYDDIVAM-GCAVSEMPPG 205 >gi|240140065|ref|YP_002964542.1| DNA protecting protein DprA [Methylobacterium extorquens AM1] gi|240010039|gb|ACS41265.1| DNA protecting protein DprA [Methylobacterium extorquens AM1] Length = 397 Score = 47.1 bits (111), Expect = 0.001, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 22/34 (64%) Query: 1 [protein fragment, 34 aa] 34 +AGG D +YP + L+EEI GG ++E+P G Sbjct: 166 LAGGQDRIYPENHAGLVEEIVGAGGAVVAEMPMG 199 >gi|238019258|ref|ZP_04599684.1| hypothetical protein VEIDISOL_01122 [Veillonella dispar ATCC 17748] gi|237863957|gb|EEP65247.1| hypothetical protein VEIDISOL_01122 [Veillonella dispar ATCC 17748] Length = 408 Score = 46.7 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 20/34 (58%) Query: 1 [protein fragment, 34 aa] 34 M GLD +YP EN L + I N G+ +SE P G Sbjct: 179 MGCGLDIVYPRENTKLFDRILQNNGLLVSEYPPG 212 >gi|218531570|ref|YP_002422386.1| DNA protecting protein DprA [Methylobacterium chloromethanicum CM4] gi|218523873|gb|ACK84458.1| DNA protecting protein DprA [Methylobacterium chloromethanicum CM4] Length = 397 Score = 46.7 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 22/34 (64%) Query: 1 [protein fragment, 34 aa] 34 +AGG D +YP + L+EEI GG ++E+P G Sbjct: 166 LAGGQDRIYPENHAGLVEEIVGAGGAVVAEMPMG 199 >gi|326204632|ref|ZP_08194488.1| DNA protecting protein DprA [Clostridium papyrosolvens DSM 2782] gi|325985199|gb|EGD46039.1| DNA protecting protein DprA [Clostridium papyrosolvens DSM 2782] Length = 374 Score = 46.7 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 22/34 (64%) Query: 1 [protein fragment, 34 aa] 34 + GLD +YP EN L +EI D+ G+ +SE P G Sbjct: 171 LGSGLDNIYPQENAGLFKEIIDSKGLVLSEYPPG 204 >gi|225849802|ref|YP_002730036.1| protein smf (DNA-processing chain A) [Persephonella marina EX-H1] gi|225645083|gb|ACO03269.1| protein smf (DNA-processing chain A) [Persephonella marina EX-H1] Length = 352 Score = 46.7 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D YPPEN+ L E I +N G ISE P G Sbjct: 169 LGCGIDIAYPPENKKLYERIIEN-GAVISEFPMG 201 >gi|163852730|ref|YP_001640773.1| DNA protecting protein DprA [Methylobacterium extorquens PA1] gi|163664335|gb|ABY31702.1| DNA protecting protein DprA [Methylobacterium extorquens PA1] Length = 397 Score = 46.7 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 22/34 (64%) Query: 1 [protein fragment, 34 aa] 34 +AGG D +YP + L+EEI GG ++E+P G Sbjct: 166 LAGGQDRIYPENHAGLVEEIVGAGGAVVAEMPMG 199 >gi|91205528|ref|YP_537883.1| putative DNA processing protein DprA [Rickettsia bellii RML369-C] gi|91069072|gb|ABE04794.1| Putative DNA processing protein DprA [Rickettsia bellii RML369-C] Length = 225 Score = 46.7 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGG+D +YPPEN+ L E G+ I+E+P G Sbjct: 13 IAGGIDHIYPPENKKLFEN-LAEEGLIIAELPVG 45 >gi|157827244|ref|YP_001496308.1| putative DNA processing protein DprA [Rickettsia bellii OSU 85-389] gi|157802548|gb|ABV79271.1| Putative DNA processing protein DprA [Rickettsia bellii OSU 85-389] Length = 223 Score = 46.3 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGG+D +YPPEN+ L E G+ I+E+P G Sbjct: 13 IAGGIDHIYPPENKKLFEN-LAEEGLIIAELPVG 45 >gi|313892683|ref|ZP_07826266.1| DNA protecting protein DprA [Veillonella sp. oral taxon 158 str. F0412] gi|313442774|gb|EFR61183.1| DNA protecting protein DprA [Veillonella sp. oral taxon 158 str. F0412] Length = 408 Score = 46.3 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 20/34 (58%) Query: 1 [protein fragment, 34 aa] 34 M GLD +YP EN L + I N G+ +SE P G Sbjct: 179 MGCGLDIVYPRENTKLFDRILQNNGLLLSEYPPG 212 >gi|13470875|ref|NP_102444.1| DNA processing chain A [Mesorhizobium loti MAFF303099] gi|14021618|dbj|BAB48230.1| DNA processing chain A [Mesorhizobium loti MAFF303099] Length = 377 Score = 46.3 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 20/34 (58%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YPPEN L EI G ISE+PFG Sbjct: 175 LAGGLDLPYPPENAGLCAEI-AERGAVISEMPFG 207 >gi|110633709|ref|YP_673917.1| DNA protecting protein DprA [Mesorhizobium sp. BNC1] gi|110284693|gb|ABG62752.1| DNA protecting protein DprA [Chelativorans sp. BNC1] Length = 378 Score = 46.3 bits (109), Expect = 0.001, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YPPEN L I G+ ++E+PFG Sbjct: 176 LAGGLDRPYPPENDGLFRAI-GERGVVLTEMPFG 208 >gi|153815654|ref|ZP_01968322.1| hypothetical protein RUMTOR_01890 [Ruminococcus torques ATCC 27756] gi|317502440|ref|ZP_07960604.1| smf family protein [Lachnospiraceae bacterium 8_1_57FAA] gi|145847085|gb|EDK24003.1| hypothetical protein RUMTOR_01890 [Ruminococcus torques ATCC 27756] gi|316896178|gb|EFV18285.1| smf family protein [Lachnospiraceae bacterium 8_1_57FAA] Length = 357 Score = 45.9 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%) Query: 1 [protein fragment, 34 aa] 34 + G+D YP E+ L +I + GG ISE+P G Sbjct: 168 LGCGVDVCYPREHIGLYVDILEQGGGIISEMPPG 201 >gi|254562490|ref|YP_003069585.1| DNA protecting protein DprA [Methylobacterium extorquens DM4] gi|254269768|emb|CAX25740.1| DNA protecting protein DprA [Methylobacterium extorquens DM4] Length = 397 Score = 45.9 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 22/34 (64%) Query: 1 [protein fragment, 34 aa] 34 +AGG D +YP + L+EEI GG ++E+P G Sbjct: 166 LAGGQDQIYPENHAGLVEEIVGAGGAVVAEMPMG 199 >gi|320108287|ref|YP_004183877.1| DNA protecting protein DprA [Terriglobus saanensis SP1PR4] gi|319926808|gb|ADV83883.1| DNA protecting protein DprA [Terriglobus saanensis SP1PR4] Length = 410 Score = 45.9 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 16/31 (51%), Positives = 20/31 (64%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP EN+ L EEI GG +SE P G Sbjct: 201 GIDVIYPKENKRLAEEILQGGGAIVSEYPLG 231 >gi|73666848|ref|YP_302864.1| SMF protein [Ehrlichia canis str. Jake] gi|72393989|gb|AAZ68266.1| SMF protein [Ehrlichia canis str. Jake] Length = 374 Score = 45.9 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 23/33 (69%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 MA G++ +YP EN +L + I D GG+ I+E PF Sbjct: 174 MASGINIVYPQENTHLYKTIIDKGGLIITEFPF 206 >gi|58696725|ref|ZP_00372270.1| DNA processing chain A [Wolbachia endosymbiont of Drosophila simulans] gi|225630004|ref|YP_002726795.1| DNA processing chain A [Wolbachia sp. wRi] gi|58537093|gb|EAL60213.1| DNA processing chain A [Wolbachia endosymbiont of Drosophila simulans] gi|225591985|gb|ACN95004.1| DNA processing chain A [Wolbachia sp. wRi] Length = 362 Score = 45.9 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 16/32 (50%), Positives = 24/32 (75%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 A G+D +YP EN +L ++I NGG+ I+E+PF Sbjct: 164 ASGIDVVYPKENFDLYKKITGNGGLVITELPF 195 >gi|322436363|ref|YP_004218575.1| DNA protecting protein DprA [Acidobacterium sp. MP5ACTX9] gi|321164090|gb|ADW69795.1| DNA protecting protein DprA [Acidobacterium sp. MP5ACTX9] Length = 404 Score = 45.9 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 17/31 (54%), Positives = 20/31 (64%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP EN+ L EEI GG +SE P G Sbjct: 187 GLDVVYPKENKRLAEEIVTGGGAIVSEYPLG 217 >gi|312897996|ref|ZP_07757405.1| DNA protecting protein DprA [Megasphaera micronuciformis F0359] gi|310620921|gb|EFQ04472.1| DNA protecting protein DprA [Megasphaera micronuciformis F0359] Length = 367 Score = 45.5 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 17/31 (54%), Positives = 18/31 (58%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD YPPEN L I GG+ SE PFG Sbjct: 179 GLDKTYPPENAALFRRIIGAGGVVCSEFPFG 209 >gi|305681197|ref|ZP_07404004.1| DNA protecting protein DprA [Corynebacterium matruchotii ATCC 14266] gi|305659402|gb|EFM48902.1| DNA protecting protein DprA [Corynebacterium matruchotii ATCC 14266] Length = 405 Score = 45.5 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 18/33 (54%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 A GLD YP N ++L I + G +SE P G Sbjct: 197 ACGLDRPYPRRNHDMLTTIAQHNGALVSEYPPG 229 >gi|225021105|ref|ZP_03710297.1| hypothetical protein CORMATOL_01117 [Corynebacterium matruchotii ATCC 33806] gi|224946105|gb|EEG27314.1| hypothetical protein CORMATOL_01117 [Corynebacterium matruchotii ATCC 33806] Length = 405 Score = 45.5 bits (107), Expect = 0.002, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 18/33 (54%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 A GLD YP N ++L I + G +SE P G Sbjct: 197 ACGLDRPYPRRNHDMLTTIAQHNGALVSEYPPG 229 >gi|58698108|ref|ZP_00373031.1| DNA processing chain A [Wolbachia endosymbiont of Drosophila ananassae] gi|58535354|gb|EAL59430.1| DNA processing chain A [Wolbachia endosymbiont of Drosophila ananassae] Length = 346 Score = 45.5 bits (107), Expect = 0.003, Method: Composition-based stats. Identities = 16/32 (50%), Positives = 24/32 (75%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 A G+D +YP EN +L ++I NGG+ I+E+PF Sbjct: 148 ASGIDVVYPKENFDLYKKITGNGGLVITELPF 179 >gi|67458923|ref|YP_246547.1| putative DNA processing protein DprA [Rickettsia felis URRWXCal2] gi|67004456|gb|AAY61382.1| Putatie DNA processing protein DprA [Rickettsia felis URRWXCal2] Length = 382 Score = 45.5 bits (107), Expect = 0.003, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGG+D +YPPEN+ L E G+ ++E+P G Sbjct: 177 IAGGIDHIYPPENKKLFEN-LAEEGLILAELPIG 209 >gi|294791910|ref|ZP_06757058.1| DNA processing protein DprA [Veillonella sp. 6_1_27] gi|294457140|gb|EFG25502.1| DNA processing protein DprA [Veillonella sp. 6_1_27] Length = 408 Score = 45.5 bits (107), Expect = 0.003, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 19/34 (55%) Query: 1 [protein fragment, 34 aa] 34 M GLD YP EN L + I N G+ +SE P G Sbjct: 179 MGCGLDITYPRENAKLFDRILQNNGLLLSEYPPG 212 >gi|42520001|ref|NP_965916.1| DNA processing chain A [Wolbachia endosymbiont of Drosophila melanogaster] gi|42409738|gb|AAS13850.1| DNA processing chain A [Wolbachia endosymbiont of Drosophila melanogaster] Length = 362 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 16/32 (50%), Positives = 24/32 (75%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 A G+D +YP EN +L ++I NGG+ I+E+PF Sbjct: 164 ASGIDVVYPKENFDLYKKITGNGGLVITELPF 195 >gi|315648145|ref|ZP_07901246.1| DNA protecting protein DprA [Paenibacillus vortex V453] gi|315276791|gb|EFU40134.1| DNA protecting protein DprA [Paenibacillus vortex V453] Length = 391 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 18/34 (52%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YPPENR+L EEI G+ ISE P G Sbjct: 190 LGAGIDVIYPPENRSLYEEI-AAKGLVISEYPPG 222 >gi|68536255|ref|YP_250960.1| putative DNA processing protein [Corynebacterium jeikeium K411] gi|260578955|ref|ZP_05846858.1| DNA processing protein [Corynebacterium jeikeium ATCC 43734] gi|68263854|emb|CAI37342.1| putative DNA processing protein [Corynebacterium jeikeium K411] gi|258602929|gb|EEW16203.1| DNA processing protein [Corynebacterium jeikeium ATCC 43734] Length = 396 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 18/34 (52%), Positives = 22/34 (64%) Query: 1 [protein fragment, 34 aa] 34 MA GLD YP + NL E+I +GG+ ISE P G Sbjct: 198 MACGLDVSYPKAHANLFEQIVGSGGMLISEYPPG 231 >gi|225677140|ref|ZP_03788139.1| DNA processing chain A [Wolbachia endosymbiont of Muscidifurax uniraptor] gi|225590807|gb|EEH12035.1| DNA processing chain A [Wolbachia endosymbiont of Muscidifurax uniraptor] Length = 362 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 15/32 (46%), Positives = 25/32 (78%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 A G+D +YP EN +L ++I +NGG+ ++E+PF Sbjct: 164 ASGIDVVYPKENFDLYKKITENGGLVVTELPF 195 >gi|83309780|ref|YP_420044.1| Rossmann fold nucleotide-binding protein [Magnetospirillum magneticum AMB-1] gi|82944621|dbj|BAE49485.1| Predicted Rossmann fold nucleotide-binding protein [Magnetospirillum magneticum AMB-1] Length = 383 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGG+D +YPPEN +L EI G +SE+P G Sbjct: 181 LAGGVDVVYPPENTDLWREI-GAAGAVVSEMPVG 213 >gi|329929328|ref|ZP_08283081.1| DNA protecting protein DprA [Paenibacillus sp. HGF5] gi|328936697|gb|EGG33140.1| DNA protecting protein DprA [Paenibacillus sp. HGF5] Length = 391 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 18/34 (52%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YPPENR+L EEI G+ ISE P G Sbjct: 190 LGAGIDVIYPPENRSLYEEI-AAKGLIISEYPPG 222 >gi|170742467|ref|YP_001771122.1| DNA protecting protein DprA [Methylobacterium sp. 4-46] gi|168196741|gb|ACA18688.1| DNA protecting protein DprA [Methylobacterium sp. 4-46] Length = 391 Score = 45.2 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%) Query: 1 [protein fragment, 34 aa] 34 +AGG D +YP E+ L I GG ++E+P G Sbjct: 166 LAGGQDRIYPAEHEALAARILAQGGAIVAEMPLG 199 >gi|254474217|ref|ZP_05087608.1| DNA processing chain A [Pseudovibrio sp. JE062] gi|211956747|gb|EEA91956.1| DNA processing chain A [Pseudovibrio sp. JE062] Length = 397 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 15/32 (46%), Positives = 19/32 (59%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 AGG+D +YP EN L + G AISE+P Sbjct: 182 AGGIDTVYPKENLELFSSMIATNGAAISEMPI 213 >gi|295982522|pdb|3MAJ|A Chain A, Crystal Structure Of Putative Dna Processing Protein Dpra Fr Rhodopseudomonas Palustris Cga009 Length = 382 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 22/34 (64%) Query: 1 [protein fragment, 34 aa] 34 +AGG D +YP E+ +LL +I G AISE P G Sbjct: 185 LAGGHDKIYPAEHEDLLLDIIQTRGAAISEXPLG 218 >gi|261407992|ref|YP_003244233.1| DNA protecting protein DprA [Paenibacillus sp. Y412MC10] gi|261284455|gb|ACX66426.1| DNA protecting protein DprA [Paenibacillus sp. Y412MC10] Length = 391 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 18/34 (52%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YPPENR+L EEI G+ ISE P G Sbjct: 190 LGAGIDVIYPPENRSLYEEI-AAKGLIISEYPPG 222 >gi|188582755|ref|YP_001926200.1| DNA protecting protein DprA [Methylobacterium populi BJ001] gi|179346253|gb|ACB81665.1| DNA protecting protein DprA [Methylobacterium populi BJ001] Length = 397 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 22/34 (64%) Query: 1 [protein fragment, 34 aa] 34 +AGG D +YP + L++ I D GG ++E+P G Sbjct: 166 LAGGQDKIYPETHAGLVDAIVDAGGAVVAEMPMG 199 >gi|260427296|ref|ZP_05781275.1| protein smf [Citreicella sp. SE45] gi|260421788|gb|EEX15039.1| protein smf [Citreicella sp. SE45] Length = 398 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 19/34 (55%), Positives = 22/34 (64%) Query: 1 [protein fragment, 34 aa] 34 +AGG+D LYP EN L EEI GG +SE P G Sbjct: 182 LAGGVDVLYPSENTRLAEEIRAQGGAVVSEQPIG 215 >gi|88657722|ref|YP_507678.1| putative DNA processing protein DprA [Ehrlichia chaffeensis str. Arkansas] gi|88599179|gb|ABD44648.1| putative DNA processing protein DprA [Ehrlichia chaffeensis str. Arkansas] Length = 375 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 22/33 (66%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 MA G++ +YP EN +L I D GG+ I+E PF Sbjct: 174 MASGVNIVYPQENIHLYNTIVDKGGLIITEFPF 206 >gi|251772341|gb|EES52909.1| putative DNA processing protein DprA [Leptospirillum ferrodiazotrophum] Length = 292 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 17/31 (54%), Positives = 20/31 (64%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YPPEN L EI GG+ +SE P G Sbjct: 177 GLDRVYPPENVGLAREIERTGGLILSEYPPG 207 >gi|46200754|ref|ZP_00056433.2| COG0758: Predicted Rossmann fold nucleotide-binding protein involved in DNA uptake [Magnetospirillum magnetotacticum MS-1] Length = 383 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGG+D +YPPEN +L EI G +SE+P G Sbjct: 181 LAGGVDVVYPPENTDLWREICA-AGTVVSEMPVG 213 >gi|89895301|ref|YP_518788.1| hypothetical protein DSY2555 [Desulfitobacterium hafniense Y51] gi|219669735|ref|YP_002460170.1| DNA protecting protein DprA [Desulfitobacterium hafniense DCB-2] gi|89334749|dbj|BAE84344.1| hypothetical protein [Desulfitobacterium hafniense Y51] gi|219539995|gb|ACL21734.1| DNA protecting protein DprA [Desulfitobacterium hafniense DCB-2] Length = 389 Score = 44.8 bits (105), Expect = 0.004, Method: Composition-based stats. Identities = 18/34 (52%), Positives = 21/34 (61%) Query: 1 [protein fragment, 34 aa] 34 M GL+ +YPPEN+ L EEI GG SE P G Sbjct: 182 MGCGLNHMYPPENQKLAEEILAKGGALWSEFPPG 215 >gi|313895732|ref|ZP_07829288.1| DNA protecting protein DprA [Selenomonas sp. oral taxon 137 str. F0430] gi|320528987|ref|ZP_08030079.1| DNA protecting protein DprA [Selenomonas artemidis F0399] gi|312975858|gb|EFR41317.1| DNA protecting protein DprA [Selenomonas sp. oral taxon 137 str. F0430] gi|320138617|gb|EFW30507.1| DNA protecting protein DprA [Selenomonas artemidis F0399] Length = 363 Score = 44.8 bits (105), Expect = 0.005, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 21/34 (61%) Query: 1 [protein fragment, 34 aa] 34 + G+D YPPENR L+ +I D GG +SE G Sbjct: 172 LGCGVDIAYPPENRRLIAQIIDAGGAVLSEYAPG 205 >gi|259046716|ref|ZP_05737117.1| DNA processing chain A [Granulicatella adiacens ATCC 49175] gi|259036612|gb|EEW37867.1| DNA processing chain A [Granulicatella adiacens ATCC 49175] Length = 288 Score = 44.8 bits (105), Expect = 0.005, Method: Composition-based stats. Identities = 18/34 (52%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + GLD +YPPEN NL +EI G+ ISE P G Sbjct: 169 IGSGLDVVYPPENANLYKEI-GEKGLIISEYPLG 201 >gi|241667272|ref|ZP_04754850.1| DNA processing protein DprA [Francisella philomiragia subsp. philomiragia ATCC 25015] gi|254875823|ref|ZP_05248533.1| DNA processing protein dprA [Francisella philomiragia subsp. philomiragia ATCC 25015] gi|254841844|gb|EET20258.1| DNA processing protein dprA [Francisella philomiragia subsp. philomiragia ATCC 25015] Length = 366 Score = 44.4 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 19/31 (61%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP NR L I N G+ ISE+P G Sbjct: 175 GVDIIYPSSNRELYSNIISNNGLIISELPLG 205 >gi|255526680|ref|ZP_05393584.1| DNA protecting protein DprA [Clostridium carboxidivorans P7] gi|296185600|ref|ZP_06854009.1| DNA protecting protein DprA [Clostridium carboxidivorans P7] gi|255509612|gb|EET85948.1| DNA protecting protein DprA [Clostridium carboxidivorans P7] gi|296049728|gb|EFG89153.1| DNA protecting protein DprA [Clostridium carboxidivorans P7] Length = 364 Score = 44.4 bits (104), Expect = 0.005, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + GG+D +YP E+ L+EEI G ISE P G Sbjct: 171 LGGGVDKVYPKEHIKLMEEIIA-KGAVISEYPPG 203 >gi|164687263|ref|ZP_02211291.1| hypothetical protein CLOBAR_00904 [Clostridium bartlettii DSM 16795] gi|164603687|gb|EDQ97152.1| hypothetical protein CLOBAR_00904 [Clostridium bartlettii DSM 16795] Length = 304 Score = 44.4 bits (104), Expect = 0.006, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 21/34 (61%) Query: 1 [protein fragment, 34 aa] 34 + GLD YPPEN +L +EI +N G ISE G Sbjct: 175 LPCGLDKYYPPENCDLGDEILENEGCLISEYKIG 208 >gi|320535372|ref|ZP_08035486.1| DNA protecting protein DprA [Treponema phagedenis F0421] gi|320147774|gb|EFW39276.1| DNA protecting protein DprA [Treponema phagedenis F0421] Length = 317 Score = 44.0 bits (103), Expect = 0.006, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%) Query: 1 [protein fragment, 34 aa] 34 +A G+D +YP N L +I + GG +SE P G Sbjct: 177 LACGVDRIYPRSNARLAAKIIETGGCILSEYPPG 210 >gi|292670827|ref|ZP_06604253.1| DNA protecting protein DprA [Selenomonas noxia ATCC 43541] gi|292647448|gb|EFF65420.1| DNA protecting protein DprA [Selenomonas noxia ATCC 43541] Length = 363 Score = 44.0 bits (103), Expect = 0.006, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 22/34 (64%) Query: 1 [protein fragment, 34 aa] 34 + G+D YPPENR LL +I ++GG +SE G Sbjct: 172 LGCGVDIAYPPENRRLLSQIVESGGAVLSEYAPG 205 >gi|256827137|ref|YP_003151096.1| DNA protecting protein DprA [Cryptobacterium curtum DSM 15641] gi|256583280|gb|ACU94414.1| DNA protecting protein DprA [Cryptobacterium curtum DSM 15641] Length = 328 Score = 44.0 bits (103), Expect = 0.006, Method: Composition-based stats. Identities = 14/30 (46%), Positives = 19/30 (63%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISE 30 + GG D YPP + L +EI +NGG +SE Sbjct: 124 LGGGCDQPYPPSHVPLFQEIINNGGAIVSE 153 >gi|254796757|ref|YP_003081593.1| DNA processing chain A [Neorickettsia risticii str. Illinois] gi|254590002|gb|ACT69364.1| DNA processing chain A [Neorickettsia risticii str. Illinois] Length = 375 Score = 44.0 bits (103), Expect = 0.007, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 22/31 (70%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D YP EN+ L E I + GG+ ++E+PFG Sbjct: 170 GIDQCYPTENQKLQERIIERGGLVVTEVPFG 200 >gi|114799220|ref|YP_760845.1| DNA protecting protein DprA [Hyphomonas neptunium ATCC 15444] gi|114739394|gb|ABI77519.1| DNA protecting protein DprA [Hyphomonas neptunium ATCC 15444] Length = 371 Score = 44.0 bits (103), Expect = 0.007, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + GG+D +YPP++ L E+ G+ +SE+PFG Sbjct: 172 LGGGIDHVYPPKHDRLYAEV-AQQGLIVSEMPFG 204 >gi|269798030|ref|YP_003311930.1| DNA protecting protein DprA [Veillonella parvula DSM 2008] gi|269094659|gb|ACZ24650.1| DNA protecting protein DprA [Veillonella parvula DSM 2008] Length = 408 Score = 44.0 bits (103), Expect = 0.007, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 19/34 (55%) Query: 1 [protein fragment, 34 aa] 34 M GLD YP EN L + + N G+ +SE P G Sbjct: 179 MGCGLDITYPRENAKLFDRMLQNNGLLLSEYPPG 212 >gi|167626698|ref|YP_001677198.1| DNA processing protein DprA [Francisella philomiragia subsp. philomiragia ATCC 25017] gi|167596699|gb|ABZ86697.1| DNA processing protein DprA [Francisella philomiragia subsp. philomiragia ATCC 25017] Length = 288 Score = 44.0 bits (103), Expect = 0.007, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 19/31 (61%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP NR L I N G+ ISE+P G Sbjct: 97 GVDIIYPSSNRELYSNIISNNGLIISELPLG 127 >gi|294793770|ref|ZP_06758907.1| DNA processing protein DprA [Veillonella sp. 3_1_44] gi|294455340|gb|EFG23712.1| DNA processing protein DprA [Veillonella sp. 3_1_44] Length = 408 Score = 44.0 bits (103), Expect = 0.008, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 19/34 (55%) Query: 1 [protein fragment, 34 aa] 34 M GLD YP EN L + + N G+ +SE P G Sbjct: 179 MGCGLDITYPRENAKLFDRMLQNNGLLLSEYPPG 212 >gi|75676200|ref|YP_318621.1| SMF protein [Nitrobacter winogradskyi Nb-255] gi|74421070|gb|ABA05269.1| SMF protein [Nitrobacter winogradskyi Nb-255] Length = 372 Score = 43.6 bits (102), Expect = 0.008, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 25/34 (73%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGG D +YP E+ +LL + ++GG AISE+P G Sbjct: 175 LAGGHDRIYPLEHEDLLAAVLESGG-AISEMPMG 207 >gi|329114375|ref|ZP_08243137.1| Protein Smf [Acetobacter pomorum DM001] gi|326696451|gb|EGE48130.1| Protein Smf [Acetobacter pomorum DM001] Length = 412 Score = 43.6 bits (102), Expect = 0.009, Method: Composition-based stats. Identities = 18/34 (52%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGGLDC YPPEN +L EI G ++E P G Sbjct: 164 IAGGLDCPYPPENASLQAEI-AQKGAVVTEAPLG 196 >gi|304436896|ref|ZP_07396860.1| DNA processing protein DprA [Selenomonas sp. oral taxon 149 str. 67H29BP] gi|304370095|gb|EFM23756.1| DNA processing protein DprA [Selenomonas sp. oral taxon 149 str. 67H29BP] Length = 363 Score = 43.6 bits (102), Expect = 0.009, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 19/34 (55%) Query: 1 [protein fragment, 34 aa] 34 + G+D YPPENR LL EI G +SE G Sbjct: 172 LGCGVDIAYPPENRRLLTEIVAADGAVLSEYAPG 205 >gi|258541853|ref|YP_003187286.1| DNA processing chain A SMF [Acetobacter pasteurianus IFO 3283-01] gi|256632931|dbj|BAH98906.1| DNA processing chain A SMF [Acetobacter pasteurianus IFO 3283-01] gi|256635988|dbj|BAI01957.1| DNA processing chain A SMF [Acetobacter pasteurianus IFO 3283-03] gi|256639043|dbj|BAI05005.1| DNA processing chain A SMF [Acetobacter pasteurianus IFO 3283-07] gi|256642097|dbj|BAI08052.1| DNA processing chain A SMF [Acetobacter pasteurianus IFO 3283-22] gi|256645152|dbj|BAI11100.1| DNA processing chain A SMF [Acetobacter pasteurianus IFO 3283-26] gi|256648207|dbj|BAI14148.1| DNA processing chain A SMF [Acetobacter pasteurianus IFO 3283-32] gi|256651260|dbj|BAI17194.1| DNA processing chain A SMF [Acetobacter pasteurianus IFO 3283-01-42C] gi|256654251|dbj|BAI20178.1| DNA processing chain A SMF [Acetobacter pasteurianus IFO 3283-12] Length = 208 Score = 43.6 bits (102), Expect = 0.009, Method: Composition-based stats. Identities = 18/34 (52%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGGLDC YPPEN +L EI G ++E P G Sbjct: 164 IAGGLDCPYPPENASLQAEI-AQKGAVVTEAPLG 196 >gi|190571736|ref|YP_001976094.1| DNA processing chain A [Wolbachia endosymbiont of Culex quinquefasciatus Pel] gi|213019224|ref|ZP_03335031.1| DNA processing chain A [Wolbachia endosymbiont of Culex quinquefasciatus JHB] gi|190358008|emb|CAQ55476.1| DNA processing chain A [Wolbachia endosymbiont of Culex quinquefasciatus Pel] gi|212995333|gb|EEB55974.1| DNA processing chain A [Wolbachia endosymbiont of Culex quinquefasciatus JHB] Length = 361 Score = 43.6 bits (102), Expect = 0.009, Method: Composition-based stats. Identities = 15/32 (46%), Positives = 25/32 (78%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 A G+D +YP EN +L ++I +NGG+ ++E+PF Sbjct: 163 ASGIDVVYPRENFDLYKKITENGGLVMTELPF 194 >gi|88606798|ref|YP_505506.1| putative DNA processing protein DprA [Anaplasma phagocytophilum HZ] gi|88597861|gb|ABD43331.1| putative DNA processing protein DprA [Anaplasma phagocytophilum HZ] Length = 344 Score = 43.6 bits (102), Expect = 0.009, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 22/33 (66%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +A G++ +YP EN L + I GG+ ISE+PF Sbjct: 143 IANGINVIYPRENAKLYKSIVREGGLLISELPF 175 >gi|296445900|ref|ZP_06887851.1| DNA protecting protein DprA [Methylosinus trichosporium OB3b] gi|296256568|gb|EFH03644.1| DNA protecting protein DprA [Methylosinus trichosporium OB3b] Length = 412 Score = 43.6 bits (102), Expect = 0.010, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 19/33 (57%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +AGG YP E+ L+ EI GG +SE+P Sbjct: 175 LAGGHARPYPSEHAPLIAEIAARGGAVLSEMPI 207 >gi|282850258|ref|ZP_06259637.1| DNA protecting protein DprA [Veillonella parvula ATCC 17745] gi|282579751|gb|EFB85155.1| DNA protecting protein DprA [Veillonella parvula ATCC 17745] Length = 408 Score = 43.6 bits (102), Expect = 0.010, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 19/34 (55%) Query: 1 [protein fragment, 34 aa] 34 M GLD YP EN L + + N G+ +SE P G Sbjct: 179 MGCGLDITYPRENAKLFDRMLQNNGLLLSEYPPG 212 >gi|225163857|ref|ZP_03726152.1| DNA protecting protein DprA [Opitutaceae bacterium TAV2] gi|224801538|gb|EEG19839.1| DNA protecting protein DprA [Opitutaceae bacterium TAV2] Length = 388 Score = 43.2 bits (101), Expect = 0.011, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 20/33 (60%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G+D +YPPEN +L I + GG SE PF Sbjct: 173 LGTGIDIIYPPENLDLYRRIENEGGAICSEFPF 205 >gi|317488107|ref|ZP_07946684.1| DNA protecting protein DprA [Eggerthella sp. 1_3_56FAA] gi|316912815|gb|EFV34347.1| DNA protecting protein DprA [Eggerthella sp. 1_3_56FAA] Length = 227 Score = 43.2 bits (101), Expect = 0.011, Method: Composition-based stats. Identities = 14/30 (46%), Positives = 18/30 (60%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISE 30 + GG D LYP E+ L + I D GG +SE Sbjct: 24 LGGGCDRLYPAEHEGLFQRIVDGGGAVVSE 53 >gi|299138372|ref|ZP_07031551.1| DNA protecting protein DprA [Acidobacterium sp. MP5ACTX8] gi|298599618|gb|EFI55777.1| DNA protecting protein DprA [Acidobacterium sp. MP5ACTX8] Length = 403 Score = 43.2 bits (101), Expect = 0.012, Method: Composition-based stats. Identities = 16/31 (51%), Positives = 20/31 (64%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP EN+ L E+I GG ISE P G Sbjct: 180 GIDVIYPKENKKLAEQIVQQGGALISEFPMG 210 >gi|164686892|ref|ZP_02210920.1| hypothetical protein CLOBAR_00488 [Clostridium bartlettii DSM 16795] gi|164604282|gb|EDQ97747.1| hypothetical protein CLOBAR_00488 [Clostridium bartlettii DSM 16795] Length = 329 Score = 43.2 bits (101), Expect = 0.013, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 19/33 (57%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 M GLD +YP N +L + I +N G ISE P Sbjct: 178 MPCGLDMVYPNNNCDLFKRIINNNGCVISEYPP 210 >gi|294055361|ref|YP_003549019.1| DNA protecting protein DprA [Coraliomargarita akajimensis DSM 45221] gi|293614694|gb|ADE54849.1| DNA protecting protein DprA [Coraliomargarita akajimensis DSM 45221] Length = 373 Score = 43.2 bits (101), Expect = 0.013, Method: Composition-based stats. Identities = 16/32 (50%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Query: 3 GGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YPPEN +L I G +SE PFG Sbjct: 178 CGLDIVYPPENLDLYRAIVA-KGAVVSEFPFG 208 >gi|182680321|ref|YP_001834467.1| DNA protecting protein DprA [Beijerinckia indica subsp. indica ATCC 9039] gi|182636204|gb|ACB96978.1| DNA protecting protein DprA [Beijerinckia indica subsp. indica ATCC 9039] Length = 429 Score = 43.2 bits (101), Expect = 0.013, Method: Composition-based stats. Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +AGGL +YP E+ LLE + G AISE+PF Sbjct: 177 LAGGLGRIYPAEHAPLLERLL-GEGAAISEMPF 208 >gi|296117478|ref|ZP_06836065.1| putative DNA processing chain A [Gluconacetobacter hansenii ATCC 23769] gi|295975999|gb|EFG82790.1| putative DNA processing chain A [Gluconacetobacter hansenii ATCC 23769] Length = 375 Score = 43.2 bits (101), Expect = 0.013, Method: Composition-based stats. Identities = 18/34 (52%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGGLDC YPPE+ L +EI G I+E P G Sbjct: 164 IAGGLDCPYPPEHGRLHDEI-AQQGALITEAPPG 196 >gi|90417726|ref|ZP_01225638.1| DNA processing protein DprA, putative [Aurantimonas manganoxydans SI85-9A1] gi|90337398|gb|EAS51049.1| DNA processing protein DprA, putative [Aurantimonas manganoxydans SI85-9A1] Length = 376 Score = 43.2 bits (101), Expect = 0.013, Method: Composition-based stats. Identities = 19/33 (57%), Positives = 21/33 (63%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGGLD YP ENR L+ I D GG +SE FG Sbjct: 177 AGGLDRPYPDENRPLMRRIVDEGGCLLSERAFG 209 >gi|269795658|ref|YP_003315113.1| DNA protecting protein DprA [Sanguibacter keddieii DSM 10542] gi|269097843|gb|ACZ22279.1| DNA protecting protein DprA [Sanguibacter keddieii DSM 10542] Length = 399 Score = 42.8 bits (100), Expect = 0.014, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 22/34 (64%) Query: 1 [protein fragment, 34 aa] 34 +AGG D LYP N +LL + D G+ +SE+P G Sbjct: 192 LAGGPDRLYPAGNADLLRGVLDGAGLVLSELPPG 225 >gi|88608661|ref|YP_506277.1| putative DNA processing protein DprA [Neorickettsia sennetsu str. Miyayama] gi|88600830|gb|ABD46298.1| putative DNA processing protein DprA [Neorickettsia sennetsu str. Miyayama] Length = 378 Score = 42.8 bits (100), Expect = 0.014, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 22/31 (70%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D YP EN+ L E I + GG+ ++E+PFG Sbjct: 170 GIDQCYPIENQRLQERIIERGGLVVTEVPFG 200 >gi|126729116|ref|ZP_01744930.1| DNA processing protein DprA, putative [Sagittula stellata E-37] gi|126710106|gb|EBA09158.1| DNA processing protein DprA, putative [Sagittula stellata E-37] Length = 372 Score = 42.8 bits (100), Expect = 0.014, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 21/34 (61%) Query: 1 [protein fragment, 34 aa] 34 +AGG+D LYP EN L ++I G ISE P G Sbjct: 159 LAGGVDVLYPAENAGLADDIVTCHGARISEQPMG 192 >gi|188996508|ref|YP_001930759.1| DNA protecting protein DprA [Sulfurihydrogenibium sp. YO3AOP1] gi|188931575|gb|ACD66205.1| DNA protecting protein DprA [Sulfurihydrogenibium sp. YO3AOP1] Length = 356 Score = 42.8 bits (100), Expect = 0.015, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YP EN+ L EEI G ISE PFG Sbjct: 171 LGNGIDIVYPYENKKLYEEI-SEKGCIISEFPFG 203 >gi|237755691|ref|ZP_04584300.1| DNA protecting protein DprA [Sulfurihydrogenibium yellowstonense SS-5] gi|237692141|gb|EEP61140.1| DNA protecting protein DprA [Sulfurihydrogenibium yellowstonense SS-5] Length = 356 Score = 42.8 bits (100), Expect = 0.015, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YP EN+ L EEI G ISE PFG Sbjct: 171 LGNGIDIVYPYENKKLYEEI-SEKGCIISEFPFG 203 >gi|332981422|ref|YP_004462863.1| DNA protecting protein DprA [Mahella australiensis 50-1 BON] gi|332699100|gb|AEE96041.1| DNA protecting protein DprA [Mahella australiensis 50-1 BON] Length = 366 Score = 42.8 bits (100), Expect = 0.016, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YPPE++ L +I + G ISE P G Sbjct: 175 LGCGVDMIYPPEHKPLYYDIISH-GAVISEFPPG 207 >gi|85859218|ref|YP_461420.1| SMF family protein involved in DNA uptake [Syntrophus aciditrophicus SB] gi|85722309|gb|ABC77252.1| SMF family protein involved in DNA uptake [Syntrophus aciditrophicus SB] Length = 394 Score = 42.8 bits (100), Expect = 0.016, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + GLD +YPPEN+NL E+I G ISE+ G Sbjct: 173 LGCGLDIVYPPENKNLYEKI-AADGAVISELALG 205 >gi|85716403|ref|ZP_01047375.1| SMF protein [Nitrobacter sp. Nb-311A] gi|85696760|gb|EAQ34646.1| SMF protein [Nitrobacter sp. Nb-311A] Length = 372 Score = 42.8 bits (100), Expect = 0.016, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 25/34 (73%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGG D +YP E+ +LL + ++GG AISE+P G Sbjct: 175 LAGGHDRIYPLEHEDLLAAVLEDGG-AISEMPMG 207 >gi|189183183|ref|YP_001936968.1| DNA processing protein Smf [Orientia tsutsugamushi str. Ikeda] gi|189179954|dbj|BAG39734.1| DNA processing protein Smf [Orientia tsutsugamushi str. Ikeda] Length = 386 Score = 42.8 bits (100), Expect = 0.017, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 23/33 (69%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +AGG+D +YP EN NL +I N G+ ++E+P Sbjct: 177 IAGGVDHIYPQENINLYHKI-ANEGLILAELPI 208 >gi|208780407|ref|ZP_03247748.1| DNA protecting protein DprA, putative [Francisella novicida FTG] gi|208743775|gb|EDZ90078.1| DNA protecting protein DprA, putative [Francisella novicida FTG] Length = 368 Score = 42.8 bits (100), Expect = 0.018, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 20/31 (64%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP NR L +I + G+ ISE+P G Sbjct: 177 GVDVVYPSSNRELYNKIINTNGLIISELPLG 207 >gi|150005910|ref|YP_001300654.1| putative DNA processing enzyme DprA [Bacteroides vulgatus ATCC 8482] gi|149934334|gb|ABR41032.1| putative DNA processing enzyme DprA [Bacteroides vulgatus ATCC 8482] Length = 326 Score = 42.8 bits (100), Expect = 0.018, Method: Composition-based stats. Identities = 18/36 (50%), Positives = 24/36 (66%), Gaps = 2/36 (5%) Query: 1 MAGGLD--CLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD +YP EN +L +EI NGG+ +SE P G Sbjct: 180 LANGLDWASIYPKENLSLAKEIVSNGGLLLSEYPVG 215 >gi|167630278|ref|YP_001680777.1| DNA processing protein dpra, putative [Heliobacterium modesticaldum Ice1] gi|167593018|gb|ABZ84766.1| DNA processing protein dpra, putative [Heliobacterium modesticaldum Ice1] Length = 378 Score = 42.8 bits (100), Expect = 0.018, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGG+D +YPPE+ L I + G +SE P G Sbjct: 179 LAGGVDVIYPPEHGKLASRIVEQ-GALVSEYPPG 211 >gi|257063753|ref|YP_003143425.1| DNA protecting protein DprA [Slackia heliotrinireducens DSM 20476] gi|256791406|gb|ACV22076.1| DNA protecting protein DprA [Slackia heliotrinireducens DSM 20476] Length = 319 Score = 42.5 bits (99), Expect = 0.018, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 20/32 (62%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIP 32 + GG D YP EN +L +++ D GG +SE P Sbjct: 109 LGGGCDMPYPVENFDLFQQVVDAGGAVVSEHP 140 >gi|170746908|ref|YP_001753168.1| DNA protecting protein DprA [Methylobacterium radiotolerans JCM 2831] gi|170653430|gb|ACB22485.1| DNA protecting protein DprA [Methylobacterium radiotolerans JCM 2831] Length = 403 Score = 42.5 bits (99), Expect = 0.018, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 21/34 (61%) Query: 1 [protein fragment, 34 aa] 34 MAGG D +YP + L+E I GG ++E+P G Sbjct: 165 MAGGQDRIYPASHAALVEAILAEGGAVLAEMPMG 198 >gi|148284625|ref|YP_001248715.1| DNA processing protein [Orientia tsutsugamushi str. Boryong] gi|146740064|emb|CAM80189.1| DNA processing protein [Orientia tsutsugamushi str. Boryong] Length = 386 Score = 42.5 bits (99), Expect = 0.019, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 23/33 (69%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +AGG+D +YP EN NL +I N G+ ++E+P Sbjct: 177 IAGGVDHIYPQENINLYHKI-ANEGLILAELPI 208 >gi|197303737|ref|ZP_03168774.1| hypothetical protein RUMLAC_02466 [Ruminococcus lactaris ATCC 29176] gi|197297257|gb|EDY31820.1| hypothetical protein RUMLAC_02466 [Ruminococcus lactaris ATCC 29176] Length = 366 Score = 42.5 bits (99), Expect = 0.021, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 19/34 (55%) Query: 1 [protein fragment, 34 aa] 34 + G+D YP E+ L +I + GG +SE P G Sbjct: 172 LGCGVDICYPREHIGLYMDILEQGGGILSEFPPG 205 >gi|254294345|ref|YP_003060368.1| DNA protecting protein DprA [Hirschia baltica ATCC 49814] gi|254042876|gb|ACT59671.1| DNA protecting protein DprA [Hirschia baltica ATCC 49814] Length = 373 Score = 42.5 bits (99), Expect = 0.021, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGG+D +YPPE+ L + I + G +SE P G Sbjct: 175 LAGGVDAIYPPEHAKLYDAILER-GAIVSESPLG 207 >gi|114327469|ref|YP_744626.1| DNA processing protein [Granulibacter bethesdensis CGDNIH1] gi|114315643|gb|ABI61703.1| DNA processing protein [Granulibacter bethesdensis CGDNIH1] Length = 378 Score = 42.5 bits (99), Expect = 0.022, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGGLDC YP EN L + + G ISE+P G Sbjct: 163 VAGGLDCPYPRENIRL-QSVIAKRGAVISELPLG 195 >gi|225874954|ref|YP_002756413.1| DNA protecting protein DprA [Acidobacterium capsulatum ATCC 51196] gi|225792046|gb|ACO32136.1| DNA protecting protein DprA [Acidobacterium capsulatum ATCC 51196] Length = 401 Score = 42.5 bits (99), Expect = 0.022, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 21/31 (67%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP EN+ L E+I GG +SE+P G Sbjct: 192 GVDVIYPKENKALAEQIVATGGAIVSELPLG 222 >gi|296129327|ref|YP_003636577.1| DNA protecting protein DprA [Cellulomonas flavigena DSM 20109] gi|296021142|gb|ADG74378.1| DNA protecting protein DprA [Cellulomonas flavigena DSM 20109] Length = 402 Score = 42.5 bits (99), Expect = 0.023, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 21/34 (61%) Query: 1 [protein fragment, 34 aa] 34 +AGG+D YP N LLEE+ GG SE+P G Sbjct: 203 LAGGVDRAYPAGNARLLEEVVRAGGSLFSEVPPG 236 >gi|257791160|ref|YP_003181766.1| DNA protecting protein DprA [Eggerthella lenta DSM 2243] gi|325832903|ref|ZP_08165576.1| DNA protecting protein DprA [Eggerthella sp. HGA1] gi|257475057|gb|ACV55377.1| DNA protecting protein DprA [Eggerthella lenta DSM 2243] gi|325485768|gb|EGC88232.1| DNA protecting protein DprA [Eggerthella sp. HGA1] Length = 305 Score = 42.5 bits (99), Expect = 0.023, Method: Composition-based stats. Identities = 14/30 (46%), Positives = 18/30 (60%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISE 30 + GG D LYP E+ L + I D GG +SE Sbjct: 102 LGGGCDRLYPAEHEGLFQRIVDEGGAVVSE 131 >gi|240145514|ref|ZP_04744115.1| DNA processing protein DprA [Roseburia intestinalis L1-82] gi|257202330|gb|EEV00615.1| DNA processing protein DprA [Roseburia intestinalis L1-82] Length = 361 Score = 42.1 bits (98), Expect = 0.023, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 18/34 (52%) Query: 1 [protein fragment, 34 aa] 34 + G+D YP N + +EI + G ISE P G Sbjct: 170 LGCGVDICYPKSNSRIYQEILEKNGAIISEYPPG 203 >gi|328675504|gb|AEB28179.1| Rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Francisella cf. novicida 3523] Length = 368 Score = 42.1 bits (98), Expect = 0.024, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 19/31 (61%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP N+ L +I + G+ +SE P G Sbjct: 177 GIDVVYPSSNKELYNKIINTNGLIVSEFPLG 207 >gi|167009201|ref|ZP_02274132.1| DNA processing protein DprA [Francisella tularensis subsp. holarctica FSC200] gi|254367122|ref|ZP_04983155.1| DNA uptake protein, SMF family [Francisella tularensis subsp. holarctica 257] gi|134252945|gb|EBA52039.1| DNA uptake protein, SMF family [Francisella tularensis subsp. holarctica 257] Length = 245 Score = 42.1 bits (98), Expect = 0.024, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 19/31 (61%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP NR L +I + G+ ISE P G Sbjct: 77 GVDVVYPSSNRELYNKIINTNGLIISEFPLG 107 >gi|308176205|ref|YP_003915611.1| smf family protein [Arthrobacter arilaitensis Re117] gi|307743668|emb|CBT74640.1| putative smf family protein [Arthrobacter arilaitensis Re117] Length = 333 Score = 42.1 bits (98), Expect = 0.025, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGG+D YP + LL I D G+ +SE+P G Sbjct: 186 LAGGVDRPYPAGHSELLGRIADT-GLVVSEMPPG 218 >gi|254372325|ref|ZP_04987816.1| DNA uptake protein [Francisella tularensis subsp. novicida GA99-3549] gi|151570054|gb|EDN35708.1| DNA uptake protein [Francisella novicida GA99-3549] Length = 368 Score = 42.1 bits (98), Expect = 0.025, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 19/31 (61%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP NR L +I + G+ ISE P G Sbjct: 177 GVDVVYPSSNRELYNKIINTNGLIISEFPLG 207 >gi|328676429|gb|AEB27299.1| Rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Francisella cf. novicida Fx1] Length = 368 Score = 42.1 bits (98), Expect = 0.026, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 19/31 (61%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP NR L +I + G+ ISE P G Sbjct: 177 GVDVVYPSSNRELYNKIINTNGLIISEFPLG 207 >gi|134302268|ref|YP_001122237.1| DNA processing protein DprA [Francisella tularensis subsp. tularensis WY96-3418] gi|134050045|gb|ABO47116.1| DNA processing protein DprA [Francisella tularensis subsp. tularensis WY96-3418] Length = 368 Score = 42.1 bits (98), Expect = 0.026, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 19/31 (61%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP NR L +I + G+ ISE P G Sbjct: 177 GVDVVYPSSNRELYNKIINTNGLIISEFPLG 207 >gi|118496955|ref|YP_898005.1| SMF family DNA uptake protein [Francisella tularensis subsp. novicida U112] gi|194324184|ref|ZP_03057958.1| DNA protecting protein DprA, putative [Francisella tularensis subsp. novicida FTE] gi|118422861|gb|ABK89251.1| DNA uptake protein, SMF family [Francisella novicida U112] gi|194321631|gb|EDX19115.1| DNA protecting protein DprA, putative [Francisella tularensis subsp. novicida FTE] Length = 368 Score = 42.1 bits (98), Expect = 0.027, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 19/31 (61%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP NR L +I + G+ ISE P G Sbjct: 177 GVDVVYPSSNRELYNKIINTNGLIISEFPLG 207 >gi|291533226|emb|CBL06339.1| DNA protecting protein DprA [Megamonas hypermegale ART12/1] Length = 368 Score = 42.1 bits (98), Expect = 0.028, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GLD +YP EN+ LLE I G ISE P Sbjct: 169 LGCGLDIIYPKENKQLLEAI-AQNGAVISEYPL 200 >gi|325294278|ref|YP_004280792.1| DNA protecting protein DprA [Desulfurobacterium thermolithotrophum DSM 11699] gi|325064726|gb|ADY72733.1| DNA protecting protein DprA [Desulfurobacterium thermolithotrophum DSM 11699] Length = 337 Score = 42.1 bits (98), Expect = 0.029, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 20/34 (58%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YP N +L E I D GG ISE P G Sbjct: 154 LGSGVDSIYPRGNFSLAERIVDTGGAIISEFPLG 187 >gi|298372209|ref|ZP_06982199.1| DNA processing protein DprA [Bacteroidetes oral taxon 274 str. F0058] gi|298275113|gb|EFI16664.1| DNA processing protein DprA [Bacteroidetes oral taxon 274 str. F0058] Length = 363 Score = 42.1 bits (98), Expect = 0.030, Method: Composition-based stats. Identities = 13/32 (40%), Positives = 19/32 (59%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIP 32 +A GLD +YP +++ L I GG I+E P Sbjct: 173 VAHGLDRVYPAQHKGLAASIVQQGGAIITEYP 204 >gi|253700153|ref|YP_003021342.1| DNA protecting protein DprA [Geobacter sp. M21] gi|251775003|gb|ACT17584.1| DNA protecting protein DprA [Geobacter sp. M21] Length = 359 Score = 41.7 bits (97), Expect = 0.031, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YPPEN L + + DN G ISE P G Sbjct: 170 LGCGIDLVYPPENGALYQALADN-GALISEFPMG 202 >gi|260752380|ref|YP_003225273.1| DNA protecting protein DprA [Zymomonas mobilis subsp. mobilis NCIMB 11163] gi|258551743|gb|ACV74689.1| DNA protecting protein DprA [Zymomonas mobilis subsp. mobilis NCIMB 11163] Length = 385 Score = 41.7 bits (97), Expect = 0.031, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +AGGLD YPPEN+ L + I G+ +SE+P Sbjct: 173 IAGGLDSFYPPENKELQQAI-SEKGLVVSEMPP 204 >gi|254373799|ref|ZP_04989282.1| DNA processing protein DprA [Francisella novicida GA99-3548] gi|151571520|gb|EDN37174.1| DNA processing protein DprA [Francisella novicida GA99-3548] Length = 368 Score = 41.7 bits (97), Expect = 0.031, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 19/31 (61%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP NR L +I + G+ ISE P G Sbjct: 177 GVDVVYPSSNRELYNKIINTNGLIISEFPLG 207 >gi|110832994|ref|YP_691853.1| peptide deformylase, DNA processing protein [Alcanivorax borkumensis SK2] gi|110646105|emb|CAL15581.1| peptide deformylase, DNA processing protein [Alcanivorax borkumensis SK2] Length = 353 Score = 41.7 bits (97), Expect = 0.031, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 20/34 (58%) Query: 1 [protein fragment, 34 aa] 34 M G D +YPP N +L EEI D GG +SE G Sbjct: 165 MGNGPDRIYPPRNGSLAEEIVDTGGALVSEFAPG 198 >gi|154247839|ref|YP_001418797.1| DNA protecting protein DprA [Xanthobacter autotrophicus Py2] gi|154161924|gb|ABS69140.1| DNA protecting protein DprA [Xanthobacter autotrophicus Py2] Length = 378 Score = 41.7 bits (97), Expect = 0.031, Method: Composition-based stats. Identities = 15/32 (46%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 AGGL YPPEN L+E++ G +SE+P Sbjct: 183 AGGLARPYPPENLGLIEKV-AATGAIVSEMPL 213 >gi|255659254|ref|ZP_05404663.1| DNA processing protein DprA [Mitsuokella multacida DSM 20544] gi|260848709|gb|EEX68716.1| DNA processing protein DprA [Mitsuokella multacida DSM 20544] Length = 365 Score = 41.7 bits (97), Expect = 0.032, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 21/34 (61%) Query: 1 [protein fragment, 34 aa] 34 + G+D YP ENR LL EI ++GG ISE G Sbjct: 174 LGCGIDVAYPAENRRLLMEIAESGGAVISEYGPG 207 >gi|90019672|ref|YP_525499.1| filamentous hemagglutinin-like protein [Saccharophagus degradans 2-40] gi|89949272|gb|ABD79287.1| DNA processing protein DprA, putative [Saccharophagus degradans 2-40] Length = 399 Score = 41.7 bits (97), Expect = 0.032, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 18/31 (58%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP N L EI NGG +SE P G Sbjct: 200 GIDSVYPQRNSALASEIIANGGAIVSEFPLG 230 >gi|241762041|ref|ZP_04760125.1| DNA protecting protein DprA [Zymomonas mobilis subsp. mobilis ATCC 10988] gi|241373507|gb|EER63094.1| DNA protecting protein DprA [Zymomonas mobilis subsp. mobilis ATCC 10988] Length = 385 Score = 41.7 bits (97), Expect = 0.033, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +AGGLD YPPEN+ L + I G+ +SE+P Sbjct: 173 IAGGLDSFYPPENKELQQAI-SEKGLVVSEMPP 204 >gi|290954217|ref|ZP_06558838.1| DNA processing protein DprA [Francisella tularensis subsp. holarctica URFT1] gi|295312381|ref|ZP_06803163.1| DNA processing protein DprA [Francisella tularensis subsp. holarctica URFT1] Length = 268 Score = 41.7 bits (97), Expect = 0.034, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 19/31 (61%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP NR L +I + G+ ISE P G Sbjct: 77 GVDVVYPSSNRELYNKIINTNGLIISEFPLG 107 >gi|56552090|ref|YP_162929.1| DNA protecting protein DprA [Zymomonas mobilis subsp. mobilis ZM4] gi|56543664|gb|AAV89818.1| DNA protecting protein DprA [Zymomonas mobilis subsp. mobilis ZM4] Length = 385 Score = 41.7 bits (97), Expect = 0.034, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +AGGLD YPPEN+ L + I G+ +SE+P Sbjct: 173 IAGGLDSFYPPENKELQQAI-SEKGLVVSEMPP 204 >gi|254370428|ref|ZP_04986433.1| predicted protein [Francisella tularensis subsp. tularensis FSC033] gi|151568671|gb|EDN34325.1| predicted protein [Francisella tularensis subsp. tularensis FSC033] Length = 228 Score = 41.7 bits (97), Expect = 0.034, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 19/31 (61%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP NR L +I + G+ ISE P G Sbjct: 177 GVDVVYPSSNRELYNKIINTNGLIISEFPLG 207 >gi|118578968|ref|YP_900218.1| DNA protecting protein DprA [Pelobacter propionicus DSM 2379] gi|118501678|gb|ABK98160.1| DNA protecting protein DprA [Pelobacter propionicus DSM 2379] Length = 371 Score = 41.7 bits (97), Expect = 0.034, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YPPENR+L +E+ G +SE P G Sbjct: 177 LGCGIDRIYPPENRDLFDEM-AERGCLVSEFPLG 209 >gi|332637402|ref|ZP_08416265.1| putative DNA processing enzyme DprA [Weissella cibaria KACC 11862] Length = 341 Score = 41.7 bits (97), Expect = 0.035, Method: Composition-based stats. Identities = 17/35 (48%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Query: 1 MAGGLDCL-YPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD YP +NR L E+I GG +SE P G Sbjct: 180 LAAGLDEPVYPAKNRELAEKILTEGGALVSEYPAG 214 >gi|325297496|ref|YP_004257413.1| SMF family protein [Bacteroides salanitronis DSM 18170] gi|324317049|gb|ADY34940.1| SMF family protein [Bacteroides salanitronis DSM 18170] Length = 343 Score = 41.7 bits (97), Expect = 0.035, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 21/34 (61%) Query: 1 [protein fragment, 34 aa] 34 +A GLD +P N+ L EEI GG +SE PFG Sbjct: 199 VASGLDITHPKVNKTLQEEIVAKGGTIVSEHPFG 232 >gi|4511994|gb|AAD21554.1| DNA processing chain A [Zymomonas mobilis subsp. mobilis ZM4] Length = 385 Score = 41.7 bits (97), Expect = 0.036, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +AGGLD YPPEN+ L + I G+ +SE+P Sbjct: 173 IAGGLDSFYPPENKELQQAI-SEKGLVVSEMPP 204 >gi|238926948|ref|ZP_04658708.1| SMF family DNA processing protein [Selenomonas flueggei ATCC 43531] gi|238885182|gb|EEQ48820.1| SMF family DNA processing protein [Selenomonas flueggei ATCC 43531] Length = 369 Score = 41.7 bits (97), Expect = 0.037, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 20/34 (58%) Query: 1 [protein fragment, 34 aa] 34 + G+D YP ENR LL EI +GG +SE G Sbjct: 178 LGCGVDVAYPSENRRLLAEICTSGGAVLSEYAPG 211 >gi|149925346|ref|ZP_01913610.1| SMF protein [Limnobacter sp. MED105] gi|149825463|gb|EDM84671.1| SMF protein [Limnobacter sp. MED105] Length = 362 Score = 41.7 bits (97), Expect = 0.038, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 19/34 (55%) Query: 1 [protein fragment, 34 aa] 34 + G D +YPP + L +I GG+ +SE P G Sbjct: 152 LGCGPDEIYPPHHAGLKAQIVGQGGLVLSEYPPG 185 >gi|294678614|ref|YP_003579229.1| DNA protecting protein DprA [Rhodobacter capsulatus SB 1003] gi|294477434|gb|ADE86822.1| DNA protecting protein DprA [Rhodobacter capsulatus SB 1003] Length = 383 Score = 41.7 bits (97), Expect = 0.038, Method: Composition-based stats. Identities = 19/34 (55%), Positives = 25/34 (73%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 MAGGLD +YPPENR+L I GG+ ++E+P G Sbjct: 180 MAGGLDVIYPPENRDLASRIAT-GGLLLAELPPG 212 >gi|56416598|ref|YP_153672.1| DNA processing protein, chain A [Anaplasma marginale str. St. Maries] gi|222474964|ref|YP_002563379.1| DNA processing protein, chain A dprA (smf) [Anaplasma marginale str. Florida] gi|56387830|gb|AAV86417.1| DNA processing protein, chain A [Anaplasma marginale str. St. Maries] gi|222419100|gb|ACM49123.1| DNA processing protein, chain A dprA (smf) [Anaplasma marginale str. Florida] Length = 377 Score = 41.7 bits (97), Expect = 0.038, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 22/32 (68%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 A G+D +YP +N +L I NGG+ ++E+PF Sbjct: 176 ASGIDVVYPKDNLHLYRAIVHNGGVVVTELPF 207 >gi|325262840|ref|ZP_08129576.1| DNA processing protein DprA [Clostridium sp. D5] gi|324031934|gb|EGB93213.1| DNA processing protein DprA [Clostridium sp. D5] Length = 360 Score = 41.7 bits (97), Expect = 0.040, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 20/34 (58%) Query: 1 [protein fragment, 34 aa] 34 + G++ YP E+ L +I +NGG +SE P G Sbjct: 169 LGCGVNICYPREHIGLYADILENGGGILSEFPPG 202 >gi|157413603|ref|YP_001484469.1| DNA uptake Rossmann fold nucleotide-binding protein [Prochlorococcus marinus str. MIT 9215] gi|157388178|gb|ABV50883.1| Predicted Rossmann fold nucleotide-binding protein involved in DNA uptake [Prochlorococcus marinus str. MIT 9215] Length = 311 Score = 41.7 bits (97), Expect = 0.040, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 20/34 (58%) Query: 1 [protein fragment, 34 aa] 34 + GLD +YP EN NL EI D GG +SE G Sbjct: 169 LPNGLDEIYPKENANLASEIIDYGGCLVSEYLIG 202 >gi|269958987|ref|YP_003328776.1| putativeDNA recombination-mediator protein A [Anaplasma centrale str. Israel] gi|269848818|gb|ACZ49462.1| putativeDNA recombination-mediator protein A [Anaplasma centrale str. Israel] Length = 378 Score = 41.3 bits (96), Expect = 0.040, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 22/32 (68%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 A G+D +YP +N +L I NGG+ ++E+PF Sbjct: 176 ANGIDVVYPKDNLHLYRAIVHNGGVVVTELPF 207 >gi|169824494|ref|YP_001692105.1| putative Smf protein DNA processing subunit A [Finegoldia magna ATCC 29328] gi|303233675|ref|ZP_07320329.1| DNA protecting protein DprA [Finegoldia magna BVS033A4] gi|167831299|dbj|BAG08215.1| putative Smf protein DNA processing subunit A [Finegoldia magna ATCC 29328] gi|302495109|gb|EFL54861.1| DNA protecting protein DprA [Finegoldia magna BVS033A4] Length = 356 Score = 41.3 bits (96), Expect = 0.040, Method: Composition-based stats. Identities = 13/35 (37%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Query: 1 MAGGLDCLYPPENRNLLEE-IWDNGGIAISEIPFG 34 + G+D +YP N + +E I + G+ +SE PFG Sbjct: 167 LGCGIDQVYPQSNYRVFQEMISSHNGVIMSEYPFG 201 >gi|302380488|ref|ZP_07268953.1| DNA protecting protein DprA [Finegoldia magna ACS-171-V-Col3] gi|302311431|gb|EFK93447.1| DNA protecting protein DprA [Finegoldia magna ACS-171-V-Col3] Length = 290 Score = 41.3 bits (96), Expect = 0.043, Method: Composition-based stats. Identities = 13/35 (37%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Query: 1 MAGGLDCLYPPENRNLLEE-IWDNGGIAISEIPFG 34 + G+D +YP N + +E I + G+ +SE PFG Sbjct: 101 LGCGIDQVYPQSNYRVFQEMISSHNGVIMSEYPFG 135 >gi|332653525|ref|ZP_08419270.1| DNA processing protein DprA [Ruminococcaceae bacterium D16] gi|332518671|gb|EGJ48274.1| DNA processing protein DprA [Ruminococcaceae bacterium D16] Length = 410 Score = 41.3 bits (96), Expect = 0.043, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGG+D YP ENR L +++ G ISE P G Sbjct: 172 LAGGVDVPYPKENRFLYQDV-AAVGALISEYPPG 204 >gi|169830783|ref|YP_001716765.1| DNA protecting protein DprA [Candidatus Desulforudis audaxviator MP104C] gi|169637627|gb|ACA59133.1| DNA protecting protein DprA [Candidatus Desulforudis audaxviator MP104C] Length = 394 Score = 41.3 bits (96), Expect = 0.043, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 23/34 (67%) Query: 1 [protein fragment, 34 aa] 34 + GLD +YP EN L+E+I +GG+ ++E P G Sbjct: 195 LGSGLDVVYPRENAGLMEKIAASGGLVLTEFPLG 228 >gi|19553232|ref|NP_601234.1| Rossmann-fold nucleotide-binding protein [Corynebacterium glutamicum ATCC 13032] gi|62390868|ref|YP_226270.1| DNA uptake Rossmann fold nucleotide-binding protein [Corynebacterium glutamicum ATCC 13032] gi|21324799|dbj|BAB99422.1| Predicted Rossmann-fold nucleotide-binding protein involved in DNA uptake [Corynebacterium glutamicum ATCC 13032] gi|41326207|emb|CAF20369.1| Predicted Rossmann fold nucleotide-binding protein involved in DNA uptake [Corynebacterium glutamicum ATCC 13032] Length = 394 Score = 41.3 bits (96), Expect = 0.044, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 2 AGGLDCLYPPENRNLLEEIW-DNGGIAISEIPFG 34 A GLD YP NR+L +I G +SE P G Sbjct: 192 ACGLDRSYPSHNRDLFNQIAKSGKGALVSEYPPG 225 >gi|145295932|ref|YP_001138753.1| hypothetical protein cgR_1857 [Corynebacterium glutamicum R] gi|140845852|dbj|BAF54851.1| hypothetical protein [Corynebacterium glutamicum R] Length = 394 Score = 41.3 bits (96), Expect = 0.044, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 2 AGGLDCLYPPENRNLLEEIW-DNGGIAISEIPFG 34 A GLD YP NR+L +I G +SE P G Sbjct: 192 ACGLDRSYPSHNRDLFNQIAKSGKGALVSEYPPG 225 >gi|255002940|ref|ZP_05277904.1| DNA processing protein, chain A dprA (smf) [Anaplasma marginale str. Puerto Rico] gi|255004065|ref|ZP_05278866.1| DNA processing protein, chain A dprA (smf) [Anaplasma marginale str. Virginia] Length = 354 Score = 41.3 bits (96), Expect = 0.045, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 22/32 (68%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 A G+D +YP +N +L I NGG+ ++E+PF Sbjct: 153 ASGIDVVYPKDNLHLYRAIVHNGGVVVTELPF 184 >gi|298291505|ref|YP_003693444.1| DNA protecting protein DprA [Starkeya novella DSM 506] gi|296928016|gb|ADH88825.1| DNA protecting protein DprA [Starkeya novella DSM 506] Length = 369 Score = 41.3 bits (96), Expect = 0.047, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGG D YP EN L+E I G +SE+P G Sbjct: 173 IAGGHDRPYPRENEKLMEAI-AAEGAILSEMPMG 205 >gi|255689876|ref|ZP_05413551.1| putative DNA processing protein DprA [Bacteroides finegoldii DSM 17565] gi|260624481|gb|EEX47352.1| putative DNA processing protein DprA [Bacteroides finegoldii DSM 17565] Length = 309 Score = 41.3 bits (96), Expect = 0.050, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 22/34 (64%) Query: 1 [protein fragment, 34 aa] 34 +A GLD +P N++L +EI GG +SE PFG Sbjct: 178 VASGLDITHPKVNKSLQDEIIAKGGTILSEHPFG 211 >gi|328954307|ref|YP_004371641.1| DNA protecting protein DprA [Desulfobacca acetoxidans DSM 11109] gi|328454631|gb|AEB10460.1| DNA protecting protein DprA [Desulfobacca acetoxidans DSM 11109] Length = 366 Score = 41.3 bits (96), Expect = 0.051, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + GLD +YP EN+ L ++I G +SE P G Sbjct: 175 LGCGLDVIYPQENKALYQQI-SENGALVSEFPLG 207 >gi|71277761|ref|YP_266804.1| putative DNA processing protein DprA [Colwellia psychrerythraea 34H] gi|71143501|gb|AAZ23974.1| putative DNA processing protein DprA [Colwellia psychrerythraea 34H] Length = 383 Score = 41.3 bits (96), Expect = 0.052, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 21/34 (61%) Query: 1 [protein fragment, 34 aa] 34 +A GLD +YP + +L ++I D+ G ISE G Sbjct: 177 VATGLDQVYPARHHSLAQKIIDSSGAIISEFVPG 210 >gi|333030447|ref|ZP_08458508.1| SMF family protein [Bacteroides coprosuis DSM 18011] gi|332741044|gb|EGJ71526.1| SMF family protein [Bacteroides coprosuis DSM 18011] Length = 310 Score = 40.9 bits (95), Expect = 0.053, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 23/34 (67%) Query: 1 [protein fragment, 34 aa] 34 +A GL+ +YP +N +L + I +GG+ +SE P G Sbjct: 186 LAHGLEKVYPYKNSSLADRILASGGVVLSEYPIG 219 >gi|330994161|ref|ZP_08318089.1| Protein smf [Gluconacetobacter sp. SXCC-1] gi|329758628|gb|EGG75144.1| Protein smf [Gluconacetobacter sp. SXCC-1] Length = 390 Score = 40.9 bits (95), Expect = 0.055, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGGLDC YPPE+ +L I G ++E P G Sbjct: 168 IAGGLDCPYPPEHADLQARI-AGTGAVVTEAPLG 200 >gi|312115161|ref|YP_004012757.1| DNA protecting protein DprA [Rhodomicrobium vannielii ATCC 17100] gi|311220290|gb|ADP71658.1| DNA protecting protein DprA [Rhodomicrobium vannielii ATCC 17100] Length = 487 Score = 40.9 bits (95), Expect = 0.055, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + GGLD +YPPE+ L +I G+ I E P G Sbjct: 269 LPGGLDRIYPPEHLGLAADI-AQNGLLIGECPPG 301 >gi|154253273|ref|YP_001414097.1| DNA protecting protein DprA [Parvibaculum lavamentivorans DS-1] gi|154157223|gb|ABS64440.1| DNA protecting protein DprA [Parvibaculum lavamentivorans DS-1] Length = 372 Score = 40.9 bits (95), Expect = 0.056, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD +YP ENR L I G +SE+P G Sbjct: 170 LAGGLDIVYPEENRELQTAIASQ-GALVSEMPPG 202 >gi|323140523|ref|ZP_08075450.1| DNA protecting protein DprA [Phascolarctobacterium sp. YIT 12067] gi|322414975|gb|EFY05767.1| DNA protecting protein DprA [Phascolarctobacterium sp. YIT 12067] Length = 385 Score = 40.9 bits (95), Expect = 0.057, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + GLD +YPPEN L I + G ++E P G Sbjct: 182 LGCGLDIVYPPENAKLFARIAEQ-GALVTEYPPG 214 >gi|57238947|ref|YP_180083.1| Smf protein (DNA processing chain A) [Ehrlichia ruminantium str. Welgevonden] gi|58578880|ref|YP_197092.1| Smf protein (DNA processing chain A) [Ehrlichia ruminantium str. Welgevonden] gi|57161026|emb|CAH57932.1| putative DNA processing protein chain A [Ehrlichia ruminantium str. Welgevonden] gi|58417506|emb|CAI26710.1| Smf protein (DNA processing chain A) [Ehrlichia ruminantium str. Welgevonden] Length = 375 Score = 40.9 bits (95), Expect = 0.059, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 20/33 (60%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 M G++ +YP EN L I DNGG+ +E PF Sbjct: 174 MGNGINIVYPEENTTLYNAITDNGGLIATEFPF 206 >gi|58616939|ref|YP_196138.1| Smf protein (DNA processing chain A) [Ehrlichia ruminantium str. Gardel] gi|58416551|emb|CAI27664.1| Smf protein (DNA processing chain A) [Ehrlichia ruminantium str. Gardel] Length = 375 Score = 40.9 bits (95), Expect = 0.059, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 20/33 (60%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 M G++ +YP EN L I DNGG+ +E PF Sbjct: 174 MGNGINIVYPEENTTLYNAITDNGGLIATEFPF 206 >gi|262089745|gb|ACY24839.1| Smf protein [uncultured organism] Length = 382 Score = 40.9 bits (95), Expect = 0.062, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 22/34 (64%) Query: 1 [protein fragment, 34 aa] 34 M GLD +YP +R L ++I D GG +SE+P G Sbjct: 179 MGTGLDMIYPSRHRALAQQIVDIGGALVSELPLG 212 >gi|154500973|ref|ZP_02039011.1| hypothetical protein BACCAP_04659 [Bacteroides capillosus ATCC 29799] gi|150269997|gb|EDM97516.1| hypothetical protein BACCAP_04659 [Bacteroides capillosus ATCC 29799] Length = 408 Score = 40.9 bits (95), Expect = 0.063, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + GG+D +YP ENR L E++ G ISE P G Sbjct: 171 LGGGIDVVYPAENRWLYEDV-AAAGALISEYPPG 203 >gi|297588473|ref|ZP_06947116.1| SMF family DNA processing protein [Finegoldia magna ATCC 53516] gi|297573846|gb|EFH92567.1| SMF family DNA processing protein [Finegoldia magna ATCC 53516] Length = 356 Score = 40.9 bits (95), Expect = 0.064, Method: Composition-based stats. Identities = 12/35 (34%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Query: 1 MAGGLDCLYPPENRNLLEE-IWDNGGIAISEIPFG 34 + G+D +YP N + ++ I + G+ +SE PFG Sbjct: 167 LGCGIDQVYPRSNYRVFQDMISSHNGVIMSEYPFG 201 >gi|54026111|ref|YP_120353.1| putative Rossmann-fold nucleotide-binding protein [Nocardia farcinica IFM 10152] gi|54017619|dbj|BAD58989.1| putative Rossmann-fold nucleotide-binding protein [Nocardia farcinica IFM 10152] Length = 392 Score = 40.9 bits (95), Expect = 0.066, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +A G+D YP ++ LL EI G+ +SE P G Sbjct: 188 LACGVDRPYPAQHDRLLAEI-AEVGLVVSEYPPG 220 >gi|225175754|ref|ZP_03729747.1| DNA protecting protein DprA [Dethiobacter alkaliphilus AHT 1] gi|225168678|gb|EEG77479.1| DNA protecting protein DprA [Dethiobacter alkaliphilus AHT 1] Length = 361 Score = 40.5 bits (94), Expect = 0.068, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + GLD YPPE+ L+E I +N G ISE P G Sbjct: 162 LGHGLDLCYPPEHLELMEAIVEN-GAVISEYPPG 194 >gi|218263971|ref|ZP_03477902.1| hypothetical protein PRABACTJOHN_03592 [Parabacteroides johnsonii DSM 18315] gi|218222382|gb|EEC95032.1| hypothetical protein PRABACTJOHN_03592 [Parabacteroides johnsonii DSM 18315] Length = 322 Score = 40.5 bits (94), Expect = 0.073, Method: Composition-based stats. Identities = 16/36 (44%), Positives = 23/36 (63%), Gaps = 2/36 (5%) Query: 1 MAGGLD--CLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD +YP EN L ++I + GG+ +SE P G Sbjct: 179 LANGLDWESIYPKENLELAKDIVEKGGLLLSEYPVG 214 >gi|325479008|gb|EGC82109.1| DNA protecting protein DprA [Anaerococcus prevotii ACS-065-V-Col13] Length = 365 Score = 40.5 bits (94), Expect = 0.073, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YP +N++L I + G+ +SE P G Sbjct: 174 IGCGIDKIYPKQNKDLYRRI-EENGLILSEFPLG 206 >gi|118443914|ref|YP_878225.1| DNA uptake protein [Clostridium novyi NT] gi|118134370|gb|ABK61414.1| DNA uptake protein [Clostridium novyi NT] Length = 359 Score = 40.5 bits (94), Expect = 0.073, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YP EN+N+ +EI N G IS+ P G Sbjct: 169 LGSGIDVIYPRENKNIYDEIIKN-GCVISQFPPG 201 >gi|304316916|ref|YP_003852061.1| DNA protecting protein DprA [Thermoanaerobacterium thermosaccharolyticum DSM 571] gi|302778418|gb|ADL68977.1| DNA protecting protein DprA [Thermoanaerobacterium thermosaccharolyticum DSM 571] Length = 362 Score = 40.5 bits (94), Expect = 0.074, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G++ +YP EN+ L+E+I N G +SE P Sbjct: 171 LGCGVNIVYPEENKRLMEDIISN-GAVVSEYPL 202 >gi|188586006|ref|YP_001917551.1| DNA protecting protein DprA [Natranaerobius thermophilus JW/NM-WN-LF] gi|179350693|gb|ACB84963.1| DNA protecting protein DprA [Natranaerobius thermophilus JW/NM-WN-LF] Length = 349 Score = 40.5 bits (94), Expect = 0.081, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GLD +YPPENR L ++I G+ ISE P Sbjct: 163 LGNGLDIIYPPENRELYKQI-SEKGLLISEYPP 194 >gi|192360468|ref|YP_001984037.1| smf protein [Cellvibrio japonicus Ueda107] gi|190686633|gb|ACE84311.1| smf protein [Cellvibrio japonicus Ueda107] Length = 387 Score = 40.5 bits (94), Expect = 0.082, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%) Query: 1 [protein fragment, 34 aa] 34 M G+D +YP +R L ++I GG +SE P G Sbjct: 179 MGTGIDRIYPGRHRTLAQQIIAQGGALVSEFPLG 212 >gi|308177311|ref|YP_003916717.1| smf family protein [Arthrobacter arilaitensis Re117] gi|307744774|emb|CBT75746.1| putative smf family protein [Arthrobacter arilaitensis Re117] Length = 414 Score = 40.5 bits (94), Expect = 0.083, Method: Composition-based stats. Identities = 18/34 (52%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 MAGG+D LYP N NLL +I G+ +SE+P G Sbjct: 216 MAGGIDRLYPSGNSNLLNQIVAR-GVLLSEVPPG 248 >gi|169630293|ref|YP_001703942.1| hypothetical protein MAB_3212c [Mycobacterium abscessus ATCC 19977] gi|169242260|emb|CAM63288.1| Conserved hypothetical protein [Mycobacterium abscessus] Length = 378 Score = 40.5 bits (94), Expect = 0.083, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGG+D YP + LL I + G+ +SE P G Sbjct: 180 LAGGVDVPYPAGHSGLLYRIARH-GLVVSEYPPG 212 >gi|255263932|ref|ZP_05343274.1| DNA protecting protein DprA [Thalassiobium sp. R2A62] gi|255106267|gb|EET48941.1| DNA protecting protein DprA [Thalassiobium sp. R2A62] Length = 197 Score = 40.5 bits (94), Expect = 0.086, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 MAGG+DC+YP EN L +I G+ +SE P G Sbjct: 153 MAGGVDCIYPSENTELARKI-AQNGVRVSEQPIG 185 >gi|222054654|ref|YP_002537016.1| DNA protecting protein DprA [Geobacter sp. FRC-32] gi|221563943|gb|ACM19915.1| DNA protecting protein DprA [Geobacter sp. FRC-32] Length = 359 Score = 40.2 bits (93), Expect = 0.090, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YPPENR L +E+ + G +SE P G Sbjct: 170 LGCGIDIVYPPENRPLFKEM-EEKGALVSEFPMG 202 >gi|148265710|ref|YP_001232416.1| DNA protecting protein DprA [Geobacter uraniireducens Rf4] gi|146399210|gb|ABQ27843.1| DNA protecting protein DprA [Geobacter uraniireducens Rf4] Length = 359 Score = 40.2 bits (93), Expect = 0.091, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YPPEN+ L +E+ G +SE P G Sbjct: 170 LGCGIDVVYPPENQRLFKEM-AEKGALVSEFPMG 202 >gi|39997645|ref|NP_953596.1| DNA processing protein DprA [Geobacter sulfurreducens PCA] gi|39984537|gb|AAR35923.1| DNA processing protein DprA [Geobacter sulfurreducens PCA] gi|298506585|gb|ADI85308.1| DNA uptake/processing protein SMF [Geobacter sulfurreducens KN400] Length = 356 Score = 40.2 bits (93), Expect = 0.091, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YPPENR L + D G +SE P G Sbjct: 168 LGCGIDVVYPPENRALFARVADR-GALVSEFPLG 200 >gi|291299698|ref|YP_003510976.1| DNA protecting protein DprA [Stackebrandtia nassauensis DSM 44728] gi|290568918|gb|ADD41883.1| DNA protecting protein DprA [Stackebrandtia nassauensis DSM 44728] Length = 384 Score = 40.2 bits (93), Expect = 0.092, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +A G+D YP N L E I G+ +SE P G Sbjct: 185 LACGVDRPYPAANAGLFERI-AETGLLVSEWPPG 217 >gi|154482594|ref|ZP_02025042.1| hypothetical protein EUBVEN_00261 [Eubacterium ventriosum ATCC 27560] gi|149736619|gb|EDM52505.1| hypothetical protein EUBVEN_00261 [Eubacterium ventriosum ATCC 27560] Length = 333 Score = 40.2 bits (93), Expect = 0.097, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D YP EN L +I NGG ISE P G Sbjct: 144 LGSGVDVCYPTENIELYNDILKNGG-IISEYPPG 176 >gi|302338070|ref|YP_003803276.1| DNA protecting protein DprA [Spirochaeta smaragdinae DSM 11293] gi|301635255|gb|ADK80682.1| DNA protecting protein DprA [Spirochaeta smaragdinae DSM 11293] Length = 337 Score = 40.2 bits (93), Expect = 0.099, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 18/34 (52%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YP + L E I GG +SE P G Sbjct: 171 LGSGVDRIYPEAHHRLAERILAEGGGLVSEYPPG 204 >gi|254447541|ref|ZP_05061007.1| DNA protecting protein DprA [gamma proteobacterium HTCC5015] gi|198262884|gb|EDY87163.1| DNA protecting protein DprA [gamma proteobacterium HTCC5015] Length = 373 Score = 40.2 bits (93), Expect = 0.100, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%) Query: 1 [protein fragment, 34 aa] 34 MA G D +YP ++R+L I GG ++E P G Sbjct: 172 MATGADRVYPAKHRDLAHRIVAEGGALVTEFPLG 205 >gi|225019249|ref|ZP_03708441.1| hypothetical protein CLOSTMETH_03202 [Clostridium methylpentosum DSM 5476] gi|224947880|gb|EEG29089.1| hypothetical protein CLOSTMETH_03202 [Clostridium methylpentosum DSM 5476] Length = 369 Score = 40.2 bits (93), Expect = 0.10, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 18/34 (52%) Query: 1 [protein fragment, 34 aa] 34 ++ LD YP N L EI +GG +SE P G Sbjct: 172 LSCPLDKNYPASNEGLRREILRHGGALVSEFPPG 205 >gi|84501686|ref|ZP_00999858.1| DNA processing protein DprA, putative [Oceanicola batsensis HTCC2597] gi|84390307|gb|EAQ02866.1| DNA processing protein DprA, putative [Oceanicola batsensis HTCC2597] Length = 372 Score = 40.2 bits (93), Expect = 0.10, Method: Composition-based stats. Identities = 18/34 (52%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 MAGG+D LYPPEN L + I G +SE+P G Sbjct: 153 MAGGVDALYPPENATLADAI-PGTGARLSEMPMG 185 >gi|296139360|ref|YP_003646603.1| DNA protecting protein DprA [Tsukamurella paurometabola DSM 20162] gi|296027494|gb|ADG78264.1| DNA protecting protein DprA [Tsukamurella paurometabola DSM 20162] Length = 388 Score = 40.2 bits (93), Expect = 0.11, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YP + L I G ISE P G Sbjct: 191 VAGGLDRPYPAGHAGLFRRI-AEDGAVISEYPPG 223 >gi|81299514|ref|YP_399722.1| DNA processing protein DprA, putative [Synechococcus elongatus PCC 7942] gi|81168395|gb|ABB56735.1| DNA processing protein DprA, putative [Synechococcus elongatus PCC 7942] Length = 402 Score = 40.2 bits (93), Expect = 0.11, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 23/34 (67%) Query: 1 [protein fragment, 34 aa] 34 + G++ +YPP+NR L E I + GG+ +SE P G Sbjct: 200 LGTGVNVIYPPQNRALYEAILEQGGLILSEQPSG 233 >gi|56750836|ref|YP_171537.1| DNA processing protein [Synechococcus elongatus PCC 6301] gi|56685795|dbj|BAD79017.1| DNA processing protein [Synechococcus elongatus PCC 6301] Length = 406 Score = 40.2 bits (93), Expect = 0.11, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 23/34 (67%) Query: 1 [protein fragment, 34 aa] 34 + G++ +YPP+NR L E I + GG+ +SE P G Sbjct: 204 LGTGVNVIYPPQNRALYEAILEQGGLILSEQPSG 237 >gi|284099271|ref|ZP_06385988.1| SMF protein [Candidatus Poribacteria sp. WGA-A3] gi|283830401|gb|EFC34611.1| SMF protein [Candidatus Poribacteria sp. WGA-A3] Length = 375 Score = 40.2 bits (93), Expect = 0.11, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D YPPE+R L ++I + G +SE+P G Sbjct: 175 VGCGVDRTYPPEHRQLRKDI-EVNGAVVSELPLG 207 >gi|262376935|ref|ZP_06070162.1| DNA protecting protein DprA [Acinetobacter lwoffii SH145] gi|262308280|gb|EEY89416.1| DNA protecting protein DprA [Acinetobacter lwoffii SH145] Length = 379 Score = 40.2 bits (93), Expect = 0.11, Method: Composition-based stats. Identities = 14/30 (46%), Positives = 22/30 (73%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISE 30 MA GLD YP ++++L ++I ++GG ISE Sbjct: 179 MATGLDQTYPAQHQSLRQQIIEHGGAVISE 208 >gi|302392405|ref|YP_003828225.1| DNA protecting protein DprA [Acetohalobium arabaticum DSM 5501] gi|302204482|gb|ADL13160.1| DNA protecting protein DprA [Acetohalobium arabaticum DSM 5501] Length = 367 Score = 39.8 bits (92), Expect = 0.12, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YPPEN L+ EI + G IS P G Sbjct: 171 LGSGIDVIYPPENDELVTEI-EESGAVISSFPLG 203 >gi|257458421|ref|ZP_05623563.1| smf protein [Treponema vincentii ATCC 35580] gi|257444225|gb|EEV19326.1| smf protein [Treponema vincentii ATCC 35580] Length = 318 Score = 39.8 bits (92), Expect = 0.12, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 18/34 (52%) Query: 1 [protein fragment, 34 aa] 34 +A GLD LYP N L I + GG +SE G Sbjct: 178 LACGLDRLYPQSNARLAGRILETGGCILSEYAPG 211 >gi|182412005|ref|YP_001817071.1| DNA protecting protein DprA [Opitutus terrae PB90-1] gi|177839219|gb|ACB73471.1| DNA protecting protein DprA [Opitutus terrae PB90-1] Length = 382 Score = 39.8 bits (92), Expect = 0.13, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YPPEN L +I + G +SE PFG Sbjct: 177 VGCGIDIIYPPENLALYRQI-EATGAVLSEFPFG 209 >gi|254784307|ref|YP_003071735.1| SMF protein [Teredinibacter turnerae T7901] gi|237686231|gb|ACR13495.1| SMF protein [Teredinibacter turnerae T7901] Length = 389 Score = 39.8 bits (92), Expect = 0.13, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 20/34 (58%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YP N+ + ++I GG +SE P G Sbjct: 178 LGTGIDQVYPQRNKQMADQIVQTGGALVSEFPLG 211 >gi|257066778|ref|YP_003153034.1| DNA protecting protein DprA [Anaerococcus prevotii DSM 20548] gi|256798658|gb|ACV29313.1| DNA protecting protein DprA [Anaerococcus prevotii DSM 20548] Length = 363 Score = 39.8 bits (92), Expect = 0.13, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YP +NR+L I + G+ +SE P G Sbjct: 172 IGCGIDKIYPKQNRDLYRRI-EENGLILSEFPLG 204 >gi|254446574|ref|ZP_05060050.1| DNA protecting protein DprA, putative [Verrucomicrobiae bacterium DG1235] gi|198260882|gb|EDY85190.1| DNA protecting protein DprA, putative [Verrucomicrobiae bacterium DG1235] Length = 376 Score = 39.8 bits (92), Expect = 0.13, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Query: 3 GGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPPEN +L + G +SE PFG Sbjct: 179 CGIDIVYPPENVDLFRQ-AQVNGAVVSEFPFG 209 >gi|258511359|ref|YP_003184793.1| DNA protecting protein DprA [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446] gi|257478085|gb|ACV58404.1| DNA protecting protein DprA [Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446] Length = 366 Score = 39.8 bits (92), Expect = 0.13, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D YPP NR L ++I G +SE P G Sbjct: 175 LGCGIDRCYPPSNRRLYDQIAST-GTLVSEYPPG 207 >gi|167771636|ref|ZP_02443689.1| hypothetical protein ANACOL_03008 [Anaerotruncus colihominis DSM 17241] gi|167666276|gb|EDS10406.1| hypothetical protein ANACOL_03008 [Anaerotruncus colihominis DSM 17241] Length = 415 Score = 39.8 bits (92), Expect = 0.13, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 19/34 (55%) Query: 1 [protein fragment, 34 aa] 34 +A GLD YP + L I D GG ++E PFG Sbjct: 172 LACGLDVDYPSASGELKRRILDAGGALVTEFPFG 205 >gi|188589719|ref|YP_001920600.1| DNA protecting protein DprA [Clostridium botulinum E3 str. Alaska E43] gi|188500000|gb|ACD53136.1| DNA protecting protein DprA [Clostridium botulinum E3 str. Alaska E43] Length = 352 Score = 39.8 bits (92), Expect = 0.13, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YP EN +L ++ + G+ ISE P G Sbjct: 168 LGCGIDVVYPSENIDLFSKVIKD-GLIISEFPLG 200 >gi|189502567|ref|YP_001958284.1| hypothetical protein Aasi_1230 [Candidatus Amoebophilus asiaticus 5a2] gi|189498008|gb|ACE06555.1| hypothetical protein Aasi_1230 [Candidatus Amoebophilus asiaticus 5a2] Length = 374 Score = 39.8 bits (92), Expect = 0.13, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 24/34 (70%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD +YP ++ + ++ +GG+ +SEIP G Sbjct: 176 LAGGLDKIYPTAHKKVALDMLADGGL-VSEIPIG 208 >gi|288958693|ref|YP_003449034.1| DNA processing protein [Azospirillum sp. B510] gi|288911001|dbj|BAI72490.1| DNA processing protein [Azospirillum sp. B510] Length = 378 Score = 39.8 bits (92), Expect = 0.13, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGG+D +YPPEN L +I G+ ++E G Sbjct: 173 LAGGIDVVYPPENEALYRDILAQ-GVIVAESAIG 205 >gi|251779444|ref|ZP_04822364.1| DNA protecting protein DprA [Clostridium botulinum E1 str. 'BoNT E Beluga'] gi|243083759|gb|EES49649.1| DNA protecting protein DprA [Clostridium botulinum E1 str. 'BoNT E Beluga'] Length = 352 Score = 39.8 bits (92), Expect = 0.14, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YP EN +L ++ + G+ ISE P G Sbjct: 168 LGCGIDVVYPSENIDLFSKVIKD-GLIISEFPLG 200 >gi|84498371|ref|ZP_00997168.1| SMF protein [Janibacter sp. HTCC2649] gi|84381871|gb|EAP97754.1| SMF protein [Janibacter sp. HTCC2649] Length = 390 Score = 39.8 bits (92), Expect = 0.14, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +A GLD YP + LL EI D G+ +SE+P G Sbjct: 192 LARGLDRAYPQAHEGLLREIAD-IGVVVSELPLG 224 >gi|300718671|ref|YP_003743474.1| DNA protecting protein [Erwinia billingiae Eb661] gi|299064507|emb|CAX61627.1| DNA protecting protein [Erwinia billingiae Eb661] Length = 374 Score = 39.8 bits (92), Expect = 0.15, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 21/33 (63%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ LYP ++ +L +EI +GG ISE P Sbjct: 167 LGSGLNHLYPRQHISLAKEIIASGGAVISEFPL 199 >gi|147677580|ref|YP_001211795.1| Rossmann fold nucleotide-binding protein [Pelotomaculum thermopropionicum SI] gi|146273677|dbj|BAF59426.1| predicted Rossmann fold nucleotide-binding protein [Pelotomaculum thermopropionicum SI] Length = 367 Score = 39.8 bits (92), Expect = 0.15, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G D +YP ENR L+E+I N G ISE P G Sbjct: 172 LGCGPDVVYPRENRRLMEKII-NNGAVISEYPPG 204 >gi|322420083|ref|YP_004199306.1| DNA protecting protein DprA [Geobacter sp. M18] gi|320126470|gb|ADW14030.1| DNA protecting protein DprA [Geobacter sp. M18] Length = 359 Score = 39.4 bits (91), Expect = 0.15, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YPPEN L + + G ISE P G Sbjct: 170 LGCGIDVVYPPENDTLYRSLCEQ-GAVISEFPMG 202 >gi|291549900|emb|CBL26162.1| DNA protecting protein DprA [Ruminococcus torques L2-14] Length = 370 Score = 39.4 bits (91), Expect = 0.16, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 20/34 (58%) Query: 1 [protein fragment, 34 aa] 34 + G+D YP ++ L +I ++GG +SE P G Sbjct: 175 LGSGVDVCYPRDHIGLYMDIIEHGGGILSEFPPG 208 >gi|95929065|ref|ZP_01311810.1| DNA processing protein DprA, putative [Desulfuromonas acetoxidans DSM 684] gi|95134966|gb|EAT16620.1| DNA processing protein DprA, putative [Desulfuromonas acetoxidans DSM 684] Length = 363 Score = 39.4 bits (91), Expect = 0.16, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YP ENR+L E+I GI +SE P G Sbjct: 170 LGCGIDLIYPKENRHLFEQI-GEKGIIVSEYPPG 202 >gi|326793338|ref|YP_004311158.1| DNA protecting protein DprA [Marinomonas mediterranea MMB-1] gi|326544102|gb|ADZ89322.1| DNA protecting protein DprA [Marinomonas mediterranea MMB-1] Length = 442 Score = 39.4 bits (91), Expect = 0.17, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 19/33 (57%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 M GL LYP +N L +I + GG+ +SE P Sbjct: 206 MGTGLLNLYPKQNIGLFTKIVEQGGVLVSEYPL 238 >gi|114763467|ref|ZP_01442874.1| DNA processing protein DprA, putative [Pelagibaca bermudensis HTCC2601] gi|114544005|gb|EAU47016.1| DNA processing protein DprA, putative [Roseovarius sp. HTCC2601] Length = 375 Score = 39.4 bits (91), Expect = 0.17, Method: Composition-based stats. Identities = 19/34 (55%), Positives = 21/34 (61%) Query: 1 [protein fragment, 34 aa] 34 MAGG+D LYP EN L EEI GG +SE G Sbjct: 153 MAGGVDILYPSENTRLGEEIRARGGALVSEHAMG 186 >gi|87199818|ref|YP_497075.1| DNA processing protein DprA, putative [Novosphingobium aromaticivorans DSM 12444] gi|87135499|gb|ABD26241.1| DNA protecting protein DprA [Novosphingobium aromaticivorans DSM 12444] Length = 375 Score = 39.4 bits (91), Expect = 0.17, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +A G+D YPPE+ +L +E + G+ I+E+P G Sbjct: 181 IASGIDVTYPPEHGDL-QEQVAHEGLLIAEMPPG 213 >gi|114570266|ref|YP_756946.1| DNA protecting protein DprA [Maricaulis maris MCS10] gi|114340728|gb|ABI66008.1| DNA protecting protein DprA [Maricaulis maris MCS10] Length = 387 Score = 39.4 bits (91), Expect = 0.18, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGG+D +YPPE+ L G+ +SE+P G Sbjct: 170 LAGGIDHIYPPEHGELHAR-LGEDGLLLSEVPLG 202 >gi|88855250|ref|ZP_01129915.1| DNA processing factor [marine actinobacterium PHSC20C1] gi|88815778|gb|EAR25635.1| DNA processing factor [marine actinobacterium PHSC20C1] Length = 434 Score = 39.4 bits (91), Expect = 0.18, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGG+D YP + +LL I +N G ISE+P G Sbjct: 218 LAGGVDRFYPSGHDSLLSRIVEN-GAVISELPCG 250 >gi|269215607|ref|ZP_06159461.1| DNA processing protein DprA [Slackia exigua ATCC 700122] gi|269131094|gb|EEZ62169.1| DNA processing protein DprA [Slackia exigua ATCC 700122] Length = 311 Score = 39.4 bits (91), Expect = 0.19, Method: Composition-based stats. Identities = 13/32 (40%), Positives = 17/32 (53%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIP 32 + GG+ YP +N L + I D GG SE P Sbjct: 106 LGGGIARPYPADNVPLFQRIVDGGGALASEHP 137 >gi|329295655|ref|ZP_08252991.1| DNA protecting protein DprA [Plautia stali symbiont] Length = 374 Score = 39.4 bits (91), Expect = 0.19, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 21/33 (63%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ LYP ++ L +EI +GG +SE+P Sbjct: 167 LGSGLNHLYPKSHQPLAQEIIASGGALVSELPL 199 >gi|302389647|ref|YP_003825468.1| DNA protecting protein DprA [Thermosediminibacter oceani DSM 16646] gi|302200275|gb|ADL07845.1| DNA protecting protein DprA [Thermosediminibacter oceani DSM 16646] Length = 359 Score = 39.4 bits (91), Expect = 0.19, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YPPEN NL+ EI G IS P G Sbjct: 172 LGCGIDIVYPPENYNLMAEII-KAGCVISSFPMG 204 >gi|260599605|ref|YP_003212176.1| hypothetical protein CTU_38130 [Cronobacter turicensis z3032] gi|260218782|emb|CBA34130.1| Protein smf [Cronobacter turicensis z3032] Length = 381 Score = 39.4 bits (91), Expect = 0.19, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 20/33 (60%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP +R L EEI + GG +SE PF Sbjct: 178 LGNGLAQVYPARHRKLAEEIIEQGGAVVSEFPF 210 >gi|218288280|ref|ZP_03492579.1| DNA protecting protein DprA [Alicyclobacillus acidocaldarius LAA1] gi|218241639|gb|EED08812.1| DNA protecting protein DprA [Alicyclobacillus acidocaldarius LAA1] Length = 366 Score = 39.4 bits (91), Expect = 0.19, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D YPP NR L ++I G +SE P G Sbjct: 175 LGCGIDRCYPPSNRRLYDQIAST-GTLVSEYPPG 207 >gi|152994061|ref|YP_001338896.1| DNA protecting protein DprA [Marinomonas sp. MWYL1] gi|150834985|gb|ABR68961.1| DNA protecting protein DprA [Marinomonas sp. MWYL1] Length = 442 Score = 39.4 bits (91), Expect = 0.19, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 M GL YP NR + EEI + GG ISE P Sbjct: 210 MGTGLFHRYPHHNRQMFEEILEQGGALISEYPL 242 >gi|254477402|ref|ZP_05090788.1| DNA protecting protein DprA [Ruegeria sp. R11] gi|214031645|gb|EEB72480.1| DNA protecting protein DprA [Ruegeria sp. R11] Length = 362 Score = 39.4 bits (91), Expect = 0.19, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 MAGG+D +YP EN L +I D G+ +SE P G Sbjct: 145 MAGGVDVIYPAENLQLARDIADQ-GLLLSEHPPG 177 >gi|320161003|ref|YP_004174227.1| putative DNA processing protein [Anaerolinea thermophila UNI-1] gi|319994856|dbj|BAJ63627.1| putative DNA processing protein [Anaerolinea thermophila UNI-1] Length = 370 Score = 39.0 bits (90), Expect = 0.20, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + GLD +YPPE+ L E+I G IS+ G Sbjct: 172 LGCGLDRIYPPEHSKLAEKIIQQ-GALISDYAPG 204 >gi|313888012|ref|ZP_07821690.1| DNA protecting protein DprA [Peptoniphilus harei ACS-146-V-Sch2b] gi|312845967|gb|EFR33350.1| DNA protecting protein DprA [Peptoniphilus harei ACS-146-V-Sch2b] Length = 359 Score = 39.0 bits (90), Expect = 0.21, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YP N+ L EEI G ISE P G Sbjct: 172 LGTGIDVIYPKSNKALYEEI-SEKGAVISEFPLG 204 >gi|225848022|ref|YP_002728185.1| DNA protecting protein DprA [Sulfurihydrogenibium azorense Az-Fu1] gi|225643199|gb|ACN98249.1| DNA protecting protein DprA [Sulfurihydrogenibium azorense Az-Fu1] Length = 356 Score = 39.0 bits (90), Expect = 0.21, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YP ENR L ++I +N G ISE P G Sbjct: 171 LGSGIDVVYPFENRKLYDKITEN-GCVISEFPIG 203 >gi|126733565|ref|ZP_01749312.1| DNA processing protein DprA, putative [Roseobacter sp. CCS2] gi|126716431|gb|EBA13295.1| DNA processing protein DprA, putative [Roseobacter sp. CCS2] Length = 379 Score = 39.0 bits (90), Expect = 0.21, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 MAGG+D +YP EN L +I G+ +SE+P G Sbjct: 180 MAGGVDIIYPAENTQLAHDI-AKRGLRLSEMPMG 212 >gi|197119085|ref|YP_002139512.1| DNA uptake/processing protein SMF [Geobacter bemidjiensis Bem] gi|197088445|gb|ACH39716.1| DNA uptake/processing protein SMF [Geobacter bemidjiensis Bem] Length = 359 Score = 39.0 bits (90), Expect = 0.21, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YPPEN L + G ISE P G Sbjct: 170 LGCGIDLVYPPENGALYQA-LAESGALISEFPMG 202 >gi|225181360|ref|ZP_03734804.1| DNA protecting protein DprA [Dethiobacter alkaliphilus AHT 1] gi|225167941|gb|EEG76748.1| DNA protecting protein DprA [Dethiobacter alkaliphilus AHT 1] Length = 357 Score = 39.0 bits (90), Expect = 0.21, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G D YPPEN L E+I GGI +SE P G Sbjct: 171 LGCGPDVCYPPENLKLREKIVS-GGIILSEFPPG 203 >gi|159043687|ref|YP_001532481.1| DNA protecting protein DprA [Dinoroseobacter shibae DFL 12] gi|157911447|gb|ABV92880.1| DNA protecting protein DprA [Dinoroseobacter shibae DFL 12] Length = 379 Score = 39.0 bits (90), Expect = 0.22, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD +YP EN L + I G+ +SE P G Sbjct: 183 VAGGLDVIYPKENTELFKRIAKQ-GLIVSEQPLG 215 >gi|325579162|ref|ZP_08149118.1| DNA processing SMF protein [Haemophilus parainfluenzae ATCC 33392] gi|325159397|gb|EGC71531.1| DNA processing SMF protein [Haemophilus parainfluenzae ATCC 33392] Length = 367 Score = 39.0 bits (90), Expect = 0.22, Method: Composition-based stats. Identities = 13/30 (43%), Positives = 20/30 (66%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISE 30 + GLD +YP ++R L E+I +N G +SE Sbjct: 170 LGSGLDHIYPAKHRRLAEQIIENNGALVSE 199 >gi|301155615|emb|CBW15083.1| conserved protein [Haemophilus parainfluenzae T3T1] Length = 371 Score = 39.0 bits (90), Expect = 0.22, Method: Composition-based stats. Identities = 13/30 (43%), Positives = 20/30 (66%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISE 30 + GLD +YP ++R L E+I +N G +SE Sbjct: 170 LGSGLDHIYPAKHRRLAEQIIENNGALVSE 199 >gi|310641535|ref|YP_003946293.1| DNA protecting protein dpra [Paenibacillus polymyxa SC2] gi|309246485|gb|ADO56052.1| DNA protecting protein DprA [Paenibacillus polymyxa SC2] Length = 409 Score = 39.0 bits (90), Expect = 0.22, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + +D +YPP+N +L E+ G+ +SE P G Sbjct: 208 LGTAIDQIYPPQNASLFAEMAS-KGLIVSEYPPG 240 >gi|332670025|ref|YP_004453033.1| SMF family protein [Cellulomonas fimi ATCC 484] gi|332339063|gb|AEE45646.1| SMF family protein [Cellulomonas fimi ATCC 484] Length = 412 Score = 39.0 bits (90), Expect = 0.23, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 22/34 (64%) Query: 1 [protein fragment, 34 aa] 34 +AGG+D YP N ++ + D+GG +SE+P G Sbjct: 190 LAGGVDRAYPVGNARMIAAVMDDGGTVVSEVPVG 223 >gi|291522666|emb|CBK80959.1| DNA protecting protein DprA [Coprococcus catus GD/7] Length = 359 Score = 39.0 bits (90), Expect = 0.24, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D YP EN +L EI NGG +SE P G Sbjct: 173 LGCGVDVCYPRENIDLYTEISRNGG-ILSEFPPG 205 >gi|33152875|ref|NP_874228.1| DNA processing chain A [Haemophilus ducreyi 35000HP] gi|33149100|gb|AAP96617.1| smf protein [Haemophilus ducreyi 35000HP] Length = 380 Score = 39.0 bits (90), Expect = 0.24, Method: Composition-based stats. Identities = 13/30 (43%), Positives = 19/30 (63%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISE 30 + GLD +YP ++ L E+I NGG +SE Sbjct: 168 LGSGLDQVYPARHKKLAEQIIANGGALVSE 197 >gi|160884358|ref|ZP_02065361.1| hypothetical protein BACOVA_02336 [Bacteroides ovatus ATCC 8483] gi|255691673|ref|ZP_05415348.1| putative DNA protecting protein DprA [Bacteroides finegoldii DSM 17565] gi|156110097|gb|EDO11842.1| hypothetical protein BACOVA_02336 [Bacteroides ovatus ATCC 8483] gi|260622745|gb|EEX45616.1| putative DNA protecting protein DprA [Bacteroides finegoldii DSM 17565] Length = 320 Score = 39.0 bits (90), Expect = 0.24, Method: Composition-based stats. Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 2/36 (5%) Query: 1 MAGGLD--CLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD +YP EN +L +EI G+ +SE P G Sbjct: 179 LANGLDWDSIYPKENLDLAKEIVVKRGLLLSEYPVG 214 >gi|227499921|ref|ZP_03930014.1| SMF family DNA processing protein [Anaerococcus tetradius ATCC 35098] gi|227218030|gb|EEI83303.1| SMF family DNA processing protein [Anaerococcus tetradius ATCC 35098] Length = 363 Score = 39.0 bits (90), Expect = 0.25, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YP +NR+L I + G+ +SE P G Sbjct: 172 IGCGIDKIYPKKNRDLYRRI-EESGLILSEFPLG 204 >gi|308068644|ref|YP_003870249.1| Smf protein [Paenibacillus polymyxa E681] gi|305857923|gb|ADM69711.1| Smf protein [Paenibacillus polymyxa E681] Length = 395 Score = 39.0 bits (90), Expect = 0.25, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + +D +YPP+N +L E+ G+ +SE P G Sbjct: 194 LGTAIDQIYPPQNASLFAEMAS-KGLIVSEYPPG 226 >gi|228471288|ref|ZP_04056094.1| Smf protein DNA processing chain A [Porphyromonas uenonis 60-3] gi|228306930|gb|EEK16028.1| Smf protein DNA processing chain A [Porphyromonas uenonis 60-3] Length = 384 Score = 38.6 bits (89), Expect = 0.26, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 20/34 (58%) Query: 1 [protein fragment, 34 aa] 34 +A GL +YP +RNL I +GG +SE P G Sbjct: 179 LAHGLHMIYPSNHRNLARSIVSHGGALLSEYPAG 212 >gi|158424472|ref|YP_001525764.1| SMF protein [Azorhizobium caulinodans ORS 571] gi|158331361|dbj|BAF88846.1| SMF protein [Azorhizobium caulinodans ORS 571] Length = 374 Score = 38.6 bits (89), Expect = 0.26, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGGL YP EN L++ + G +SE+P G Sbjct: 174 AGGLSRPYPAENVPLIQAV-AEKGAVVSEMPLG 205 >gi|332991531|gb|AEF01586.1| DNA protecting protein DprA [Alteromonas sp. SN2] Length = 385 Score = 38.6 bits (89), Expect = 0.27, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%) Query: 1 [protein fragment, 34 aa] 34 M G D +YPP+N +L +I + GG I+E G Sbjct: 190 MGTGPDIVYPPKNVSLHRDIVNAGGACITEFFPG 223 >gi|89071023|ref|ZP_01158240.1| DNA processing protein DprA, putative [Oceanicola granulosus HTCC2516] gi|89043411|gb|EAR49628.1| DNA processing protein DprA, putative [Oceanicola granulosus HTCC2516] Length = 356 Score = 38.6 bits (89), Expect = 0.27, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGG+D +YPPEN L +I G+ +SE G Sbjct: 153 LAGGIDVIYPPENAGLARDIAAQ-GVLLSEQRPG 185 >gi|281421987|ref|ZP_06252986.1| putative DNA protecting protein DprA [Prevotella copri DSM 18205] gi|281403945|gb|EFB34625.1| putative DNA protecting protein DprA [Prevotella copri DSM 18205] Length = 321 Score = 38.6 bits (89), Expect = 0.29, Method: Composition-based stats. Identities = 16/36 (44%), Positives = 23/36 (63%), Gaps = 2/36 (5%) Query: 1 MAGGLD--CLYPPENRNLLEEIWDNGGIAISEIPFG 34 +A GLD +YP EN L + I ++GG+ +SE P G Sbjct: 179 LANGLDWESIYPKENLELAKNIVESGGLLLSEYPVG 214 >gi|327395470|dbj|BAK12892.1| protein Smf [Pantoea ananatis AJ13355] Length = 374 Score = 38.6 bits (89), Expect = 0.29, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL LYP + L +EI + GG ISE P Sbjct: 167 LGSGLAHLYPRRHVALAQEIVEQGGAVISEFPL 199 >gi|300907197|ref|ZP_07124860.1| putative DNA protecting protein DprA [Escherichia coli MS 84-1] gi|301303624|ref|ZP_07209746.1| putative DNA protecting protein DprA [Escherichia coli MS 124-1] gi|300401072|gb|EFJ84610.1| putative DNA protecting protein DprA [Escherichia coli MS 84-1] gi|300841123|gb|EFK68883.1| putative DNA protecting protein DprA [Escherichia coli MS 124-1] gi|315257854|gb|EFU37822.1| putative DNA protecting protein DprA [Escherichia coli MS 85-1] Length = 324 Score = 38.6 bits (89), Expect = 0.29, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 20/34 (58%) Query: 1 [protein fragment, 34 aa] 34 +A GL+ P +N L +EI D GG ISE P G Sbjct: 178 LAHGLEEAKPKQNSRLAQEILDKGGAWISEYPMG 211 >gi|300780927|ref|ZP_07090781.1| smf family protein [Corynebacterium genitalium ATCC 33030] gi|300532634|gb|EFK53695.1| smf family protein [Corynebacterium genitalium ATCC 33030] Length = 398 Score = 38.6 bits (89), Expect = 0.29, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 16/33 (48%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 A G +YP N L + I GG ++E P G Sbjct: 198 ACGPGQIYPKRNGKLFDRIAAEGGAIVTEYPPG 230 >gi|290512103|ref|ZP_06551471.1| DNA processing protein [Klebsiella sp. 1_1_55] gi|289775893|gb|EFD83893.1| DNA processing protein [Klebsiella sp. 1_1_55] Length = 374 Score = 38.6 bits (89), Expect = 0.30, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 21/33 (63%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ +YP + NL ++I DNGG +SE P Sbjct: 167 LGNGLEQVYPRRHANLAQQIIDNGGTLVSEFPL 199 >gi|148556726|ref|YP_001264308.1| DNA protecting protein DprA [Sphingomonas wittichii RW1] gi|148501916|gb|ABQ70170.1| DNA protecting protein DprA [Sphingomonas wittichii RW1] Length = 592 Score = 38.6 bits (89), Expect = 0.31, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGG+D +YPPEN L +E G+ I+E P G Sbjct: 395 IAGGIDIVYPPENAAL-QEAIAERGLLIAEQPPG 427 >gi|291619141|ref|YP_003521883.1| Smf [Pantoea ananatis LMG 20103] gi|291154171|gb|ADD78755.1| Smf [Pantoea ananatis LMG 20103] Length = 376 Score = 38.6 bits (89), Expect = 0.31, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL LYP + L +EI + GG ISE P Sbjct: 169 LGSGLAHLYPRRHVALAQEIVEQGGAVISEFPL 201 >gi|288933301|ref|YP_003437360.1| DNA protecting protein DprA [Klebsiella variicola At-22] gi|288888030|gb|ADC56348.1| DNA protecting protein DprA [Klebsiella variicola At-22] Length = 374 Score = 38.6 bits (89), Expect = 0.32, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 21/33 (63%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ +YP + NL ++I DNGG +SE P Sbjct: 167 LGNGLEQVYPRRHANLAQQIIDNGGTLVSEFPL 199 >gi|288923345|ref|ZP_06417477.1| DNA protecting protein DprA [Frankia sp. EUN1f] gi|288345308|gb|EFC79705.1| DNA protecting protein DprA [Frankia sp. EUN1f] Length = 311 Score = 38.6 bits (89), Expect = 0.32, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGG+D YP + +L +I + G +SE P G Sbjct: 182 LAGGVDIPYPAAHADLFHDIAHH-GALVSEAPPG 214 >gi|332300411|ref|YP_004442332.1| DNA protecting protein DprA [Porphyromonas asaccharolytica DSM 20707] gi|332177474|gb|AEE13164.1| DNA protecting protein DprA [Porphyromonas asaccharolytica DSM 20707] Length = 384 Score = 38.6 bits (89), Expect = 0.33, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 20/34 (58%) Query: 1 [protein fragment, 34 aa] 34 +A GL +YP +RNL I +GG +SE P G Sbjct: 179 LAHGLHMIYPSNHRNLARNIVTHGGALLSEYPAG 212 >gi|120552988|ref|YP_957339.1| DNA protecting protein DprA [Marinobacter aquaeolei VT8] gi|120322837|gb|ABM17152.1| DNA protecting protein DprA [Marinobacter aquaeolei VT8] Length = 405 Score = 38.6 bits (89), Expect = 0.33, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + GLD LYP ++RNL I +N G+ +SE P G Sbjct: 201 VGCGLDRLYPAQHRNLAHRIIEN-GLIVSEYPPG 233 >gi|317063578|ref|ZP_07928063.1| conserved hypothetical protein [Fusobacterium ulcerans ATCC 49185] gi|313689254|gb|EFS26089.1| conserved hypothetical protein [Fusobacterium ulcerans ATCC 49185] Length = 355 Score = 38.6 bits (89), Expect = 0.33, Method: Composition-based stats. Identities = 17/31 (54%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP ENR L E+I + G+ ISE P G Sbjct: 172 GLDIIYPKENRILWEQI-ERSGLIISEYPLG 201 >gi|257469331|ref|ZP_05633425.1| Smf protein [Fusobacterium ulcerans ATCC 49185] Length = 352 Score = 38.6 bits (89), Expect = 0.33, Method: Composition-based stats. Identities = 17/31 (54%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP ENR L E+I + G+ ISE P G Sbjct: 169 GLDIIYPKENRILWEQI-ERSGLIISEYPLG 198 >gi|260889465|ref|ZP_05900728.1| DNA protecting protein DprA [Leptotrichia hofstadii F0254] gi|260860876|gb|EEX75376.1| DNA protecting protein DprA [Leptotrichia hofstadii F0254] Length = 279 Score = 38.2 bits (88), Expect = 0.34, Method: Composition-based stats. Identities = 17/31 (54%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP ENR+L E I G ISE P G Sbjct: 178 GLDVVYPYENRDLWERI-GETGTLISEYPLG 207 >gi|215485950|ref|YP_002328381.1| hypothetical protein E2348C_0815 [Escherichia coli O127:H6 str. E2348/69] gi|312969113|ref|ZP_07783320.1| SMF family protein [Escherichia coli 2362-75] gi|331676604|ref|ZP_08377300.1| DNA protecting protein DprA [Escherichia coli H591] gi|215264022|emb|CAS08363.1| predicted protein [Escherichia coli O127:H6 str. E2348/69] gi|312286515|gb|EFR14428.1| SMF family protein [Escherichia coli 2362-75] gi|323942733|gb|EGB38898.1| DNA recombination-mediator protein A [Escherichia coli E482] gi|331075293|gb|EGI46591.1| DNA protecting protein DprA [Escherichia coli H591] Length = 319 Score = 38.2 bits (88), Expect = 0.34, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 20/34 (58%) Query: 1 [protein fragment, 34 aa] 34 +A GL+ P +N L +EI D GG ISE P G Sbjct: 173 LAHGLEEAKPKQNSRLAQEILDKGGAWISEYPMG 206 >gi|251797454|ref|YP_003012185.1| DNA protecting protein DprA [Paenibacillus sp. JDR-2] gi|247545080|gb|ACT02099.1| DNA protecting protein DprA [Paenibacillus sp. JDR-2] Length = 371 Score = 38.2 bits (88), Expect = 0.34, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +A +D YPPENR+L ++I G+ +SE P G Sbjct: 177 LASPVDHCYPPENRSLYQQIV-REGLILSESPVG 209 >gi|51244646|ref|YP_064530.1| SMF protein (DNA processing chain A) [Desulfotalea psychrophila LSv54] gi|50875683|emb|CAG35523.1| probable SMF protein (DNA processing chain A) [Desulfotalea psychrophila LSv54] Length = 357 Score = 38.2 bits (88), Expect = 0.35, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + GLD +YP +N+ L +I G+ I+E P G Sbjct: 168 LGCGLDIVYPYQNKKLY-KIIAGEGLVITEYPLG 200 >gi|300783888|ref|YP_003764179.1| DNA processing protein [Amycolatopsis mediterranei U32] gi|299793402|gb|ADJ43777.1| DNA processing protein [Amycolatopsis mediterranei U32] Length = 332 Score = 38.2 bits (88), Expect = 0.35, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 17/34 (50%) Query: 1 [protein fragment, 34 aa] 34 + +D YP + LL I +GG ISE P G Sbjct: 134 LGCAVDNGYPAGHIGLLNRIAGSGGAVISEYPPG 167 >gi|297623876|ref|YP_003705310.1| DNA protecting protein DprA [Truepera radiovictrix DSM 17093] gi|297165056|gb|ADI14767.1| DNA protecting protein DprA [Truepera radiovictrix DSM 17093] Length = 372 Score = 38.2 bits (88), Expect = 0.35, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 17/34 (50%) Query: 1 [protein fragment, 34 aa] 34 + G+D YP +N L I D GG +SE G Sbjct: 182 LGSGVDRPYPAQNARLARRIADGGGAVVSEYRLG 215 >gi|16329968|ref|NP_440696.1| hypothetical protein slr1197 [Synechocystis sp. PCC 6803] gi|3914979|sp|P73345|SMF_SYNY3 RecName: Full=Protein smf gi|1652454|dbj|BAA17376.1| slr1197 [Synechocystis sp. PCC 6803] Length = 398 Score = 38.2 bits (88), Expect = 0.35, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + GLD +YPP+NR L E+I G+ +SE P G Sbjct: 178 LGTGLDLIYPPQNRQLFEQI-AAEGLILSEYPVG 210 >gi|187734950|ref|YP_001877062.1| DNA protecting protein DprA [Akkermansia muciniphila ATCC BAA-835] gi|187425002|gb|ACD04281.1| DNA protecting protein DprA [Akkermansia muciniphila ATCC BAA-835] Length = 375 Score = 38.2 bits (88), Expect = 0.36, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 20/33 (60%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ LYP ENRNL + I D G +SE P Sbjct: 173 IGAGLNKLYPRENRNLAQRIADGHGAVVSEFPM 205 >gi|323136208|ref|ZP_08071290.1| DNA protecting protein DprA [Methylocystis sp. ATCC 49242] gi|322398282|gb|EFY00802.1| DNA protecting protein DprA [Methylocystis sp. ATCC 49242] Length = 424 Score = 38.2 bits (88), Expect = 0.36, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +AGG YP E+ L+EEI G+ +SE+P Sbjct: 175 LAGGQARPYPAEHGRLIEEI-AERGLIVSEMPL 206 >gi|325673466|ref|ZP_08153157.1| DNA protecting protein DprA [Rhodococcus equi ATCC 33707] gi|325555487|gb|EGD25158.1| DNA protecting protein DprA [Rhodococcus equi ATCC 33707] Length = 373 Score = 38.2 bits (88), Expect = 0.37, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +A G+D YP + LL++I G ISE P G Sbjct: 181 LACGVDRAYPAGHGRLLQQI-ARDGAVISEYPPG 213 >gi|312139229|ref|YP_004006565.1| smf family protein [Rhodococcus equi 103S] gi|311888568|emb|CBH47880.1| putative SMF family protein [Rhodococcus equi 103S] Length = 373 Score = 38.2 bits (88), Expect = 0.37, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +A G+D YP + LL++I G ISE P G Sbjct: 181 LACGVDRAYPAGHGRLLQQI-ARDGAVISEYPPG 213 >gi|187935056|ref|YP_001885453.1| DNA uptake protein [Clostridium botulinum B str. Eklund 17B] gi|187723209|gb|ACD24430.1| DNA uptake protein [Clostridium botulinum B str. Eklund 17B] Length = 352 Score = 38.2 bits (88), Expect = 0.37, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YP EN L ++ + G+ ISE P G Sbjct: 168 LGCGIDVVYPSENIALFSKVIKD-GLIISEFPLG 200 >gi|92114982|ref|YP_574910.1| DNA processing protein DprA, putative [Chromohalobacter salexigens DSM 3043] gi|91798072|gb|ABE60211.1| DNA protecting protein DprA [Chromohalobacter salexigens DSM 3043] Length = 371 Score = 38.2 bits (88), Expect = 0.37, Method: Composition-based stats. Identities = 11/32 (34%), Positives = 19/32 (59%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIP 32 + G++ +YPP + L + D GG+ +SE P Sbjct: 177 LGCGVEVIYPPRHAGLYRRLLDEGGLLLSEHP 208 >gi|261856670|ref|YP_003263953.1| DNA protecting protein DprA [Halothiobacillus neapolitanus c2] gi|261837139|gb|ACX96906.1| DNA protecting protein DprA [Halothiobacillus neapolitanus c2] Length = 384 Score = 38.2 bits (88), Expect = 0.37, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 20/34 (58%) Query: 1 [protein fragment, 34 aa] 34 M G D +YP E++ L EI GG+ ISE P G Sbjct: 182 MGTGPDIIYPREHQALAAEIVAQGGLLISEWPPG 215 >gi|262202034|ref|YP_003273242.1| DNA protecting protein DprA [Gordonia bronchialis DSM 43247] gi|262085381|gb|ACY21349.1| DNA protecting protein DprA [Gordonia bronchialis DSM 43247] Length = 374 Score = 38.2 bits (88), Expect = 0.38, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 MA G+D YP + LL EI G ISE P G Sbjct: 183 MACGIDRDYPAAHAQLLREI-ARVGAVISEYPPG 215 >gi|167767275|ref|ZP_02439328.1| hypothetical protein CLOSS21_01794 [Clostridium sp. SS2/1] gi|317497303|ref|ZP_07955626.1| DNA protecting protein DprA [Lachnospiraceae bacterium 5_1_63FAA] gi|167711250|gb|EDS21829.1| hypothetical protein CLOSS21_01794 [Clostridium sp. SS2/1] gi|291559414|emb|CBL38214.1| DNA protecting protein DprA [butyrate-producing bacterium SSC/2] gi|316895372|gb|EFV17531.1| DNA protecting protein DprA [Lachnospiraceae bacterium 5_1_63FAA] Length = 360 Score = 38.2 bits (88), Expect = 0.39, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YP EN L +++ N ISE P G Sbjct: 170 LGCGIDLIYPKENFQLFYDMYANQ-TVISEYPPG 202 >gi|254805838|ref|YP_003084059.1| DNA processing protein DprA [Neisseria meningitidis alpha14] gi|254669380|emb|CBA08516.1| DNA processing protein DprA [Neisseria meningitidis alpha14] Length = 395 Score = 38.2 bits (88), Expect = 0.39, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI G+ +SE P G Sbjct: 180 GIDRIYPPSNKNLAYEI-AEKGLIVSEFPIG 209 >gi|217979954|ref|YP_002364101.1| DNA protecting protein DprA [Methylocella silvestris BL2] gi|217505330|gb|ACK52739.1| DNA protecting protein DprA [Methylocella silvestris BL2] Length = 422 Score = 38.2 bits (88), Expect = 0.40, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGGL +YP + L+E + + G A+SE+PFG Sbjct: 172 LAGGLGNIYPAAHAELVERLIET-GAAVSEMPFG 204 >gi|94266973|ref|ZP_01290622.1| SMF protein [delta proteobacterium MLMS-1] gi|93452328|gb|EAT02959.1| SMF protein [delta proteobacterium MLMS-1] Length = 381 Score = 38.2 bits (88), Expect = 0.40, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%) Query: 1 [protein fragment, 34 aa] 34 + GLD +YPP+NR L I G+ + E P G Sbjct: 176 LGCGLDVVYPPQNRQLFHTIGRQRGLLLGEYPLG 209 >gi|269219630|ref|ZP_06163484.1| DNA protecting protein DprA [Actinomyces sp. oral taxon 848 str. F0332] gi|269210872|gb|EEZ77212.1| DNA protecting protein DprA [Actinomyces sp. oral taxon 848 str. F0332] Length = 468 Score = 38.2 bits (88), Expect = 0.41, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 17/33 (51%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 A G+D YP + +L EI GG SE P G Sbjct: 261 ACGVDRYYPASHADLYLEILRRGGAICSEAPPG 293 >gi|189426316|ref|YP_001953493.1| DNA protecting protein DprA [Geobacter lovleyi SZ] gi|189422575|gb|ACD96973.1| DNA protecting protein DprA [Geobacter lovleyi SZ] Length = 364 Score = 38.2 bits (88), Expect = 0.41, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G+D YPPENR L E+I G ISE P Sbjct: 170 LGCGVDVDYPPENRQLAEQI-SGNGCIISEFPM 201 >gi|257125884|ref|YP_003163998.1| DNA protecting protein DprA [Leptotrichia buccalis C-1013-b] gi|257049823|gb|ACV39007.1| DNA protecting protein DprA [Leptotrichia buccalis C-1013-b] Length = 363 Score = 38.2 bits (88), Expect = 0.41, Method: Composition-based stats. Identities = 17/31 (54%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP ENR+L E I G ISE P G Sbjct: 178 GLDIVYPYENRDLWERI-GEVGTLISEYPLG 207 >gi|120403195|ref|YP_953024.1| transcriptional regulator, TrmB [Mycobacterium vanbaalenii PYR-1] gi|119956013|gb|ABM13018.1| DNA protecting protein DprA [Mycobacterium vanbaalenii PYR-1] Length = 379 Score = 38.2 bits (88), Expect = 0.41, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGG+D YP + LL + G+ +SE P G Sbjct: 180 LAGGIDVPYPAGHSALLHRV-SGSGLLVSEYPPG 212 >gi|206900964|ref|YP_002251236.1| DNA processing protein DprA [Dictyoglomus thermophilum H-6-12] gi|206740067|gb|ACI19125.1| DNA processing protein DprA [Dictyoglomus thermophilum H-6-12] Length = 364 Score = 38.2 bits (88), Expect = 0.42, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + LD +YP N L E I +N G ISE P G Sbjct: 172 LGSSLDHIYPSGNLKLAERIIEN-GAIISEYPLG 204 >gi|329118699|ref|ZP_08247400.1| SMF-family protein [Neisseria bacilliformis ATCC BAA-1200] gi|327465202|gb|EGF11486.1| SMF-family protein [Neisseria bacilliformis ATCC BAA-1200] Length = 422 Score = 38.2 bits (88), Expect = 0.43, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 22/31 (70%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI ++ G+ +SE P G Sbjct: 197 GIDRIYPPSNKNLAYEIAEH-GLIVSEFPLG 226 >gi|262037924|ref|ZP_06011349.1| Smf protein [Leptotrichia goodfellowii F0264] gi|261748067|gb|EEY35481.1| Smf protein [Leptotrichia goodfellowii F0264] Length = 351 Score = 38.2 bits (88), Expect = 0.43, Method: Composition-based stats. Identities = 17/31 (54%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP EN+ L E+I D G+ ISE P G Sbjct: 166 GLDVVYPYENKMLWEKISDT-GMIISEYPLG 195 >gi|94263095|ref|ZP_01286914.1| SMF protein [delta proteobacterium MLMS-1] gi|93456638|gb|EAT06746.1| SMF protein [delta proteobacterium MLMS-1] Length = 381 Score = 38.2 bits (88), Expect = 0.43, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%) Query: 1 [protein fragment, 34 aa] 34 + GLD +YPP+NR L I G+ + E P G Sbjct: 176 LGCGLDVVYPPQNRQLFHTIGRQRGLLLGEYPLG 209 >gi|28572469|ref|NP_789249.1| DNA processing protein [Tropheryma whipplei TW08/27] gi|28410601|emb|CAD66987.1| putative DNA processing protein [Tropheryma whipplei TW08/27] Length = 381 Score = 38.2 bits (88), Expect = 0.43, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGG+D +YP N L +I ++ GI +SE+P G Sbjct: 191 AGGVDWIYPRGNEALFSKICES-GIIVSEMPCG 222 >gi|28493420|ref|NP_787581.1| nucleotide-binding protein [Tropheryma whipplei str. Twist] gi|28476461|gb|AAO44550.1| nucleotide-binding protein [Tropheryma whipplei str. Twist] Length = 399 Score = 38.2 bits (88), Expect = 0.43, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGG+D +YP N L +I ++ GI +SE+P G Sbjct: 209 AGGVDWIYPRGNEALFSKICES-GIIVSEMPCG 240 >gi|269925224|ref|YP_003321847.1| DNA protecting protein DprA [Thermobaculum terrenum ATCC BAA-798] gi|269788884|gb|ACZ41025.1| DNA protecting protein DprA [Thermobaculum terrenum ATCC BAA-798] Length = 365 Score = 37.8 bits (87), Expect = 0.44, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + GLD +YP EN+ L ++I G +SE P G Sbjct: 177 LGSGLDQVYPWENKKLADDIV-RSGALVSEYPLG 209 >gi|206579194|ref|YP_002236312.1| DNA protecting protein DprA [Klebsiella pneumoniae 342] gi|206568252|gb|ACI10028.1| DNA protecting protein DprA [Klebsiella pneumoniae 342] Length = 360 Score = 37.8 bits (87), Expect = 0.44, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 21/33 (63%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ +YP + NL ++I DNGG +SE P Sbjct: 167 LGNGLEQVYPRRHANLAQQIIDNGGTLVSEFPL 199 >gi|309810346|ref|ZP_07704181.1| putative DNA protecting protein DprA [Dermacoccus sp. Ellin185] gi|308435659|gb|EFP59456.1| putative DNA protecting protein DprA [Dermacoccus sp. Ellin185] Length = 283 Score = 37.8 bits (87), Expect = 0.44, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YP + LL +I D G+ +SE+P G Sbjct: 197 LAGGLDRPYPAGHHELLNQIGD-VGLLVSELPPG 229 >gi|161870938|ref|YP_001600118.1| DNA processing chain A [Neisseria meningitidis 053442] gi|161596491|gb|ABX74151.1| DNA processing chain A [Neisseria meningitidis 053442] Length = 395 Score = 37.8 bits (87), Expect = 0.44, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI G+ +SE P G Sbjct: 180 GIDRIYPPSNKNLAYEI-AEKGLIVSEFPIG 209 >gi|229817793|ref|ZP_04448075.1| hypothetical protein BIFANG_03065 [Bifidobacterium angulatum DSM 20098] gi|229785582|gb|EEP21696.1| hypothetical protein BIFANG_03065 [Bifidobacterium angulatum DSM 20098] Length = 461 Score = 37.8 bits (87), Expect = 0.45, Method: Composition-based stats. Identities = 14/30 (46%), Positives = 18/30 (60%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 AGGL+ + P N L E I NGG +SE+ Sbjct: 221 AGGLNHIGPSSNLRLFEAIRANGGALVSEM 250 >gi|169838993|ref|ZP_02872181.1| DNA uptake protein, SMF family [candidate division TM7 single-cell isolate TM7a] Length = 169 Score = 37.8 bits (87), Expect = 0.46, Method: Composition-based stats. Identities = 16/31 (51%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP +NR L E I +N G +SE P G Sbjct: 33 GLDIVYPYDNRGLWERIAEN-GTIVSEYPLG 62 >gi|258653287|ref|YP_003202443.1| DNA protecting protein DprA [Nakamurella multipartita DSM 44233] gi|258556512|gb|ACV79454.1| DNA protecting protein DprA [Nakamurella multipartita DSM 44233] Length = 423 Score = 37.8 bits (87), Expect = 0.46, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +A G+D YP NR+LL ++ G +SE P G Sbjct: 205 LACGIDRAYPEANRDLL-DLIARHGSVVSEYPPG 237 >gi|313887109|ref|ZP_07820805.1| DNA protecting protein DprA [Porphyromonas asaccharolytica PR426713P-I] gi|312923338|gb|EFR34151.1| DNA protecting protein DprA [Porphyromonas asaccharolytica PR426713P-I] Length = 384 Score = 37.8 bits (87), Expect = 0.46, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 21/34 (61%) Query: 1 [protein fragment, 34 aa] 34 +A GL +YP +RNL I ++GG +SE P G Sbjct: 179 LAHGLHMIYPSNHRNLARNIVNHGGALLSEYPAG 212 >gi|218767196|ref|YP_002341708.1| DprA homolog [Neisseria meningitidis Z2491] gi|121051204|emb|CAM07475.1| DprA homolog [Neisseria meningitidis Z2491] Length = 395 Score = 37.8 bits (87), Expect = 0.46, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI G+ +SE P G Sbjct: 180 GIDRIYPPSNKNLAYEI-AEKGLIVSEFPIG 209 >gi|325133183|gb|EGC55854.1| putative DNA processing protein DprA [Neisseria meningitidis M6190] Length = 395 Score = 37.8 bits (87), Expect = 0.47, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI G+ +SE P G Sbjct: 180 GIDRIYPPSNKNLAYEI-AEKGLIVSEFPIG 209 >gi|323705454|ref|ZP_08117029.1| DNA protecting protein DprA [Thermoanaerobacterium xylanolyticum LX-11] gi|323535356|gb|EGB25132.1| DNA protecting protein DprA [Thermoanaerobacterium xylanolyticum LX-11] Length = 362 Score = 37.8 bits (87), Expect = 0.47, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G++ YP EN+ L+EEI G +SE P Sbjct: 171 LGCGVNIAYPEENKKLMEEIIS-KGAVVSEYPL 202 >gi|302342564|ref|YP_003807093.1| DNA protecting protein DprA [Desulfarculus baarsii DSM 2075] gi|301639177|gb|ADK84499.1| DNA protecting protein DprA [Desulfarculus baarsii DSM 2075] Length = 376 Score = 37.8 bits (87), Expect = 0.47, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + GLD YPPE+ L+E + G +SE P G Sbjct: 183 LGCGLDVAYPPEHAGLIERM-AGQGAVVSEFPMG 215 >gi|288922424|ref|ZP_06416612.1| DNA protecting protein DprA [Frankia sp. EUN1f] gi|288346227|gb|EFC80568.1| DNA protecting protein DprA [Frankia sp. EUN1f] Length = 383 Score = 37.8 bits (87), Expect = 0.47, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGG+D YP + +LL+EI G+ +SE P G Sbjct: 171 LAGGVDVPYPAAHADLLDEI-AASGLVLSETPPG 203 >gi|313667412|ref|YP_004047696.1| SMF-family protein [Neisseria lactamica ST-640] gi|313004874|emb|CBN86300.1| SMF-family protein [Neisseria lactamica 020-06] Length = 395 Score = 37.8 bits (87), Expect = 0.48, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI G+ +SE P G Sbjct: 180 GIDRIYPPANKNLAYEI-AEKGLIVSEFPIG 209 >gi|304388917|ref|ZP_07370964.1| DNA protecting protein DprA [Neisseria meningitidis ATCC 13091] gi|304337051|gb|EFM03238.1| DNA protecting protein DprA [Neisseria meningitidis ATCC 13091] Length = 395 Score = 37.8 bits (87), Expect = 0.48, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI G+ +SE P G Sbjct: 180 GIDRIYPPSNKNLAYEI-AEKGLIVSEFPIG 209 >gi|253579631|ref|ZP_04856900.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39B_FAA] gi|251849132|gb|EES77093.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39BFAA] Length = 305 Score = 37.8 bits (87), Expect = 0.48, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 17/34 (50%) Query: 1 [protein fragment, 34 aa] 34 + G+D YP NR L E I G ISE P G Sbjct: 114 LGSGVDVCYPKSNRKLYERILWENGGIISECPLG 147 >gi|254671143|emb|CBA08189.1| DNA processing chain A [Neisseria meningitidis alpha153] Length = 395 Score = 37.8 bits (87), Expect = 0.48, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI G+ +SE P G Sbjct: 180 GIDRIYPPSNKNLAYEI-AEKGLIVSEFPIG 209 >gi|261378982|ref|ZP_05983555.1| putative DNA processing protein DprA [Neisseria cinerea ATCC 14685] gi|269144597|gb|EEZ71015.1| putative DNA processing protein DprA [Neisseria cinerea ATCC 14685] Length = 397 Score = 37.8 bits (87), Expect = 0.48, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI G+ +SE P G Sbjct: 180 GIDRIYPPSNKNLAYEI-AEKGLIVSEFPIG 209 >gi|85705143|ref|ZP_01036243.1| DNA processing protein DprA, putative [Roseovarius sp. 217] gi|85670465|gb|EAQ25326.1| DNA processing protein DprA, putative [Roseovarius sp. 217] Length = 342 Score = 37.8 bits (87), Expect = 0.49, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 MAGG+D +YP EN L +I N G+ +SE P G Sbjct: 139 MAGGVDVIYPAENSKLASDILAN-GLRLSEQPIG 171 >gi|124516263|gb|EAY57771.1| DNA processing protein DprA [Leptospirillum rubarum] Length = 306 Score = 37.8 bits (87), Expect = 0.49, Method: Composition-based stats. Identities = 16/31 (51%), Positives = 19/31 (61%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP +R L EEI GG +SE P G Sbjct: 179 GLDRVYPDFHRALAEEILAKGGGIVSEFPPG 209 >gi|332976017|gb|EGK12888.1| DNA processing chain A [Psychrobacter sp. 1501(2011)] Length = 434 Score = 37.8 bits (87), Expect = 0.50, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 19/34 (55%) Query: 1 [protein fragment, 34 aa] 34 M G+D YP +R L E I + GG ISE+ G Sbjct: 190 MGTGIDVYYPVPHRALFERIINEGGCIISELLPG 223 >gi|291456570|ref|ZP_06595960.1| putative DNA protecting protein DprA [Bifidobacterium breve DSM 20213] gi|291381847|gb|EFE89365.1| putative DNA protecting protein DprA [Bifidobacterium breve DSM 20213] Length = 539 Score = 37.8 bits (87), Expect = 0.50, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 19/33 (57%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGGL+ + P NR L E I GG ISE+ G Sbjct: 261 AGGLNHMGPARNRTLFERIESQGGALISELCPG 293 >gi|261337239|ref|ZP_05965123.1| DNA protecting protein DprA [Bifidobacterium gallicum DSM 20093] gi|270277595|gb|EFA23449.1| DNA protecting protein DprA [Bifidobacterium gallicum DSM 20093] Length = 481 Score = 37.8 bits (87), Expect = 0.50, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 17/32 (53%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 AGGL+ + P N L E I G ISE+P Sbjct: 275 AGGLNHIGPSTNARLFEHIQTWHGALISEMPP 306 >gi|282854572|ref|ZP_06263907.1| DNA protecting protein DprA [Propionibacterium acnes J139] gi|282582154|gb|EFB87536.1| DNA protecting protein DprA [Propionibacterium acnes J139] gi|314981836|gb|EFT25929.1| DNA protecting protein DprA [Propionibacterium acnes HL110PA3] gi|315090701|gb|EFT62677.1| DNA protecting protein DprA [Propionibacterium acnes HL110PA4] Length = 377 Score = 37.8 bits (87), Expect = 0.50, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +A GLD LYP N +LE+I G ISE+P G Sbjct: 178 LACGLDTLYPRGNSAVLEQI-AGTGALISELPPG 210 >gi|261391654|emb|CAX49102.1| Smf protein (DNA processing chain A) [Neisseria meningitidis 8013] Length = 395 Score = 37.8 bits (87), Expect = 0.50, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI G+ +SE P G Sbjct: 180 GIDRIYPPSNKNLAYEI-AEKGLIVSEFPIG 209 >gi|319411401|emb|CBY91812.1| Smf protein (DNA processing chain A) [Neisseria meningitidis WUE 2594] Length = 395 Score = 37.8 bits (87), Expect = 0.51, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI G+ +SE P G Sbjct: 180 GIDRIYPPSNKNLAYEI-AEKGLIVSEFPIG 209 >gi|153005554|ref|YP_001379879.1| DNA protecting protein DprA [Anaeromyxobacter sp. Fw109-5] gi|152029127|gb|ABS26895.1| DNA protecting protein DprA [Anaeromyxobacter sp. Fw109-5] Length = 287 Score = 37.8 bits (87), Expect = 0.51, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 22/34 (64%) Query: 1 [protein fragment, 34 aa] 34 + G+D LYP NR LLE + + GG +SE+P G Sbjct: 97 LGTGVDVLYPASNRALLERVLEQGGAILSELPDG 130 >gi|94970368|ref|YP_592416.1| DNA processing protein DprA, putative [Candidatus Koribacter versatilis Ellin345] gi|94552418|gb|ABF42342.1| DNA protecting protein DprA [Candidatus Koribacter versatilis Ellin345] Length = 385 Score = 37.8 bits (87), Expect = 0.51, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 20/31 (64%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP N+ L E+I + GG ISE P G Sbjct: 182 GVDEIYPRANKKLAEQIVEFGGALISEFPTG 212 >gi|308388334|gb|ADO30654.1| SMF-family protein [Neisseria meningitidis alpha710] gi|325131151|gb|EGC53872.1| putative DNA processing protein DprA [Neisseria meningitidis OX99.30304] gi|325137175|gb|EGC59770.1| putative DNA processing protein DprA [Neisseria meningitidis M0579] gi|325203049|gb|ADY98503.1| putative DNA processing protein DprA [Neisseria meningitidis M01-240149] gi|325207153|gb|ADZ02605.1| putative DNA processing protein DprA [Neisseria meningitidis NZ-05/33] Length = 395 Score = 37.8 bits (87), Expect = 0.53, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI G+ +SE P G Sbjct: 180 GIDRIYPPSNKNLAYEI-AEKGLIVSEFPIG 209 >gi|254420463|ref|ZP_05034187.1| DNA protecting protein DprA, putative [Brevundimonas sp. BAL3] gi|196186640|gb|EDX81616.1| DNA protecting protein DprA, putative [Brevundimonas sp. BAL3] Length = 356 Score = 37.8 bits (87), Expect = 0.53, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + GG+D +YPPE+ +L + D G +SE P G Sbjct: 166 LGGGVDDIYPPEHADLYARLVDQ-GCVVSESPVG 198 >gi|296315164|ref|ZP_06865105.1| putative DNA processing protein DprA [Neisseria polysaccharea ATCC 43768] gi|296837973|gb|EFH21911.1| putative DNA processing protein DprA [Neisseria polysaccharea ATCC 43768] Length = 397 Score = 37.8 bits (87), Expect = 0.53, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI G+ +SE P G Sbjct: 180 GIDRIYPPSNKNLAYEI-AEKGLIVSEFPIG 209 >gi|296133059|ref|YP_003640306.1| transcriptional regulator, MarR family [Thermincola sp. JR] gi|296031637|gb|ADG82405.1| transcriptional regulator, MarR family [Thermincola potens JR] Length = 359 Score = 37.8 bits (87), Expect = 0.54, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YP ENR L++ I + G +SE P G Sbjct: 172 LGTGVDIVYPRENRRLMDNIITH-GAVVSEFPPG 204 >gi|325197405|gb|ADY92861.1| putative DNA processing protein DprA [Neisseria meningitidis G2136] Length = 395 Score = 37.8 bits (87), Expect = 0.54, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI G+ +SE P G Sbjct: 180 GIDRIYPPSNKNLAYEI-AEKGLIVSEFPIG 209 >gi|226306022|ref|YP_002765982.1| DNA processing protein [Rhodococcus erythropolis PR4] gi|226185139|dbj|BAH33243.1| putative DNA processing protein [Rhodococcus erythropolis PR4] Length = 375 Score = 37.8 bits (87), Expect = 0.54, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +A G+D YP + LL++I + G ISE P G Sbjct: 181 LACGVDRAYPSGHARLLKQIASS-GAVISEYPPG 213 >gi|325203235|gb|ADY98688.1| putative DNA processing protein DprA [Neisseria meningitidis M01-240355] Length = 395 Score = 37.8 bits (87), Expect = 0.55, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI G+ +SE P G Sbjct: 180 GIDRIYPPSNKNLAYEI-AEKGLIVSEFPIG 209 >gi|317050447|ref|YP_004111563.1| DNA protecting protein DprA [Desulfurispirillum indicum S5] gi|316945531|gb|ADU65007.1| DNA protecting protein DprA [Desulfurispirillum indicum S5] Length = 354 Score = 37.8 bits (87), Expect = 0.55, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 20/34 (58%) Query: 1 [protein fragment, 34 aa] 34 M G++ +YP NR L ++I + GG I+E G Sbjct: 156 MGCGIERVYPAGNRRLAQQIVNQGGAVITEFAPG 189 >gi|254672820|emb|CBA06971.1| DNA processing chain A [Neisseria meningitidis alpha275] Length = 395 Score = 37.8 bits (87), Expect = 0.55, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI G+ +SE P G Sbjct: 180 GIDRIYPPSNKNLAYEI-AEKGLIVSEFPIG 209 >gi|307243657|ref|ZP_07525798.1| DNA protecting protein DprA [Peptostreptococcus stomatis DSM 17678] gi|306492967|gb|EFM64979.1| DNA protecting protein DprA [Peptostreptococcus stomatis DSM 17678] Length = 418 Score = 37.8 bits (87), Expect = 0.55, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 20/34 (58%) Query: 1 [protein fragment, 34 aa] 34 M +D +YP N NL +EI D GG+ +SE G Sbjct: 202 MGTSIDNIYPRSNTNLFKEILDQGGLILSETGPG 235 >gi|160947178|ref|ZP_02094345.1| hypothetical protein PEPMIC_01111 [Parvimonas micra ATCC 33270] gi|158446312|gb|EDP23307.1| hypothetical protein PEPMIC_01111 [Parvimonas micra ATCC 33270] Length = 364 Score = 37.8 bits (87), Expect = 0.55, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D YP N L +EI +N G +SE P G Sbjct: 173 LGCGVDIAYPKTNYRLYDEIIEN-GAVMSEFPIG 205 >gi|294084185|ref|YP_003550943.1| DNA protecting protein DprA [Candidatus Puniceispirillum marinum IMCC1322] gi|292663758|gb|ADE38859.1| DNA protecting protein DprA [Candidatus Puniceispirillum marinum IMCC1322] Length = 367 Score = 37.8 bits (87), Expect = 0.57, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +A G+D +YP EN +L + I + G+ ++E+P G Sbjct: 164 IASGIDLVYPQENADLFDSIIER-GLLLAEMPPG 196 >gi|255067823|ref|ZP_05319678.1| DNA processing protein DprA [Neisseria sicca ATCC 29256] gi|255047914|gb|EET43378.1| DNA processing protein DprA [Neisseria sicca ATCC 29256] Length = 403 Score = 37.5 bits (86), Expect = 0.60, Method: Composition-based stats. Identities = 14/30 (46%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 G+D +YPP N+NL EI G+ +SE P Sbjct: 180 GIDRIYPPSNKNLAYEI-AEKGLIVSEFPL 208 >gi|91763089|ref|ZP_01265053.1| DNA processing chain A [Candidatus Pelagibacter ubique HTCC1002] gi|91717502|gb|EAS84153.1| DNA processing chain A [Candidatus Pelagibacter ubique HTCC1002] Length = 306 Score = 37.5 bits (86), Expect = 0.61, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +A GLD +YP ENR L + I N GI ++E FG Sbjct: 190 LANGLDTIYPSENRELAKNIL-NKGILLTEYTFG 222 >gi|73748517|ref|YP_307756.1| putative DNA processing protein DprA [Dehalococcoides sp. CBDB1] gi|73660233|emb|CAI82840.1| putative DNA processing protein DprA [Dehalococcoides sp. CBDB1] Length = 383 Score = 37.5 bits (86), Expect = 0.62, Method: Composition-based stats. Identities = 16/32 (50%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Query: 3 GGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP EN +L +I +N G ISE P G Sbjct: 185 CGLDIIYPSENHSLARQIAEN-GALISEHPPG 215 >gi|308188322|ref|YP_003932453.1| Protein smf [Pantoea vagans C9-1] gi|308058832|gb|ADO11004.1| Protein smf [Pantoea vagans C9-1] Length = 374 Score = 37.5 bits (86), Expect = 0.63, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 16/33 (48%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL LYP + L EI GG +SE P Sbjct: 167 LGSGLQHLYPKNHTRLAAEIVGQGGAIVSEFPL 199 >gi|325135225|gb|EGC57850.1| putative DNA processing protein DprA [Neisseria meningitidis M13399] Length = 397 Score = 37.5 bits (86), Expect = 0.63, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI G+ +SE P G Sbjct: 180 GIDRIYPPSNKNLAYEI-AEKGLIVSEFPIG 209 >gi|156932269|ref|YP_001436185.1| DNA protecting protein DprA [Cronobacter sakazakii ATCC BAA-894] gi|156530523|gb|ABU75349.1| hypothetical protein ESA_00040 [Cronobacter sakazakii ATCC BAA-894] Length = 370 Score = 37.5 bits (86), Expect = 0.64, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 20/33 (60%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP +R L EEI + GG +SE PF Sbjct: 167 LGNGLAQVYPTRHRKLAEEIVERGGALVSEFPF 199 >gi|229491474|ref|ZP_04385298.1| transcriptional regulator, TrmB [Rhodococcus erythropolis SK121] gi|229321759|gb|EEN87556.1| transcriptional regulator, TrmB [Rhodococcus erythropolis SK121] Length = 375 Score = 37.5 bits (86), Expect = 0.64, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +A G+D YP + LL++I + G ISE P G Sbjct: 181 LACGVDRAYPSGHARLLKQIASS-GAVISEYPPG 213 >gi|190151041|ref|YP_001969566.1| protein smf (DNA-processing chain A) [Actinobacillus pleuropneumoniae serovar 7 str. AP76] gi|307264403|ref|ZP_07545989.1| hypothetical protein appser13_17940 [Actinobacillus pleuropneumoniae serovar 13 str. N273] gi|189916172|gb|ACE62424.1| Protein smf (DNA-processing chain A) [Actinobacillus pleuropneumoniae serovar 7 str. AP76] gi|306870219|gb|EFN01977.1| hypothetical protein appser13_17940 [Actinobacillus pleuropneumoniae serovar 13 str. N273] Length = 384 Score = 37.5 bits (86), Expect = 0.64, Method: Composition-based stats. Identities = 12/30 (40%), Positives = 20/30 (66%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISE 30 + GLD +YP ++ L E+I ++GG +SE Sbjct: 168 LGSGLDQVYPARHKKLAEQIVESGGALVSE 197 >gi|32035463|ref|ZP_00135424.1| COG0758: Predicted Rossmann fold nucleotide-binding protein involved in DNA uptake [Actinobacillus pleuropneumoniae serovar 1 str. 4074] gi|126209176|ref|YP_001054401.1| protein smf (DNA-processing chain A) [Actinobacillus pleuropneumoniae L20] gi|126097968|gb|ABN74796.1| Protein smf (DNA-processing chain A) [Actinobacillus pleuropneumoniae serovar 5b str. L20] Length = 384 Score = 37.5 bits (86), Expect = 0.64, Method: Composition-based stats. Identities = 12/30 (40%), Positives = 20/30 (66%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISE 30 + GLD +YP ++ L E+I ++GG +SE Sbjct: 168 LGSGLDQVYPARHKKLAEQIVESGGALVSE 197 >gi|332799163|ref|YP_004460662.1| DNA protecting protein DprA [Tepidanaerobacter sp. Re1] gi|332696898|gb|AEE91355.1| DNA protecting protein DprA [Tepidanaerobacter sp. Re1] Length = 364 Score = 37.5 bits (86), Expect = 0.65, Method: Composition-based stats. Identities = 15/32 (46%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Query: 3 GGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPPEN +L++EI G IS P G Sbjct: 174 CGIDIIYPPENISLMKEIL-KCGCVISSFPLG 204 >gi|289432565|ref|YP_003462438.1| DNA protecting protein DprA [Dehalococcoides sp. GT] gi|288946285|gb|ADC73982.1| DNA protecting protein DprA [Dehalococcoides sp. GT] Length = 373 Score = 37.5 bits (86), Expect = 0.65, Method: Composition-based stats. Identities = 16/32 (50%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Query: 3 GGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP EN +L +I +N G ISE P G Sbjct: 175 CGLDIIYPSENHSLARQIAEN-GALISEHPPG 205 >gi|317049805|ref|YP_004117453.1| DNA protecting protein DprA [Pantoea sp. At-9b] gi|316951422|gb|ADU70897.1| DNA protecting protein DprA [Pantoea sp. At-9b] Length = 374 Score = 37.5 bits (86), Expect = 0.65, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL LYP ++ L +EI N G +SE P Sbjct: 167 LGSGLKHLYPKIHQKLAQEIISNDGALVSEFPL 199 >gi|225568716|ref|ZP_03777741.1| hypothetical protein CLOHYLEM_04795 [Clostridium hylemonae DSM 15053] gi|225162215|gb|EEG74834.1| hypothetical protein CLOHYLEM_04795 [Clostridium hylemonae DSM 15053] Length = 362 Score = 37.5 bits (86), Expect = 0.65, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D YP E+ L +I +GG +SE P G Sbjct: 171 LGCGVDVCYPREHIGLYMDIQKHGG-ILSEYPPG 203 >gi|325145438|gb|EGC67714.1| putative DNA processing protein DprA [Neisseria meningitidis M01-240013] gi|325205209|gb|ADZ00662.1| putative DNA processing protein DprA [Neisseria meningitidis M04-240196] Length = 397 Score = 37.5 bits (86), Expect = 0.65, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI G+ +SE P G Sbjct: 180 GIDRIYPPSNKNLAYEI-AEKGLIVSEFPIG 209 >gi|240129161|ref|ZP_04741822.1| DprA [Neisseria gonorrhoeae SK-93-1035] gi|268687544|ref|ZP_06154406.1| DNA processing chain A [Neisseria gonorrhoeae SK-93-1035] gi|268627828|gb|EEZ60228.1| DNA processing chain A [Neisseria gonorrhoeae SK-93-1035] Length = 398 Score = 37.5 bits (86), Expect = 0.66, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI G+ +SE P G Sbjct: 183 GIDRIYPPANKNLAYEI-AEKGLIVSEFPIG 212 >gi|240118948|ref|ZP_04733010.1| DprA [Neisseria gonorrhoeae PID1] Length = 398 Score = 37.5 bits (86), Expect = 0.66, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI G+ +SE P G Sbjct: 183 GIDRIYPPANKNLAYEI-AEKGLIVSEFPIG 212 >gi|240081714|ref|ZP_04726257.1| DprA [Neisseria gonorrhoeae FA19] gi|268597812|ref|ZP_06131979.1| DNA processing chain A [Neisseria gonorrhoeae FA19] gi|268604659|ref|ZP_06138826.1| DNA processing chain A [Neisseria gonorrhoeae PID1] gi|268551600|gb|EEZ46619.1| DNA processing chain A [Neisseria gonorrhoeae FA19] gi|268588790|gb|EEZ53466.1| DNA processing chain A [Neisseria gonorrhoeae PID1] Length = 395 Score = 37.5 bits (86), Expect = 0.66, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI G+ +SE P G Sbjct: 180 GIDRIYPPANKNLAYEI-AEKGLIVSEFPIG 209 >gi|165977147|ref|YP_001652740.1| Smf protein [Actinobacillus pleuropneumoniae serovar 3 str. JL03] gi|165877248|gb|ABY70296.1| Smf protein [Actinobacillus pleuropneumoniae serovar 3 str. JL03] Length = 384 Score = 37.5 bits (86), Expect = 0.66, Method: Composition-based stats. Identities = 12/30 (40%), Positives = 20/30 (66%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISE 30 + GLD +YP ++ L E+I ++GG +SE Sbjct: 168 LGSGLDQVYPARHKKLAEQIVESGGALVSE 197 >gi|149915652|ref|ZP_01904178.1| DNA processing protein DprA, putative [Roseobacter sp. AzwK-3b] gi|149810544|gb|EDM70387.1| DNA processing protein DprA, putative [Roseobacter sp. AzwK-3b] Length = 357 Score = 37.5 bits (86), Expect = 0.66, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 MAGG+D YP EN L ++I G+ +SE P G Sbjct: 155 MAGGVDVPYPAENARLADDI-TRSGLRLSEQPMG 187 >gi|59802185|ref|YP_208897.1| hypothetical protein NGO1865 [Neisseria gonorrhoeae FA 1090] gi|293398230|ref|ZP_06642435.1| DNA processing protein [Neisseria gonorrhoeae F62] gi|59719080|gb|AAW90485.1| putative DNA processing chain A [Neisseria gonorrhoeae FA 1090] gi|291611493|gb|EFF40563.1| DNA processing protein [Neisseria gonorrhoeae F62] Length = 395 Score = 37.5 bits (86), Expect = 0.66, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI G+ +SE P G Sbjct: 180 GIDRIYPPANKNLAYEI-AEKGLIVSEFPIG 209 >gi|307246636|ref|ZP_07528707.1| hypothetical protein appser1_18320 [Actinobacillus pleuropneumoniae serovar 1 str. 4074] gi|307251006|ref|ZP_07532931.1| hypothetical protein appser4_17690 [Actinobacillus pleuropneumoniae serovar 4 str. M62] gi|307255621|ref|ZP_07537426.1| hypothetical protein appser9_18460 [Actinobacillus pleuropneumoniae serovar 9 str. CVJ13261] gi|307260072|ref|ZP_07541784.1| hypothetical protein appser11_18580 [Actinobacillus pleuropneumoniae serovar 11 str. 56153] gi|306852508|gb|EFM84742.1| hypothetical protein appser1_18320 [Actinobacillus pleuropneumoniae serovar 1 str. 4074] gi|306856946|gb|EFM89077.1| hypothetical protein appser4_17690 [Actinobacillus pleuropneumoniae serovar 4 str. M62] gi|306861470|gb|EFM93459.1| hypothetical protein appser9_18460 [Actinobacillus pleuropneumoniae serovar 9 str. CVJ13261] gi|306865908|gb|EFM97784.1| hypothetical protein appser11_18580 [Actinobacillus pleuropneumoniae serovar 11 str. 56153] Length = 384 Score = 37.5 bits (86), Expect = 0.67, Method: Composition-based stats. Identities = 12/30 (40%), Positives = 20/30 (66%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISE 30 + GLD +YP ++ L E+I ++GG +SE Sbjct: 168 LGSGLDQVYPARHKKLAEQIVESGGALVSE 197 >gi|288575792|ref|ZP_06393972.1| DNA protecting protein DprA [Neisseria mucosa ATCC 25996] gi|288566999|gb|EFC88559.1| DNA protecting protein DprA [Neisseria mucosa ATCC 25996] Length = 355 Score = 37.5 bits (86), Expect = 0.67, Method: Composition-based stats. Identities = 14/30 (46%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 G+D +YPP N+NL EI G+ +SE P Sbjct: 180 GIDRIYPPSNKNLAYEI-AEKGLIVSEFPL 208 >gi|325963549|ref|YP_004241455.1| DNA protecting protein DprA [Arthrobacter phenanthrenivorans Sphe3] gi|323469636|gb|ADX73321.1| DNA protecting protein DprA [Arthrobacter phenanthrenivorans Sphe3] Length = 343 Score = 37.5 bits (86), Expect = 0.67, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 MA G+D YP +R LLE + D G+ +SE+P G Sbjct: 185 MANGVDRPYPMGHRELLERVAD-LGLMVSEVPPG 217 >gi|303249954|ref|ZP_07336156.1| protein smf (DNA-processing chain A) [Actinobacillus pleuropneumoniae serovar 6 str. Femo] gi|303253126|ref|ZP_07339275.1| protein smf (DNA-processing chain A) [Actinobacillus pleuropneumoniae serovar 2 str. 4226] gi|307248764|ref|ZP_07530777.1| hypothetical protein appser2_17300 [Actinobacillus pleuropneumoniae serovar 2 str. S1536] gi|307253383|ref|ZP_07535254.1| hypothetical protein appser6_18770 [Actinobacillus pleuropneumoniae serovar 6 str. Femo] gi|307262202|ref|ZP_07543852.1| hypothetical protein appser12_17470 [Actinobacillus pleuropneumoniae serovar 12 str. 1096] gi|302647808|gb|EFL78015.1| protein smf (DNA-processing chain A) [Actinobacillus pleuropneumoniae serovar 2 str. 4226] gi|302651017|gb|EFL81171.1| protein smf (DNA-processing chain A) [Actinobacillus pleuropneumoniae serovar 6 str. Femo] gi|306854691|gb|EFM86881.1| hypothetical protein appser2_17300 [Actinobacillus pleuropneumoniae serovar 2 str. S1536] gi|306859062|gb|EFM91104.1| hypothetical protein appser6_18770 [Actinobacillus pleuropneumoniae serovar 6 str. Femo] gi|306868076|gb|EFM99902.1| hypothetical protein appser12_17470 [Actinobacillus pleuropneumoniae serovar 12 str. 1096] Length = 384 Score = 37.5 bits (86), Expect = 0.67, Method: Composition-based stats. Identities = 12/30 (40%), Positives = 20/30 (66%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISE 30 + GLD +YP ++ L E+I ++GG +SE Sbjct: 168 LGSGLDQVYPARHKKLAEQIVESGGALVSE 197 >gi|240116726|ref|ZP_04730788.1| DprA [Neisseria gonorrhoeae PID18] gi|268602397|ref|ZP_06136564.1| DNA processing chain A [Neisseria gonorrhoeae PID18] gi|268586528|gb|EEZ51204.1| DNA processing chain A [Neisseria gonorrhoeae PID18] Length = 398 Score = 37.5 bits (86), Expect = 0.69, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI G+ +SE P G Sbjct: 183 GIDRIYPPANKNLAYEI-AEKGLIVSEFPIG 212 >gi|194099892|ref|YP_002003029.1| DprA [Neisseria gonorrhoeae NCCP11945] gi|240015122|ref|ZP_04722035.1| DprA [Neisseria gonorrhoeae DGI18] gi|240017572|ref|ZP_04724112.1| DprA [Neisseria gonorrhoeae FA6140] gi|240113990|ref|ZP_04728480.1| DprA [Neisseria gonorrhoeae MS11] gi|240122193|ref|ZP_04735155.1| DprA [Neisseria gonorrhoeae PID24-1] gi|268600055|ref|ZP_06134222.1| DNA processing chain A [Neisseria gonorrhoeae MS11] gi|193935182|gb|ACF31006.1| DprA [Neisseria gonorrhoeae NCCP11945] gi|268584186|gb|EEZ48862.1| DNA processing chain A [Neisseria gonorrhoeae MS11] Length = 398 Score = 37.5 bits (86), Expect = 0.69, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI G+ +SE P G Sbjct: 183 GIDRIYPPANKNLAYEI-AEKGLIVSEFPIG 212 >gi|254494747|ref|ZP_05107918.1| DNA processing chain A [Neisseria gonorrhoeae 1291] gi|226513787|gb|EEH63132.1| DNA processing chain A [Neisseria gonorrhoeae 1291] Length = 395 Score = 37.5 bits (86), Expect = 0.69, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI G+ +SE P G Sbjct: 180 GIDRIYPPANKNLAYEI-AEKGLIVSEFPIG 209 >gi|119960903|ref|YP_948169.1| DNA protecting protein DprA [Arthrobacter aurescens TC1] gi|119947762|gb|ABM06673.1| DNA protecting protein DprA [Arthrobacter aurescens TC1] Length = 411 Score = 37.5 bits (86), Expect = 0.70, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 MAGG+D YP N +LL + G ISE+P G Sbjct: 214 MAGGVDRFYPSGNEDLLRAVATQ-GAVISEVPPG 246 >gi|325138795|gb|EGC61347.1| putative DNA processing protein DprA [Neisseria meningitidis ES14902] Length = 395 Score = 37.5 bits (86), Expect = 0.70, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI G+ +SE P G Sbjct: 180 GIDRIYPPANKNLAYEI-AEKGLIVSEFPIG 209 >gi|260439513|ref|ZP_05793329.1| DprA [Neisseria gonorrhoeae DGI2] gi|291042750|ref|ZP_06568491.1| DNA protecting protein DprA [Neisseria gonorrhoeae DGI2] gi|291013184|gb|EFE05150.1| DNA protecting protein DprA [Neisseria gonorrhoeae DGI2] Length = 395 Score = 37.5 bits (86), Expect = 0.70, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI G+ +SE P G Sbjct: 180 GIDRIYPPANKNLAYEI-AEKGLIVSEFPIG 209 >gi|239917443|ref|YP_002957001.1| DNA protecting protein DprA [Micrococcus luteus NCTC 2665] gi|239838650|gb|ACS30447.1| DNA protecting protein DprA [Micrococcus luteus NCTC 2665] Length = 424 Score = 37.5 bits (86), Expect = 0.70, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YP + +LL + G+ +SE+P G Sbjct: 222 LAGGLDRFYPAGHEDLLRAVMA-AGLLVSEMPPG 254 >gi|240124645|ref|ZP_04737531.1| DprA [Neisseria gonorrhoeae SK-92-679] gi|268683219|ref|ZP_06150081.1| DNA processing chain A [Neisseria gonorrhoeae SK-92-679] gi|268623503|gb|EEZ55903.1| DNA processing chain A [Neisseria gonorrhoeae SK-92-679] Length = 397 Score = 37.5 bits (86), Expect = 0.71, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI G+ +SE P G Sbjct: 183 GIDRIYPPANKNLAYEI-AEKGLIVSEFPIG 212 >gi|239997897|ref|ZP_04717821.1| DprA [Neisseria gonorrhoeae 35/02] Length = 398 Score = 37.5 bits (86), Expect = 0.71, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI G+ +SE P G Sbjct: 183 GIDRIYPPANKNLAYEI-AEKGLIVSEFPIG 212 >gi|240124486|ref|ZP_04737442.1| DprA [Neisseria gonorrhoeae PID332] gi|317165352|gb|ADV08893.1| DprA [Neisseria gonorrhoeae TCDC-NG08107] Length = 398 Score = 37.5 bits (86), Expect = 0.72, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI G+ +SE P G Sbjct: 183 GIDRIYPPANKNLAYEI-AEKGLIVSEFPIG 212 >gi|212716957|ref|ZP_03325085.1| hypothetical protein BIFCAT_01903 [Bifidobacterium catenulatum DSM 16992] gi|212660242|gb|EEB20817.1| hypothetical protein BIFCAT_01903 [Bifidobacterium catenulatum DSM 16992] Length = 455 Score = 37.5 bits (86), Expect = 0.72, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 18/33 (54%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGGL+ + P N L E I + G ISE+ G Sbjct: 237 AGGLNHIGPKSNERLFETIISHSGALISELCPG 269 >gi|268593749|ref|ZP_06127916.1| DNA processing chain A [Neisseria gonorrhoeae 35/02] gi|268547138|gb|EEZ42556.1| DNA processing chain A [Neisseria gonorrhoeae 35/02] Length = 395 Score = 37.5 bits (86), Expect = 0.72, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI G+ +SE P G Sbjct: 180 GIDRIYPPANKNLAYEI-AEKGLIVSEFPIG 209 >gi|322513217|ref|ZP_08066343.1| DNA-processing protein Smf [Actinobacillus ureae ATCC 25976] gi|322120993|gb|EFX92834.1| DNA-processing protein Smf [Actinobacillus ureae ATCC 25976] Length = 384 Score = 37.5 bits (86), Expect = 0.73, Method: Composition-based stats. Identities = 12/30 (40%), Positives = 20/30 (66%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISE 30 + GLD +YP ++ L E+I ++GG +SE Sbjct: 168 LGSGLDQVYPARHKKLAEQIVESGGALVSE 197 >gi|307822753|ref|ZP_07652984.1| DNA protecting protein DprA [Methylobacter tundripaludum SV96] gi|307736357|gb|EFO07203.1| DNA protecting protein DprA [Methylobacter tundripaludum SV96] Length = 350 Score = 37.5 bits (86), Expect = 0.73, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP +++L EI N G ISE P G Sbjct: 162 GLDRVYPARHKDLATEIV-NTGAMISEFPPG 191 >gi|268683117|ref|ZP_06149979.1| DNA processing chain A [Neisseria gonorrhoeae PID332] gi|268623401|gb|EEZ55801.1| DNA processing chain A [Neisseria gonorrhoeae PID332] Length = 395 Score = 37.5 bits (86), Expect = 0.73, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI G+ +SE P G Sbjct: 180 GIDRIYPPANKNLAYEI-AEKGLIVSEFPIG 209 >gi|307257797|ref|ZP_07539554.1| hypothetical protein appser10_17820 [Actinobacillus pleuropneumoniae serovar 10 str. D13039] gi|306863703|gb|EFM95629.1| hypothetical protein appser10_17820 [Actinobacillus pleuropneumoniae serovar 10 str. D13039] Length = 384 Score = 37.5 bits (86), Expect = 0.74, Method: Composition-based stats. Identities = 12/30 (40%), Positives = 20/30 (66%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISE 30 + GLD +YP ++ L E+I ++GG +SE Sbjct: 168 LGSGLDQVYPARHKKLAEQIVESGGALVSE 197 >gi|206603104|gb|EDZ39584.1| DNA processing protein DprA [Leptospirillum sp. Group II '5-way CG'] Length = 306 Score = 37.5 bits (86), Expect = 0.74, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 18/31 (58%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP +R L EI GG +SE P G Sbjct: 179 GLDRVYPDFHRTLAGEILSGGGCIVSEFPPG 209 >gi|297617128|ref|YP_003702287.1| DNA protecting protein DprA [Syntrophothermus lipocalidus DSM 12680] gi|297144965|gb|ADI01722.1| DNA protecting protein DprA [Syntrophothermus lipocalidus DSM 12680] Length = 366 Score = 37.5 bits (86), Expect = 0.75, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YP EN+ L I G+ +SE P G Sbjct: 173 LGSGIDVVYPRENKGLYSRI-AETGVVVSEFPPG 205 >gi|253583758|ref|ZP_04860956.1| smf protein [Fusobacterium varium ATCC 27725] gi|251834330|gb|EES62893.1| smf protein [Fusobacterium varium ATCC 27725] Length = 352 Score = 37.1 bits (85), Expect = 0.75, Method: Composition-based stats. Identities = 17/31 (54%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP ENR L E I + G+ ISE P G Sbjct: 169 GLDVIYPKENRILWENI-EKSGLIISEYPLG 198 >gi|281414066|ref|ZP_06245808.1| DNA protecting protein DprA [Micrococcus luteus NCTC 2665] Length = 319 Score = 37.1 bits (85), Expect = 0.76, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YP + +LL + G+ +SE+P G Sbjct: 117 LAGGLDRFYPAGHEDLLRAVMA-AGLLVSEMPPG 149 >gi|225375312|ref|ZP_03752533.1| hypothetical protein ROSEINA2194_00937 [Roseburia inulinivorans DSM 16841] gi|225212801|gb|EEG95155.1| hypothetical protein ROSEINA2194_00937 [Roseburia inulinivorans DSM 16841] Length = 359 Score = 37.1 bits (85), Expect = 0.77, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G++ YP N+ L E+I +GG ISE P Sbjct: 169 LGCGVNICYPRTNQKLYEDILSHGG-IISEYPP 200 >gi|88801029|ref|ZP_01116578.1| DNA processing chain A [Reinekea sp. MED297] gi|88776232|gb|EAR07458.1| DNA processing chain A [Reinekea sp. MED297] Length = 368 Score = 37.1 bits (85), Expect = 0.78, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YP NR L E+I G +SE P G Sbjct: 176 LGCGIDVIYPKNNRQLFEDI-ARDGCLVSEYPLG 208 >gi|119025612|ref|YP_909457.1| hypothetical protein BAD_0594 [Bifidobacterium adolescentis ATCC 15703] gi|118765196|dbj|BAF39375.1| hypothetical protein [Bifidobacterium adolescentis ATCC 15703] Length = 434 Score = 37.1 bits (85), Expect = 0.78, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 21/33 (63%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGGL+ + P N+NL E+I + G ISE+ G Sbjct: 228 AGGLNHIGPKSNQNLFEQIESHSGALISELCPG 260 >gi|206890890|ref|YP_002248891.1| DNA processing protein DprA [Thermodesulfovibrio yellowstonii DSM 11347] gi|206742828|gb|ACI21885.1| DNA processing protein DprA [Thermodesulfovibrio yellowstonii DSM 11347] Length = 368 Score = 37.1 bits (85), Expect = 0.78, Method: Composition-based stats. Identities = 15/30 (50%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISE 30 + G+ C+YPPEN+ L E+I N G ISE Sbjct: 174 LGSGVSCIYPPENKMLAEKIIKN-GAIISE 202 >gi|188535242|ref|YP_001909039.1| Predicted Rossmann fold nucleotide-binding protein involved in DNA uptake [Erwinia tasmaniensis Et1/99] gi|188030284|emb|CAO98173.1| Predicted Rossmann fold nucleotide-binding protein involved in DNA uptake [Erwinia tasmaniensis Et1/99] Length = 374 Score = 37.1 bits (85), Expect = 0.80, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 21/33 (63%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GLD +YP +++ L ++I D GG +SE P Sbjct: 167 LGSGLDAIYPRQHQFLAQQIIDCGGALVSEFPL 199 >gi|78044382|ref|YP_360615.1| putative DNA proccessing protein DprA [Carboxydothermus hydrogenoformans Z-2901] gi|77996497|gb|ABB15396.1| putative DNA proccessing protein DprA [Carboxydothermus hydrogenoformans Z-2901] Length = 358 Score = 37.1 bits (85), Expect = 0.80, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D YP EN NL EI G+ ISE G Sbjct: 168 LGSGIDVPYPRENENLYREII-QKGLIISEFLPG 200 >gi|15676044|ref|NP_273174.1| DNA processing chain A [Neisseria meningitidis MC58] gi|7225332|gb|AAF40575.1| DNA processing chain A [Neisseria meningitidis MC58] gi|316985962|gb|EFV64901.1| DNA protecting protein DprA [Neisseria meningitidis H44/76] gi|325141261|gb|EGC63760.1| putative DNA processing protein DprA [Neisseria meningitidis CU385] gi|325199330|gb|ADY94785.1| putative DNA processing protein DprA [Neisseria meningitidis H44/76] Length = 397 Score = 37.1 bits (85), Expect = 0.80, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI G+ +SE P G Sbjct: 180 GIDRIYPPVNKNLAYEI-AEKGLIVSEFPIG 209 >gi|15639384|ref|NP_218833.1| smf protein (smf) [Treponema pallidum subsp. pallidum str. Nichols] gi|189025626|ref|YP_001933398.1| protein Smf [Treponema pallidum subsp. pallidum SS14] gi|3322671|gb|AAC65377.1| smf protein (smf) [Treponema pallidum subsp. pallidum str. Nichols] gi|189018201|gb|ACD70819.1| protein Smf [Treponema pallidum subsp. pallidum SS14] gi|291059783|gb|ADD72518.1| DNA protecting protein DprA [Treponema pallidum subsp. pallidum str. Chicago] Length = 302 Score = 37.1 bits (85), Expect = 0.80, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 17/31 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 +A G+D LYP N L I + GG +SE Sbjct: 178 LACGVDQLYPRSNSALAARIIETGGCILSEY 208 >gi|299771933|ref|YP_003733959.1| Rossmann fold nucleotide-binding protein [Acinetobacter sp. DR1] gi|298702021|gb|ADI92586.1| Rossmann fold nucleotide-binding protein [Acinetobacter sp. DR1] Length = 377 Score = 37.1 bits (85), Expect = 0.82, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 17/31 (54%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD YP +N+ L E+I G I+E G Sbjct: 182 GLDSTYPAQNKKLAEQILAQNGAIITEFLPG 212 >gi|154487075|ref|ZP_02028482.1| hypothetical protein BIFADO_00915 [Bifidobacterium adolescentis L2-32] gi|154084938|gb|EDN83983.1| hypothetical protein BIFADO_00915 [Bifidobacterium adolescentis L2-32] Length = 434 Score = 37.1 bits (85), Expect = 0.83, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 21/33 (63%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGGL+ + P N+NL E+I + G ISE+ G Sbjct: 228 AGGLNHIGPKSNQNLFEQIESHSGALISELCPG 260 >gi|50955103|ref|YP_062391.1| DNA processing factor [Leifsonia xyli subsp. xyli str. CTCB07] gi|50951585|gb|AAT89286.1| DNA processing factor [Leifsonia xyli subsp. xyli str. CTCB07] Length = 411 Score = 37.1 bits (85), Expect = 0.84, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGG D LYP N LL I + G+ ++E+P G Sbjct: 225 LAGGADRLYPAANTELLTRILAS-GLILAELPPG 257 >gi|167855660|ref|ZP_02478418.1| Protein smf (DNA-processing chain A) [Haemophilus parasuis 29755] gi|167853232|gb|EDS24488.1| Protein smf (DNA-processing chain A) [Haemophilus parasuis 29755] Length = 375 Score = 37.1 bits (85), Expect = 0.87, Method: Composition-based stats. Identities = 12/30 (40%), Positives = 18/30 (60%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISE 30 + GLD +YP ++ L E+I D G +SE Sbjct: 169 LGSGLDQVYPARHKKLAEQIVDTSGALVSE 198 >gi|237736954|ref|ZP_04567435.1| topoisomerase [Fusobacterium mortiferum ATCC 9817] gi|229420816|gb|EEO35863.1| topoisomerase [Fusobacterium mortiferum ATCC 9817] Length = 356 Score = 37.1 bits (85), Expect = 0.87, Method: Composition-based stats. Identities = 16/31 (51%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP ENR + EEI G+ +SE P G Sbjct: 172 GLDIIYPYENRKIWEEI-GEKGLLLSEYPMG 201 >gi|309378540|emb|CBX22812.1| unnamed protein product [Neisseria lactamica Y92-1009] Length = 397 Score = 37.1 bits (85), Expect = 0.89, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI G+ +SE P G Sbjct: 180 GIDRIYPPANKNLAYEI-AEKGLIVSEFPIG 209 >gi|269836418|ref|YP_003318646.1| DNA protecting protein DprA [Sphaerobacter thermophilus DSM 20745] gi|269785681|gb|ACZ37824.1| DNA protecting protein DprA [Sphaerobacter thermophilus DSM 20745] Length = 359 Score = 37.1 bits (85), Expect = 0.89, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YPPE+R L E++ G +SE P G Sbjct: 171 LGSGVDVIYPPEHRQLAEQV-AQQGALVSEFPLG 203 >gi|261400041|ref|ZP_05986166.1| putative DNA processing protein DprA [Neisseria lactamica ATCC 23970] gi|269210264|gb|EEZ76719.1| putative DNA processing protein DprA [Neisseria lactamica ATCC 23970] Length = 397 Score = 37.1 bits (85), Expect = 0.89, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+NL EI G+ +SE P G Sbjct: 180 GIDRIYPPANKNLAYEI-AEKGLIVSEFPIG 209 >gi|146280420|ref|YP_001170573.1| DNA processing protein DprA, putative [Pseudomonas stutzeri A1501] gi|145568625|gb|ABP77731.1| DNA processing protein DprA, putative [Pseudomonas stutzeri A1501] Length = 365 Score = 37.1 bits (85), Expect = 0.89, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 22/33 (66%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G++ LYP + +L +EI ++GG +SE+P Sbjct: 176 LGTGIERLYPQRHLSLAKEIVEHGGALVSELPL 208 >gi|327446261|gb|EGE92915.1| DNA protecting protein DprA [Propionibacterium acnes HL013PA2] Length = 311 Score = 37.1 bits (85), Expect = 0.90, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +A GLD LYP N +LE+I G +SE+P G Sbjct: 178 LACGLDTLYPRGNSAVLEQI-AGTGALVSELPLG 210 >gi|294789444|ref|ZP_06754681.1| putative DNA processing protein DprA [Simonsiella muelleri ATCC 29453] gi|294482657|gb|EFG30347.1| putative DNA processing protein DprA [Simonsiella muelleri ATCC 29453] Length = 421 Score = 37.1 bits (85), Expect = 0.90, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP EN+ L +I G+ +SE P G Sbjct: 178 GIDRIYPNENKKLAYQI-AEKGLIVSEFPLG 207 >gi|327478636|gb|AEA81946.1| DNA processing protein DprA, putative [Pseudomonas stutzeri DSM 4166] Length = 365 Score = 37.1 bits (85), Expect = 0.90, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 22/33 (66%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G++ LYP + +L +EI ++GG +SE+P Sbjct: 176 LGTGIERLYPQRHLSLAKEIVEHGGALVSELPL 208 >gi|291517057|emb|CBK70673.1| Predicted Rossmann fold nucleotide-binding protein involved in DNA uptake [Bifidobacterium longum subsp. longum F8] Length = 514 Score = 37.1 bits (85), Expect = 0.92, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 19/33 (57%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGGL+ + P NR L E I GG ISE+ G Sbjct: 204 AGGLNHIGPMRNRTLFERIETQGGALISELCPG 236 >gi|163816842|ref|ZP_02208205.1| hypothetical protein COPEUT_03032 [Coprococcus eutactus ATCC 27759] gi|158448099|gb|EDP25094.1| hypothetical protein COPEUT_03032 [Coprococcus eutactus ATCC 27759] Length = 360 Score = 37.1 bits (85), Expect = 0.92, Method: Composition-based stats. Identities = 10/30 (33%), Positives = 18/30 (60%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISE 30 + G++ YP EN ++ I + GG+ +SE Sbjct: 173 LGSGINVPYPRENYDIYRSIVNGGGVVVSE 202 >gi|323701838|ref|ZP_08113508.1| DNA protecting protein DprA [Desulfotomaculum nigrificans DSM 574] gi|323533142|gb|EGB23011.1| DNA protecting protein DprA [Desulfotomaculum nigrificans DSM 574] Length = 363 Score = 37.1 bits (85), Expect = 0.93, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G D +YP EN L+++I + G ISE P G Sbjct: 172 LGCGPDVVYPKENARLMDKIIEQ-GAVISEFPPG 204 >gi|309811480|ref|ZP_07705262.1| DNA protecting protein DprA [Dermacoccus sp. Ellin185] gi|308434531|gb|EFP58381.1| DNA protecting protein DprA [Dermacoccus sp. Ellin185] Length = 438 Score = 37.1 bits (85), Expect = 0.93, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGG+D +YP + L I G+ +SE+P G Sbjct: 243 VAGGVDRVYPTAHEELFARI-RERGVIVSEMPLG 275 >gi|83954521|ref|ZP_00963232.1| DNA processing protein DprA, putative [Sulfitobacter sp. NAS-14.1] gi|83840805|gb|EAP79976.1| DNA processing protein DprA, putative [Sulfitobacter sp. NAS-14.1] Length = 365 Score = 37.1 bits (85), Expect = 0.93, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGG+D +YP EN L ++I G+ ISE P G Sbjct: 170 AGGVDVIYPVENTTLAQDIAAQ-GLRISEQPMG 201 >gi|313829531|gb|EFS67245.1| DNA protecting protein DprA [Propionibacterium acnes HL063PA2] Length = 377 Score = 37.1 bits (85), Expect = 0.94, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +A GLD LYP N +LE+I G +SE+P G Sbjct: 178 LACGLDTLYPRGNSAVLEQI-AGTGALVSELPLG 210 >gi|326333663|ref|ZP_08199900.1| DNA protecting protein DprA [Nocardioidaceae bacterium Broad-1] gi|325948569|gb|EGD40672.1| DNA protecting protein DprA [Nocardioidaceae bacterium Broad-1] Length = 390 Score = 37.1 bits (85), Expect = 0.97, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGG+D YP NR LL+ I G ISEI G Sbjct: 191 LAGGVDVPYPLRNRRLLDAI-AESGAVISEIAPG 223 >gi|322688898|ref|YP_004208632.1| hypothetical protein BLIF_0711 [Bifidobacterium longum subsp. infantis 157F] gi|320460234|dbj|BAJ70854.1| conserved hypothetical protein [Bifidobacterium longum subsp. infantis 157F] Length = 550 Score = 36.7 bits (84), Expect = 0.98, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 19/33 (57%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGGL+ + P NR L E I GG ISE+ G Sbjct: 240 AGGLNHIGPMRNRTLFERIEAQGGALISELCPG 272 >gi|227545995|ref|ZP_03976044.1| possible Rossmann fold nucleotide-binding protein involved in DNA uptake [Bifidobacterium longum subsp. infantis ATCC 55813] gi|322690873|ref|YP_004220443.1| hypothetical protein BLLJ_0683 [Bifidobacterium longum subsp. longum JCM 1217] gi|227213629|gb|EEI81478.1| possible Rossmann fold nucleotide-binding protein involved in DNA uptake [Bifidobacterium longum subsp. infantis ATCC 55813] gi|320455729|dbj|BAJ66351.1| conserved hypothetical protein [Bifidobacterium longum subsp. longum JCM 1217] Length = 566 Score = 36.7 bits (84), Expect = 0.98, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 19/33 (57%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGGL+ + P NR L E I GG ISE+ G Sbjct: 256 AGGLNHIGPMRNRTLFERIEAQGGALISELCPG 288 >gi|121533773|ref|ZP_01665600.1| DNA protecting protein DprA [Thermosinus carboxydivorans Nor1] gi|121307764|gb|EAX48679.1| DNA protecting protein DprA [Thermosinus carboxydivorans Nor1] Length = 282 Score = 36.7 bits (84), Expect = 0.98, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D YPPEN +L EI + GG ISE G Sbjct: 91 LGCGVDVCYPPENAKILAEIAETGG-IISEYAPG 123 >gi|297570259|ref|YP_003691603.1| DNA protecting protein DprA [Desulfurivibrio alkaliphilus AHT2] gi|296926174|gb|ADH86984.1| DNA protecting protein DprA [Desulfurivibrio alkaliphilus AHT2] Length = 381 Score = 36.7 bits (84), Expect = 0.99, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + GLD +YPP+N+ L +I G+ +SE P G Sbjct: 178 LGCGLDVVYPPQNKKLFAKI-AATGMLLSEYPPG 210 >gi|197123196|ref|YP_002135147.1| DNA protecting protein DprA [Anaeromyxobacter sp. K] gi|196173045|gb|ACG74018.1| DNA protecting protein DprA [Anaeromyxobacter sp. K] Length = 312 Score = 36.7 bits (84), Expect = 0.99, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 22/34 (64%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YP ++R L E I + GG +SE+P G Sbjct: 120 LGTGVDVVYPRQHRALFERIVEAGGALVSELPDG 153 >gi|78222110|ref|YP_383857.1| SMF protein [Geobacter metallireducens GS-15] gi|78193365|gb|ABB31132.1| DNA protecting protein DprA [Geobacter metallireducens GS-15] Length = 358 Score = 36.7 bits (84), Expect = 0.99, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YP ENR L E+ + G +SE P G Sbjct: 170 LGCGVDVVYPAENRQLFREMAEQ-GAVVSEFPLG 202 >gi|83943948|ref|ZP_00956405.1| DNA processing protein DprA, putative [Sulfitobacter sp. EE-36] gi|83845195|gb|EAP83075.1| DNA processing protein DprA, putative [Sulfitobacter sp. EE-36] Length = 365 Score = 36.7 bits (84), Expect = 0.99, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGG+D +YP EN L ++I G+ ISE P G Sbjct: 170 AGGVDVIYPVENTTLAQDIAAQ-GLRISEQPMG 201 >gi|322382312|ref|ZP_08056219.1| DNA processing Smf single strand binding protein-like protein [Paenibacillus larvae subsp. larvae B-3650] gi|321153665|gb|EFX46040.1| DNA processing Smf single strand binding protein-like protein [Paenibacillus larvae subsp. larvae B-3650] Length = 281 Score = 36.7 bits (84), Expect = 1.00, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G D +YPPEN L +I G+ +SE+P G Sbjct: 166 LGGPADKIYPPENGQLYRQI-AESGLILSEVPVG 198 >gi|317482280|ref|ZP_07941301.1| DNA recombination-mediator protein A [Bifidobacterium sp. 12_1_47BFAA] gi|316916296|gb|EFV37697.1| DNA recombination-mediator protein A [Bifidobacterium sp. 12_1_47BFAA] Length = 550 Score = 36.7 bits (84), Expect = 1.00, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 19/33 (57%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGGL+ + P NR L E I GG ISE+ G Sbjct: 240 AGGLNHIGPMRNRTLFERIEAQGGALISELCPG 272 >gi|23465510|ref|NP_696113.1| hypothetical protein BL0937 [Bifidobacterium longum NCC2705] gi|23326169|gb|AAN24749.1| hypothetical protein with partial similarity to smf DNA processing protein [Bifidobacterium longum NCC2705] Length = 566 Score = 36.7 bits (84), Expect = 1.00, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 19/33 (57%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGGL+ + P NR L E I GG ISE+ G Sbjct: 256 AGGLNHIGPMRNRTLFERIEAQGGALISELCPG 288 >gi|254491244|ref|ZP_05104425.1| DNA protecting protein DprA, putative [Methylophaga thiooxidans DMS010] gi|224463757|gb|EEF80025.1| DNA protecting protein DprA, putative [Methylophaga thiooxydans DMS010] Length = 345 Score = 36.7 bits (84), Expect = 1.0, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +A GLD +YP ++R L +I N G +SE P G Sbjct: 149 VATGLDRVYPAQHRQLAHDIAAN-GAIVSEFPLG 181 >gi|313813527|gb|EFS51241.1| DNA protecting protein DprA [Propionibacterium acnes HL025PA1] Length = 377 Score = 36.7 bits (84), Expect = 1.0, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +A GLD LYP N +LE+I G +SE+P G Sbjct: 178 LACGLDTLYPRGNSAVLEQI-AGTGALVSELPLG 210 >gi|312132950|ref|YP_004000289.1| smf [Bifidobacterium longum subsp. longum BBMN68] gi|311773931|gb|ADQ03419.1| Smf [Bifidobacterium longum subsp. longum BBMN68] Length = 514 Score = 36.7 bits (84), Expect = 1.0, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 19/33 (57%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGGL+ + P NR L E I GG ISE+ G Sbjct: 204 AGGLNHIGPMRNRTLFERIEAQGGALISELCPG 236 >gi|157372743|ref|YP_001480732.1| DNA protecting protein DprA [Serratia proteamaculans 568] gi|157324507|gb|ABV43604.1| DNA protecting protein DprA [Serratia proteamaculans 568] Length = 373 Score = 36.7 bits (84), Expect = 1.0, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 19/31 (61%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GLD +YP +R L E I +NGG ISE Sbjct: 167 LGSGLDNIYPRRHRRLAERIVENGGALISEY 197 >gi|311113475|ref|YP_003984697.1| DNA protecting protein DprA [Rothia dentocariosa ATCC 17931] gi|310944969|gb|ADP41263.1| DNA protecting protein DprA [Rothia dentocariosa ATCC 17931] Length = 494 Score = 36.7 bits (84), Expect = 1.0, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 MAGGLD YP +N +L I + G+ +SE+ G Sbjct: 290 MAGGLDHFYPVQNSEILHRIVEE-GLILSEVSIG 322 >gi|289427793|ref|ZP_06429504.1| DNA protecting protein DprA [Propionibacterium acnes J165] gi|289159057|gb|EFD07250.1| DNA protecting protein DprA [Propionibacterium acnes J165] gi|313763675|gb|EFS35039.1| DNA protecting protein DprA [Propionibacterium acnes HL013PA1] gi|313801455|gb|EFS42706.1| DNA protecting protein DprA [Propionibacterium acnes HL110PA2] gi|313807865|gb|EFS46346.1| DNA protecting protein DprA [Propionibacterium acnes HL087PA2] gi|313811664|gb|EFS49378.1| DNA protecting protein DprA [Propionibacterium acnes HL083PA1] gi|313816850|gb|EFS54564.1| DNA protecting protein DprA [Propionibacterium acnes HL059PA1] gi|313819650|gb|EFS57364.1| DNA protecting protein DprA [Propionibacterium acnes HL046PA2] gi|313822245|gb|EFS59959.1| DNA protecting protein DprA [Propionibacterium acnes HL036PA1] gi|313823522|gb|EFS61236.1| DNA protecting protein DprA [Propionibacterium acnes HL036PA2] gi|313825850|gb|EFS63564.1| DNA protecting protein DprA [Propionibacterium acnes HL063PA1] gi|313831405|gb|EFS69119.1| DNA protecting protein DprA [Propionibacterium acnes HL007PA1] gi|313835017|gb|EFS72731.1| DNA protecting protein DprA [Propionibacterium acnes HL056PA1] gi|313839826|gb|EFS77540.1| DNA protecting protein DprA [Propionibacterium acnes HL086PA1] gi|314914677|gb|EFS78508.1| DNA protecting protein DprA [Propionibacterium acnes HL005PA4] gi|314919210|gb|EFS83041.1| DNA protecting protein DprA [Propionibacterium acnes HL050PA1] gi|314920880|gb|EFS84711.1| DNA protecting protein DprA [Propionibacterium acnes HL050PA3] gi|314924577|gb|EFS88408.1| DNA protecting protein DprA [Propionibacterium acnes HL036PA3] gi|314930448|gb|EFS94279.1| DNA protecting protein DprA [Propionibacterium acnes HL067PA1] gi|314954499|gb|EFS98905.1| DNA protecting protein DprA [Propionibacterium acnes HL027PA1] gi|314957379|gb|EFT01482.1| DNA protecting protein DprA [Propionibacterium acnes HL002PA1] gi|314961998|gb|EFT06099.1| DNA protecting protein DprA [Propionibacterium acnes HL002PA2] gi|314963577|gb|EFT07677.1| DNA protecting protein DprA [Propionibacterium acnes HL082PA1] gi|314968590|gb|EFT12688.1| DNA protecting protein DprA [Propionibacterium acnes HL037PA1] gi|314974280|gb|EFT18376.1| DNA protecting protein DprA [Propionibacterium acnes HL053PA1] gi|314976715|gb|EFT20810.1| DNA protecting protein DprA [Propionibacterium acnes HL045PA1] gi|314984417|gb|EFT28509.1| DNA protecting protein DprA [Propionibacterium acnes HL005PA1] gi|314986433|gb|EFT30525.1| DNA protecting protein DprA [Propionibacterium acnes HL005PA2] gi|314990793|gb|EFT34884.1| DNA protecting protein DprA [Propionibacterium acnes HL005PA3] gi|315079433|gb|EFT51426.1| DNA protecting protein DprA [Propionibacterium acnes HL053PA2] gi|315081341|gb|EFT53317.1| DNA protecting protein DprA [Propionibacterium acnes HL078PA1] gi|315083542|gb|EFT55518.1| DNA protecting protein DprA [Propionibacterium acnes HL027PA2] gi|315087222|gb|EFT59198.1| DNA protecting protein DprA [Propionibacterium acnes HL002PA3] gi|315095251|gb|EFT67227.1| DNA protecting protein DprA [Propionibacterium acnes HL038PA1] gi|315099301|gb|EFT71277.1| DNA protecting protein DprA [Propionibacterium acnes HL059PA2] gi|315100523|gb|EFT72499.1| DNA protecting protein DprA [Propionibacterium acnes HL046PA1] gi|315106705|gb|EFT78681.1| DNA protecting protein DprA [Propionibacterium acnes HL030PA1] gi|315108930|gb|EFT80906.1| DNA protecting protein DprA [Propionibacterium acnes HL030PA2] gi|327328319|gb|EGE70081.1| DNA processing / uptake protein [Propionibacterium acnes HL096PA2] gi|327329816|gb|EGE71572.1| DNA processing / uptake protein [Propionibacterium acnes HL096PA3] gi|327444344|gb|EGE90998.1| DNA protecting protein DprA [Propionibacterium acnes HL043PA2] gi|327455053|gb|EGF01708.1| DNA protecting protein DprA [Propionibacterium acnes HL087PA3] gi|327457659|gb|EGF04314.1| DNA protecting protein DprA [Propionibacterium acnes HL083PA2] gi|328752257|gb|EGF65873.1| DNA protecting protein DprA [Propionibacterium acnes HL020PA1] gi|328755116|gb|EGF68732.1| DNA protecting protein DprA [Propionibacterium acnes HL087PA1] gi|328758105|gb|EGF71721.1| DNA protecting protein DprA [Propionibacterium acnes HL025PA2] gi|328760131|gb|EGF73709.1| DNA processing / uptake protein [Propionibacterium acnes HL099PA1] gi|332675846|gb|AEE72662.1| DNA processing / uptake protein [Propionibacterium acnes 266] Length = 377 Score = 36.7 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +A GLD LYP N +LE+I G +SE+P G Sbjct: 178 LACGLDTLYPRGNSAVLEQI-AGTGALVSELPLG 210 >gi|262197810|ref|YP_003269019.1| SMF family protein [Haliangium ochraceum DSM 14365] gi|262081157|gb|ACY17126.1| SMF family protein [Haliangium ochraceum DSM 14365] Length = 297 Score = 36.7 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 13/32 (40%), Positives = 19/32 (59%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIP 32 + G+D +YP +R L E+ +GG ISE P Sbjct: 107 LGCGIDVVYPARHRALYHEVCASGGALISEFP 138 >gi|254428234|ref|ZP_05041941.1| DNA protecting protein DprA, putative [Alcanivorax sp. DG881] gi|196194403|gb|EDX89362.1| DNA protecting protein DprA, putative [Alcanivorax sp. DG881] Length = 353 Score = 36.7 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%) Query: 1 [protein fragment, 34 aa] 34 M G DC+YPP + L +I + GG +SE G Sbjct: 165 MGSGPDCIYPPRHGLLASQIVEAGGALVSEFAPG 198 >gi|160880855|ref|YP_001559823.1| DNA protecting protein DprA [Clostridium phytofermentans ISDg] gi|160429521|gb|ABX43084.1| DNA protecting protein DprA [Clostridium phytofermentans ISDg] Length = 369 Score = 36.7 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD YP EN L +E+ +GG +SE P G Sbjct: 178 GLDLCYPRENYGLYQEVNLHGG-ILSEYPIG 207 >gi|20807897|ref|NP_623068.1| Rossmann-fold nucleotide-binding protein involved in DNA uptake [Thermoanaerobacter tengcongensis MB4] gi|254479480|ref|ZP_05092805.1| DNA protecting protein DprA, putative [Carboxydibrachium pacificum DSM 12653] gi|20516463|gb|AAM24672.1| predicted Rossmann-fold nucleotide-binding protein involved in DNA uptake [Thermoanaerobacter tengcongensis MB4] gi|214034584|gb|EEB75333.1| DNA protecting protein DprA, putative [Carboxydibrachium pacificum DSM 12653] Length = 362 Score = 36.7 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G++ +YP EN+ L+E+I G+ +SE P Sbjct: 171 LGCGINVVYPTENKKLMEQI-GEEGLLVSEYPL 202 >gi|329851389|ref|ZP_08266146.1| DNA protecting protein DprA [Asticcacaulis biprosthecum C19] gi|328840235|gb|EGF89807.1| DNA protecting protein DprA [Asticcacaulis biprosthecum C19] Length = 372 Score = 36.7 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + GG+D +YPP+N L + + + G+ +SE P G Sbjct: 172 LGGGIDDVYPPDNAALYQRLREQ-GLLVSESPVG 204 >gi|327445018|gb|EGE91672.1| DNA protecting protein DprA [Propionibacterium acnes HL043PA1] Length = 377 Score = 36.7 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +A GLD LYP N +LE+I G +SE+P G Sbjct: 178 LACGLDTLYPRGNSAVLEQI-AGTGALVSELPLG 210 >gi|229826296|ref|ZP_04452365.1| hypothetical protein GCWU000182_01668 [Abiotrophia defectiva ATCC 49176] gi|229789166|gb|EEP25280.1| hypothetical protein GCWU000182_01668 [Abiotrophia defectiva ATCC 49176] Length = 366 Score = 36.7 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G D YPP N L I + GG+ ISE P G Sbjct: 174 LGCGADVCYPPNNIELYLSIIEKGGV-ISEFPLG 206 >gi|46190458|ref|ZP_00206472.1| COG0758: Predicted Rossmann fold nucleotide-binding protein involved in DNA uptake [Bifidobacterium longum DJO10A] gi|189439541|ref|YP_001954622.1| putative DNA uptake protein [Bifidobacterium longum DJO10A] gi|189427976|gb|ACD98124.1| Putative DNA uptake protein [Bifidobacterium longum DJO10A] Length = 514 Score = 36.7 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 19/33 (57%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGGL+ + P NR L E I GG ISE+ G Sbjct: 204 AGGLNHIGPMRNRTLFERIEAQGGALISELCPG 236 >gi|331007628|ref|ZP_08330770.1| Rossmann fold nucleotide-binding protein [gamma proteobacterium IMCC1989] gi|330418568|gb|EGG93092.1| Rossmann fold nucleotide-binding protein [gamma proteobacterium IMCC1989] Length = 391 Score = 36.7 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 24/33 (72%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 MA G++ +YP ++NL E+I ++GG+ I+E P Sbjct: 194 MATGINSVYPKRHQNLAEQIVEDGGVLITEFPP 226 >gi|239621949|ref|ZP_04664980.1| DNA protecting protein DprA [Bifidobacterium longum subsp. infantis CCUG 52486] gi|239515140|gb|EEQ55007.1| DNA protecting protein DprA [Bifidobacterium longum subsp. infantis CCUG 52486] Length = 514 Score = 36.7 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 19/33 (57%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGGL+ + P NR L E I GG ISE+ G Sbjct: 204 AGGLNHIGPMRNRTLFERIEAQGGALISELCPG 236 >gi|149200840|ref|ZP_01877815.1| DNA processing protein DprA, putative [Roseovarius sp. TM1035] gi|149145173|gb|EDM33199.1| DNA processing protein DprA, putative [Roseovarius sp. TM1035] Length = 356 Score = 36.7 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 MAGG+D +YP EN L +I + G+ +SE P G Sbjct: 159 MAGGVDVIYPAENTKLAGDILAS-GLRLSEQPIG 191 >gi|314978802|gb|EFT22896.1| DNA protecting protein DprA [Propionibacterium acnes HL072PA2] gi|315089395|gb|EFT61371.1| DNA protecting protein DprA [Propionibacterium acnes HL072PA1] Length = 377 Score = 36.7 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +A GLD LYP N +LE+I G +SE+P G Sbjct: 178 LACGLDTLYPRGNSAVLEQI-AGTGALVSELPLG 210 >gi|50842909|ref|YP_056136.1| DNA processing / uptake protein [Propionibacterium acnes KPA171202] gi|50840511|gb|AAT83178.1| DNA processing / uptake protein [Propionibacterium acnes KPA171202] Length = 377 Score = 36.7 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +A GLD LYP N +LE+I G +SE+P G Sbjct: 178 LACGLDTLYPRGNSAVLEQI-AGTGALVSELPLG 210 >gi|319639529|ref|ZP_07994276.1| SMF-family protein [Neisseria mucosa C102] gi|317399100|gb|EFV79774.1| SMF-family protein [Neisseria mucosa C102] Length = 396 Score = 36.7 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 14/30 (46%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 G+D +YPP N+NL EI G+ +SE P Sbjct: 180 GIDRIYPPSNKNLAYEI-AEKGLIVSEFPL 208 >gi|313794068|gb|EFS42092.1| DNA protecting protein DprA [Propionibacterium acnes HL110PA1] gi|327451913|gb|EGE98567.1| DNA protecting protein DprA [Propionibacterium acnes HL092PA1] Length = 376 Score = 36.7 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +A GLD LYP N +LE+I G +SE+P G Sbjct: 178 LACGLDTLYPRGNSAVLEQI-AGTGALVSELPLG 210 >gi|303240294|ref|ZP_07326813.1| DNA protecting protein DprA [Acetivibrio cellulolyticus CD2] gi|302592204|gb|EFL61933.1| DNA protecting protein DprA [Acetivibrio cellulolyticus CD2] Length = 369 Score = 36.7 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + GLD +YP EN+ L+E I +N G +SE G Sbjct: 172 LGCGLDIVYPYENKKLMENIIEN-GACLSEFLPG 204 >gi|295130966|ref|YP_003581629.1| DNA protecting protein DprA [Propionibacterium acnes SK137] gi|291376560|gb|ADE00415.1| DNA protecting protein DprA [Propionibacterium acnes SK137] Length = 377 Score = 36.7 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +A GLD LYP N +LE+I G +SE+P G Sbjct: 178 LACGLDTLYPRGNSAVLEQI-AGTGALVSELPLG 210 >gi|78484539|ref|YP_390464.1| DNA processing protein DprA, putative [Thiomicrospira crunogena XCL-2] gi|78362825|gb|ABB40790.1| DNA protecting protein DprA [Thiomicrospira crunogena XCL-2] Length = 377 Score = 36.7 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +A GLD +YP NR L +I D G +SE P G Sbjct: 182 VATGLDRVYPAANRELARQIADR-GALVSEYPLG 214 >gi|327334330|gb|EGE76044.1| DNA processing / uptake protein [Propionibacterium acnes HL097PA1] Length = 377 Score = 36.7 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +A GLD LYP N +LE+I G +SE+P G Sbjct: 178 LACGLDTLYPRGNSAVLEQI-AGTGALVSELPLG 210 >gi|160934426|ref|ZP_02081813.1| hypothetical protein CLOLEP_03299 [Clostridium leptum DSM 753] gi|156867099|gb|EDO60471.1| hypothetical protein CLOLEP_03299 [Clostridium leptum DSM 753] Length = 396 Score = 36.7 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GG D YPP + + I +NGG +SE P Sbjct: 171 LGGGADVDYPPNFAGMRKRILENGGAVLSEYPP 203 >gi|262281297|ref|ZP_06059078.1| DNA protecting protein DprA [Acinetobacter calcoaceticus RUH2202] gi|262257123|gb|EEY75860.1| DNA protecting protein DprA [Acinetobacter calcoaceticus RUH2202] Length = 376 Score = 36.7 bits (84), Expect = 1.2, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 17/31 (54%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD YP +N+ L E+I G I+E G Sbjct: 182 GLDSTYPAQNKKLAEQILAQNGAIITEFLPG 212 >gi|283458211|ref|YP_003362829.1| putative Rossmann fold nucleotide-binding protein [Rothia mucilaginosa DY-18] gi|283134244|dbj|BAI65009.1| predicted Rossmann fold nucleotide-binding protein involved in DNA uptake [Rothia mucilaginosa DY-18] Length = 613 Score = 36.7 bits (84), Expect = 1.2, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 MAGGLD LYP +N + L I D G+ +SE+ G Sbjct: 408 MAGGLDRLYPAQNSDALNMIVDR-GLIMSEVSVG 440 >gi|255326005|ref|ZP_05367093.1| DNA protecting protein DprA [Rothia mucilaginosa ATCC 25296] gi|255296896|gb|EET76225.1| DNA protecting protein DprA [Rothia mucilaginosa ATCC 25296] Length = 588 Score = 36.7 bits (84), Expect = 1.2, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 MAGGLD LYP +N + L I D G+ +SE+ G Sbjct: 383 MAGGLDRLYPAQNSDALNMIVDR-GLIMSEVSVG 415 >gi|326387674|ref|ZP_08209280.1| DNA processing protein DprA, putative [Novosphingobium nitrogenifigens DSM 19370] gi|326207720|gb|EGD58531.1| DNA processing protein DprA, putative [Novosphingobium nitrogenifigens DSM 19370] Length = 383 Score = 36.7 bits (84), Expect = 1.2, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGG+D YPP++ L E I G+ ++E+P G Sbjct: 182 IAGGIDVAYPPDHAALQERI-AAEGLLVAEMPPG 214 >gi|313773612|gb|EFS39578.1| DNA protecting protein DprA [Propionibacterium acnes HL074PA1] Length = 377 Score = 36.7 bits (84), Expect = 1.2, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +A GLD LYP N +LE+I G +SE+P G Sbjct: 178 LACGLDTLYPRGNSAVLEQI-AGTGALVSELPLG 210 >gi|300741393|ref|ZP_07071414.1| DNA protecting protein DprA [Rothia dentocariosa M567] gi|300380578|gb|EFJ77140.1| DNA protecting protein DprA [Rothia dentocariosa M567] Length = 422 Score = 36.7 bits (84), Expect = 1.2, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 MAGGLD YP +N +L I + G+ +SE+ G Sbjct: 218 MAGGLDHFYPVQNSEILHRIVEE-GLILSEVSIG 250 >gi|325124150|gb|ADY83673.1| putative Rossmann-fold nucleotide-binding protein involved in DNA uptake (smf) [Acinetobacter calcoaceticus PHEA-2] Length = 377 Score = 36.7 bits (84), Expect = 1.2, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 16/31 (51%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD YP +N+ L E I G I+E G Sbjct: 182 GLDSTYPAQNKKLAEHILAQNGAIITEFLPG 212 >gi|284045125|ref|YP_003395465.1| DNA protecting protein DprA [Conexibacter woesei DSM 14684] gi|283949346|gb|ADB52090.1| DNA protecting protein DprA [Conexibacter woesei DSM 14684] Length = 366 Score = 36.7 bits (84), Expect = 1.2, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGG + YP R L E I G+ +SE+P G Sbjct: 178 LAGGAERAYPASKRRLHERI-AASGVVVSEMPPG 210 >gi|171743302|ref|ZP_02919109.1| hypothetical protein BIFDEN_02431 [Bifidobacterium dentium ATCC 27678] gi|306823247|ref|ZP_07456623.1| conserved hypothetical protein [Bifidobacterium dentium ATCC 27679] gi|309801593|ref|ZP_07695714.1| DNA protecting protein DprA [Bifidobacterium dentium JCVIHMP022] gi|171278916|gb|EDT46577.1| hypothetical protein BIFDEN_02431 [Bifidobacterium dentium ATCC 27678] gi|304553879|gb|EFM41790.1| conserved hypothetical protein [Bifidobacterium dentium ATCC 27679] gi|308221725|gb|EFO78016.1| DNA protecting protein DprA [Bifidobacterium dentium JCVIHMP022] Length = 449 Score = 36.7 bits (84), Expect = 1.2, Method: Composition-based stats. Identities = 13/30 (43%), Positives = 17/30 (56%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 AGGL+ + P N L E I D G +SE+ Sbjct: 231 AGGLNHIGPKSNARLFERIVDGKGALVSEL 260 >gi|163742204|ref|ZP_02149592.1| DNA processing protein DprA, putative [Phaeobacter gallaeciensis 2.10] gi|161384534|gb|EDQ08915.1| DNA processing protein DprA, putative [Phaeobacter gallaeciensis 2.10] Length = 355 Score = 36.7 bits (84), Expect = 1.2, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 MAGG+D +YP EN L +I + G+ ISE P G Sbjct: 123 MAGGVDVIYPTENTRLAGDIAEQ-GVMISEHPMG 155 >gi|163738379|ref|ZP_02145794.1| DNA processing protein DprA, putative [Phaeobacter gallaeciensis BS107] gi|161388300|gb|EDQ12654.1| DNA processing protein DprA, putative [Phaeobacter gallaeciensis BS107] Length = 355 Score = 36.7 bits (84), Expect = 1.2, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 MAGG+D +YP EN L +I + G+ ISE P G Sbjct: 123 MAGGVDVIYPTENTRLAGDIAEQ-GVMISEHPMG 155 >gi|94497602|ref|ZP_01304171.1| DNA processing chain A [Sphingomonas sp. SKA58] gi|94423019|gb|EAT08051.1| DNA processing chain A [Sphingomonas sp. SKA58] Length = 360 Score = 36.7 bits (84), Expect = 1.2, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +A G+D ++PPENR+L +E G+ ++E P G Sbjct: 164 IACGIDVVFPPENRDL-QEALAERGLLVTEHPPG 196 >gi|152965377|ref|YP_001361161.1| DNA protecting protein DprA [Kineococcus radiotolerans SRS30216] gi|151359894|gb|ABS02897.1| DNA protecting protein DprA [Kineococcus radiotolerans SRS30216] Length = 395 Score = 36.7 bits (84), Expect = 1.3, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +A G+D YPP N LL G +SE+P G Sbjct: 199 LACGVDRSYPPGNAALLAR-LAERGALVSEVPPG 231 >gi|289426516|ref|ZP_06428259.1| DNA protecting protein DprA [Propionibacterium acnes SK187] gi|289153244|gb|EFD01962.1| DNA protecting protein DprA [Propionibacterium acnes SK187] Length = 391 Score = 36.7 bits (84), Expect = 1.3, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +A GLD LYP N +LE+I G +SE+P G Sbjct: 192 LACGLDTLYPRGNSAVLEQI-AGTGALVSELPLG 224 >gi|212639577|ref|YP_002316097.1| putative Rossmann fold nucleotide-binding protein involved in DNA uptake [Anoxybacillus flavithermus WK1] gi|212561057|gb|ACJ34112.1| Predicted Rossmann fold nucleotide-binding protein involved in DNA uptake [Anoxybacillus flavithermus WK1] Length = 295 Score = 36.7 bits (84), Expect = 1.3, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +AGGL +YPPEN +L ++ + ISE P Sbjct: 175 IAGGLYYMYPPENESLFRQLATTQ-LIISEYPP 206 >gi|297571162|ref|YP_003696936.1| DNA protecting protein DprA [Arcanobacterium haemolyticum DSM 20595] gi|296931509|gb|ADH92317.1| DNA protecting protein DprA [Arcanobacterium haemolyticum DSM 20595] Length = 384 Score = 36.7 bits (84), Expect = 1.3, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGG+D YP + +L N G+ +SE P G Sbjct: 187 AGGVDRPYPLSHADLYTNTVKN-GVVVSESPVG 218 >gi|293611138|ref|ZP_06693436.1| conserved hypothetical protein [Acinetobacter sp. SH024] gi|292826389|gb|EFF84756.1| conserved hypothetical protein [Acinetobacter sp. SH024] Length = 377 Score = 36.7 bits (84), Expect = 1.3, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 16/31 (51%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD YP +N+ L E I G I+E G Sbjct: 182 GLDSTYPAQNKKLAEHILAQNGAIITEFLPG 212 >gi|34335037|gb|AAQ65012.1| unknown [synthetic construct] gi|301159282|emb|CBW18797.1| putative competence protein [Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344] gi|323131067|gb|ADX18497.1| putative competence protein [Salmonella enterica subsp. enterica serovar Typhimurium str. 4/74] Length = 325 Score = 36.3 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%) Query: 1 [protein fragment, 34 aa] 34 +A GL+ P +N L +I +NGG +SE P G Sbjct: 178 LAHGLELAKPKQNAKLARDILENGGAWMSEYPVG 211 >gi|163839842|ref|YP_001624247.1| SMF family protein [Renibacterium salmoninarum ATCC 33209] gi|162953318|gb|ABY22833.1| SMF family protein [Renibacterium salmoninarum ATCC 33209] Length = 323 Score = 36.3 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 MAGGLD YP N LL EI G+ ++E+P G Sbjct: 126 MAGGLDRFYPAGNELLLREI-SQSGLLLAEVPPG 158 >gi|240170585|ref|ZP_04749244.1| hypothetical protein MkanA1_14825 [Mycobacterium kansasii ATCC 12478] Length = 388 Score = 36.3 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGG+D YP + +LL I ++ G+ I+E P G Sbjct: 183 LAGGIDVPYPAGHSSLLHRIGEH-GLLITEYPPG 215 >gi|296453948|ref|YP_003661091.1| SMF family protein [Bifidobacterium longum subsp. longum JDM301] gi|296183379|gb|ADH00261.1| SMF family protein [Bifidobacterium longum subsp. longum JDM301] Length = 566 Score = 36.3 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 19/33 (57%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGGL+ + P NR L E I GG ISE+ G Sbjct: 256 AGGLNHIGPMRNRTLFERIEAQGGALISELCPG 288 >gi|281355863|ref|ZP_06242357.1| DNA protecting protein DprA [Victivallis vadensis ATCC BAA-548] gi|281318743|gb|EFB02763.1| DNA protecting protein DprA [Victivallis vadensis ATCC BAA-548] Length = 380 Score = 36.3 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GGL ++P EN L I + GG ISE P Sbjct: 172 LGGGLMRIHPQENVPLARRIVETGGAVISEFPM 204 >gi|84516624|ref|ZP_01003983.1| DNA processing protein DprA, putative [Loktanella vestfoldensis SKA53] gi|84509660|gb|EAQ06118.1| DNA processing protein DprA, putative [Loktanella vestfoldensis SKA53] Length = 336 Score = 36.3 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGG+D +YP EN L +I G+ I+E+P G Sbjct: 141 AGGVDVIYPVENTQLAHDIAKQ-GLRIAEMPMG 172 >gi|239928676|ref|ZP_04685629.1| DNA processing Smf-family protein [Streptomyces ghanaensis ATCC 14672] gi|291437000|ref|ZP_06576390.1| DNA processing Smf-family protein [Streptomyces ghanaensis ATCC 14672] gi|291339895|gb|EFE66851.1| DNA processing Smf-family protein [Streptomyces ghanaensis ATCC 14672] Length = 386 Score = 36.3 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +A G+D YP + L+ I + G+ I E+P G Sbjct: 181 LACGVDRPYPRGHTGLITRIAEQ-GLVIGELPPG 213 >gi|312797603|ref|YP_004030525.1| DNA processing protein [Burkholderia rhizoxinica HKI 454] gi|312169378|emb|CBW76381.1| DNA processing protein [Burkholderia rhizoxinica HKI 454] Length = 629 Score = 36.3 bits (83), Expect = 1.4, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 17/31 (54%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G D +YP + L EI + GG ++E P G Sbjct: 274 GADVIYPQRHTGLAAEIVERGGAILTEWPLG 304 >gi|213692568|ref|YP_002323154.1| SMF family protein [Bifidobacterium longum subsp. infantis ATCC 15697] gi|213524029|gb|ACJ52776.1| SMF family protein [Bifidobacterium longum subsp. infantis ATCC 15697] Length = 566 Score = 36.3 bits (83), Expect = 1.4, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 19/33 (57%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGGL+ + P NR L E I GG ISE+ G Sbjct: 256 AGGLNHIGPMRNRTLFERIEAQGGALISELCPG 288 >gi|320458720|dbj|BAJ69341.1| conserved hypothetical protein [Bifidobacterium longum subsp. infantis ATCC 15697] Length = 550 Score = 36.3 bits (83), Expect = 1.4, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 19/33 (57%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGGL+ + P NR L E I GG ISE+ G Sbjct: 240 AGGLNHIGPMRNRTLFERIEAQGGALISELCPG 272 >gi|283455725|ref|YP_003360289.1| Smf protein [Bifidobacterium dentium Bd1] gi|283102359|gb|ADB09465.1| Smf protein [Bifidobacterium dentium Bd1] Length = 422 Score = 36.3 bits (83), Expect = 1.4, Method: Composition-based stats. Identities = 13/30 (43%), Positives = 17/30 (56%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 AGGL+ + P N L E I D G +SE+ Sbjct: 204 AGGLNHIGPKSNARLFERIVDGKGALVSEL 233 >gi|254415891|ref|ZP_05029648.1| DNA protecting protein DprA, putative [Microcoleus chthonoplastes PCC 7420] gi|196177318|gb|EDX72325.1| DNA protecting protein DprA, putative [Microcoleus chthonoplastes PCC 7420] Length = 374 Score = 36.3 bits (83), Expect = 1.4, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YPP N+ L E I D G+ +SE P G Sbjct: 180 GIDVIYPPRNKLLYETILDR-GLVLSEYPAG 209 >gi|158337778|ref|YP_001518954.1| DNA protecting protein DprA [Acaryochloris marina MBIC11017] gi|158308019|gb|ABW29636.1| DNA protecting protein DprA [Acaryochloris marina MBIC11017] Length = 376 Score = 36.3 bits (83), Expect = 1.4, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YPP N+ L ++I + G+ +SE P G Sbjct: 176 LGTGVDMIYPPRNQGLYQKI-EQQGLLLSEYPSG 208 >gi|268608877|ref|ZP_06142604.1| DNA protecting protein DprA [Ruminococcus flavefaciens FD-1] Length = 422 Score = 36.3 bits (83), Expect = 1.4, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 19/34 (55%) Query: 1 [protein fragment, 34 aa] 34 M G+D YP N+ E+I GG+ ISE P G Sbjct: 171 MGCGVDVDYPKPNQQFREKILQCGGVFISEFPPG 204 >gi|331695085|ref|YP_004331324.1| DNA protecting protein DprA [Pseudonocardia dioxanivorans CB1190] gi|326949774|gb|AEA23471.1| DNA protecting protein DprA [Pseudonocardia dioxanivorans CB1190] Length = 292 Score = 36.3 bits (83), Expect = 1.4, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 21/34 (61%) Query: 1 [protein fragment, 34 aa] 34 +A G+D +P ++ L + + + GG+ +SE P G Sbjct: 172 LANGVDLTHPHQHARLHQTLIEQGGLLVSEYPIG 205 >gi|304399255|ref|ZP_07381121.1| DNA protecting protein DprA [Pantoea sp. aB] gi|304353181|gb|EFM17562.1| DNA protecting protein DprA [Pantoea sp. aB] Length = 374 Score = 36.3 bits (83), Expect = 1.4, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL LYP + +L EI + GG ISE P Sbjct: 167 LGSGLQNLYPKNHADLAAEIVEQGGAVISEFPL 199 >gi|184200719|ref|YP_001854926.1| putative DNA processing protein [Kocuria rhizophila DC2201] gi|183580949|dbj|BAG29420.1| putative DNA processing protein [Kocuria rhizophila DC2201] Length = 442 Score = 36.3 bits (83), Expect = 1.4, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +A G+D YP N LLE I G+ +SE+P G Sbjct: 232 LACGVDRAYPAANAELLERI-RQRGLVLSEVPLG 264 >gi|187250577|ref|YP_001875059.1| DNA protecting protein DprA [Elusimicrobium minutum Pei191] gi|186970737|gb|ACC97722.1| DNA protecting protein DprA (DNA processing chain A) [Elusimicrobium minutum Pei191] Length = 372 Score = 36.3 bits (83), Expect = 1.4, Method: Composition-based stats. Identities = 13/30 (43%), Positives = 18/30 (60%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 G+ YP EN+ L + +NGG ISE+ F Sbjct: 177 GIGRCYPAENKALANAVLENGGAIISELSF 206 >gi|261380552|ref|ZP_05985125.1| DNA processing protein DprA [Neisseria subflava NJ9703] gi|284796520|gb|EFC51867.1| DNA processing protein DprA [Neisseria subflava NJ9703] Length = 396 Score = 36.3 bits (83), Expect = 1.4, Method: Composition-based stats. Identities = 14/30 (46%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 G+D +YPP N+NL EI G+ +SE P Sbjct: 180 GIDRIYPPSNKNLAYEI-AERGLIVSEFPL 208 >gi|225027213|ref|ZP_03716405.1| hypothetical protein EUBHAL_01469 [Eubacterium hallii DSM 3353] gi|224955442|gb|EEG36651.1| hypothetical protein EUBHAL_01469 [Eubacterium hallii DSM 3353] Length = 373 Score = 36.3 bits (83), Expect = 1.4, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + GG+D +YP EN NL ++++ GG+ +SE G Sbjct: 171 LGGGIDTIYPVENFNLYQQVYQMGGV-LSEYNMG 203 >gi|295836279|ref|ZP_06823212.1| SMF protein [Streptomyces sp. SPB74] gi|197697356|gb|EDY44289.1| SMF protein [Streptomyces sp. SPB74] Length = 395 Score = 36.3 bits (83), Expect = 1.5, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +A G+D YPP + LL I + G+ + E+P G Sbjct: 186 LACGIDRSYPPGHARLLARIAEQ-GLLVGELPPG 218 >gi|146305098|ref|YP_001185563.1| DNA protecting protein DprA [Pseudomonas mendocina ymp] gi|145573299|gb|ABP82831.1| DNA protecting protein DprA [Pseudomonas mendocina ymp] Length = 368 Score = 36.3 bits (83), Expect = 1.5, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 21/33 (63%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+CLYP ++ L +I + GG +SE+P Sbjct: 179 LGTGLECLYPARHKRLAAQIIEQGGALVSELPL 211 >gi|229820997|ref|YP_002882523.1| DNA protecting protein DprA [Beutenbergia cavernae DSM 12333] gi|229566910|gb|ACQ80761.1| DNA protecting protein DprA [Beutenbergia cavernae DSM 12333] Length = 386 Score = 36.3 bits (83), Expect = 1.5, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YPP N +LL + G ++E+P G Sbjct: 186 LAGGLDRFYPPGNSDLLRAV-GRDGALVAELPPG 218 >gi|312792638|ref|YP_004025561.1| DNA protecting protein dpra [Caldicellulosiruptor kristjanssonii 177R1B] gi|312179778|gb|ADQ39948.1| DNA protecting protein DprA [Caldicellulosiruptor kristjanssonii 177R1B] Length = 365 Score = 36.3 bits (83), Expect = 1.5, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YP EN L +I +N G +SE G Sbjct: 171 LGCGVDIVYPKENLKLYRQIIEN-GCVVSEFLPG 203 >gi|312126810|ref|YP_003991684.1| DNA protecting protein dpra [Caldicellulosiruptor hydrothermalis 108] gi|311776829|gb|ADQ06315.1| DNA protecting protein DprA [Caldicellulosiruptor hydrothermalis 108] Length = 365 Score = 36.3 bits (83), Expect = 1.5, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YP EN L +I +N G +SE G Sbjct: 171 LGCGVDIVYPKENLKLYRQIIEN-GCVVSEFLPG 203 >gi|312135863|ref|YP_004003201.1| DNA protecting protein dpra [Caldicellulosiruptor owensensis OL] gi|311775914|gb|ADQ05401.1| DNA protecting protein DprA [Caldicellulosiruptor owensensis OL] Length = 365 Score = 36.3 bits (83), Expect = 1.5, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YP EN L +I +N G +SE G Sbjct: 171 LGCGVDIVYPKENLKLYRQIIEN-GCVVSEFLPG 203 >gi|227497528|ref|ZP_03927756.1| DNA protecting protein DprA [Actinomyces urogenitalis DSM 15434] gi|226833009|gb|EEH65392.1| DNA protecting protein DprA [Actinomyces urogenitalis DSM 15434] Length = 437 Score = 36.3 bits (83), Expect = 1.5, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 23/33 (69%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGG+D LYP N LL+E+ ++ G ++E+P G Sbjct: 232 AGGVDRLYPAGNATLLQEVIEH-GALVAEVPPG 263 >gi|254511723|ref|ZP_05123790.1| DNA protecting protein DprA [Rhodobacteraceae bacterium KLH11] gi|221535434|gb|EEE38422.1| DNA protecting protein DprA [Rhodobacteraceae bacterium KLH11] Length = 351 Score = 36.3 bits (83), Expect = 1.5, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 MAGG+D +YP EN +L +I G+ +SE P G Sbjct: 153 MAGGVDVIYPAENTDLARDI-AKSGLRLSEQPMG 185 >gi|126434555|ref|YP_001070246.1| DNA protecting protein DprA [Mycobacterium sp. JLS] gi|126234355|gb|ABN97755.1| DNA protecting protein DprA [Mycobacterium sp. JLS] Length = 376 Score = 36.3 bits (83), Expect = 1.5, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGG+D YP + LL I N G+ +SE P G Sbjct: 181 VAGGIDVPYPAGHSALLARIRAN-GLVLSEYPPG 213 >gi|331698494|ref|YP_004334733.1| DNA protecting protein DprA [Pseudonocardia dioxanivorans CB1190] gi|326953183|gb|AEA26880.1| DNA protecting protein DprA [Pseudonocardia dioxanivorans CB1190] Length = 396 Score = 36.3 bits (83), Expect = 1.6, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 MA G+D YP + LL I G+ +SE P G Sbjct: 200 MACGVDRAYPAAHSELLARI-AATGLVVSEYPPG 232 >gi|318075686|ref|ZP_07983018.1| DNA mediated transformation protein [Streptomyces sp. SA3_actF] Length = 212 Score = 36.3 bits (83), Expect = 1.6, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +A G+D YPP + LL I + G+ + E+P G Sbjct: 4 LACGIDRAYPPGHARLLARIAEQ-GLLLGELPPG 36 >gi|241760431|ref|ZP_04758525.1| DNA protecting protein DprA [Neisseria flavescens SK114] gi|241319100|gb|EER55593.1| DNA protecting protein DprA [Neisseria flavescens SK114] Length = 396 Score = 36.3 bits (83), Expect = 1.6, Method: Composition-based stats. Identities = 14/30 (46%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 G+D +YPP N+NL EI G+ +SE P Sbjct: 180 GIDRIYPPSNKNLAYEI-AERGLIVSEFPL 208 >gi|302382941|ref|YP_003818764.1| DNA protecting protein DprA [Brevundimonas subvibrioides ATCC 15264] gi|302193569|gb|ADL01141.1| DNA protecting protein DprA [Brevundimonas subvibrioides ATCC 15264] Length = 360 Score = 36.3 bits (83), Expect = 1.6, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + GG+D +YPP+N +L ++I G +SE P G Sbjct: 167 LGGGVDDVYPPDNASLYDQI-AQQGCIVSESPMG 199 >gi|225352788|ref|ZP_03743811.1| hypothetical protein BIFPSEUDO_04420 [Bifidobacterium pseudocatenulatum DSM 20438] gi|225156395|gb|EEG69964.1| hypothetical protein BIFPSEUDO_04420 [Bifidobacterium pseudocatenulatum DSM 20438] Length = 456 Score = 36.3 bits (83), Expect = 1.6, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 19/33 (57%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGGL+ + P N L E I ++ G ISE+ G Sbjct: 239 AGGLNYIGPKSNERLFETIINHSGALISELCPG 271 >gi|125972980|ref|YP_001036890.1| DNA protecting protein DprA [Clostridium thermocellum ATCC 27405] gi|256004777|ref|ZP_05429752.1| DNA protecting protein DprA [Clostridium thermocellum DSM 2360] gi|281417191|ref|ZP_06248211.1| DNA protecting protein DprA [Clostridium thermocellum JW20] gi|125713205|gb|ABN51697.1| DNA protecting protein DprA [Clostridium thermocellum ATCC 27405] gi|255991227|gb|EEU01334.1| DNA protecting protein DprA [Clostridium thermocellum DSM 2360] gi|281408593|gb|EFB38851.1| DNA protecting protein DprA [Clostridium thermocellum JW20] gi|316940784|gb|ADU74818.1| DNA protecting protein DprA [Clostridium thermocellum DSM 1313] Length = 370 Score = 36.3 bits (83), Expect = 1.6, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + GLD +YP EN+ L+E I ++ G +SE G Sbjct: 172 LGCGLDIVYPYENKKLMENIIES-GACLSEYLPG 204 >gi|330839578|ref|YP_004414158.1| DNA protecting protein DprA [Selenomonas sputigena ATCC 35185] gi|329747342|gb|AEC00699.1| DNA protecting protein DprA [Selenomonas sputigena ATCC 35185] Length = 364 Score = 36.3 bits (83), Expect = 1.6, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D YP EN LL EI G ISE G Sbjct: 171 LGCGVDVAYPRENARLLAEI-AEKGAVISEYAPG 203 >gi|108798955|ref|YP_639152.1| DNA processing protein DprA, putative [Mycobacterium sp. MCS] gi|119868070|ref|YP_938022.1| DNA protecting protein DprA [Mycobacterium sp. KMS] gi|108769374|gb|ABG08096.1| DNA protecting protein DprA [Mycobacterium sp. MCS] gi|119694159|gb|ABL91232.1| DNA protecting protein DprA [Mycobacterium sp. KMS] Length = 376 Score = 36.3 bits (83), Expect = 1.6, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGG+D YP + LL I N G+ +SE P G Sbjct: 181 VAGGIDVPYPAGHSALLARIRAN-GLVLSEYPPG 213 >gi|260554283|ref|ZP_05826533.1| DNA protecting protein DprA [Acinetobacter sp. RUH2624] gi|260404592|gb|EEW98112.1| DNA protecting protein DprA [Acinetobacter sp. RUH2624] Length = 376 Score = 36.3 bits (83), Expect = 1.6, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 16/31 (51%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD YP +N+ L E I G I+E G Sbjct: 182 GLDTTYPAQNKKLAEHILAQNGAIITEFLPG 212 >gi|183981827|ref|YP_001850118.1| hypothetical protein MMAR_1814 [Mycobacterium marinum M] gi|183175153|gb|ACC40263.1| conserved hypothetical membrane protein [Mycobacterium marinum M] Length = 391 Score = 36.3 bits (83), Expect = 1.6, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGG+D YP + LL I G+ ++E P G Sbjct: 183 LAGGIDIPYPTGHSALLHRI-GQHGLLVTEYPPG 215 >gi|330500989|ref|YP_004377858.1| DNA protecting protein DprA [Pseudomonas mendocina NK-01] gi|328915275|gb|AEB56106.1| DNA protecting protein DprA [Pseudomonas mendocina NK-01] Length = 372 Score = 36.3 bits (83), Expect = 1.7, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL CLYP + L I + GG +SE+P Sbjct: 183 LGTGLQCLYPRRHVGLAARIIEQGGALVSELPL 215 >gi|312621559|ref|YP_004023172.1| DNA protecting protein dpra [Caldicellulosiruptor kronotskyensis 2002] gi|312202026|gb|ADQ45353.1| DNA protecting protein DprA [Caldicellulosiruptor kronotskyensis 2002] Length = 365 Score = 36.3 bits (83), Expect = 1.7, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YP EN L +I +N G +SE G Sbjct: 171 LGCGVDIVYPKENLKLYRQIIEN-GCVVSEFLPG 203 >gi|330466300|ref|YP_004404043.1| DNA protecting protein DprA [Verrucosispora maris AB-18-032] gi|328809271|gb|AEB43443.1| DNA protecting protein DprA [Verrucosispora maris AB-18-032] Length = 391 Score = 35.9 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +A G+D YP N L + I D+ G+ +SE P Sbjct: 192 LACGVDRPYPVGNTALFDRIADS-GLLVSEWPP 223 >gi|312876485|ref|ZP_07736468.1| DNA protecting protein DprA [Caldicellulosiruptor lactoaceticus 6A] gi|311796696|gb|EFR13042.1| DNA protecting protein DprA [Caldicellulosiruptor lactoaceticus 6A] Length = 365 Score = 35.9 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YP EN L +I +N G +SE G Sbjct: 171 LGCGVDIVYPKENLKLYRQIIEN-GCVVSEFLPG 203 >gi|300933910|ref|ZP_07149166.1| putative DNA processing protein [Corynebacterium resistens DSM 45100] Length = 400 Score = 35.9 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +A GLD YP +N L ++I + G+ +SE G Sbjct: 200 LACGLDVNYPIKNAQLFQQI-THNGVLVSEYAPG 232 >gi|260886588|ref|ZP_05897851.1| DNA processing protein DprA [Selenomonas sputigena ATCC 35185] gi|260863731|gb|EEX78231.1| DNA processing protein DprA [Selenomonas sputigena ATCC 35185] Length = 370 Score = 35.9 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D YP EN LL EI G ISE G Sbjct: 177 LGCGVDVAYPRENARLLAEI-AEKGAVISEYAPG 209 >gi|332139432|ref|YP_004425170.1| DNA protecting protein DprA [Alteromonas macleodii str. 'Deep ecotype'] gi|327549454|gb|AEA96172.1| DNA protecting protein DprA [Alteromonas macleodii str. 'Deep ecotype'] Length = 369 Score = 35.9 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 21/34 (61%) Query: 1 [protein fragment, 34 aa] 34 M G D +YP +N L EI D+GG++++E G Sbjct: 174 MGTGPDKIYPAKNSKLYNEIHDSGGVSVTEFFPG 207 >gi|147669298|ref|YP_001214116.1| DNA protecting protein DprA [Dehalococcoides sp. BAV1] gi|146270246|gb|ABQ17238.1| DNA protecting protein DprA [Dehalococcoides sp. BAV1] Length = 373 Score = 35.9 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 15/32 (46%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Query: 3 GGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP EN +L +I G ISE P G Sbjct: 175 CGLDIIYPSENHSLARQI-AEDGALISEHPPG 205 >gi|225075474|ref|ZP_03718673.1| hypothetical protein NEIFLAOT_00479 [Neisseria flavescens NRL30031/H210] gi|224953193|gb|EEG34402.1| hypothetical protein NEIFLAOT_00479 [Neisseria flavescens NRL30031/H210] Length = 396 Score = 35.9 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 14/30 (46%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 G+D +YPP N+NL EI G+ +SE P Sbjct: 180 GIDRIYPPSNKNLAYEI-AERGLIVSEFPL 208 >gi|154504527|ref|ZP_02041265.1| hypothetical protein RUMGNA_02031 [Ruminococcus gnavus ATCC 29149] gi|153795009|gb|EDN77429.1| hypothetical protein RUMGNA_02031 [Ruminococcus gnavus ATCC 29149] Length = 360 Score = 35.9 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 18/34 (52%) Query: 1 [protein fragment, 34 aa] 34 + G+D YP + L +I + G +SE+P G Sbjct: 169 LGSGVDVCYPKNHMGLYLDILEQEGGILSELPPG 202 >gi|119475270|ref|ZP_01615623.1| SMF protein [marine gamma proteobacterium HTCC2143] gi|119451473|gb|EAW32706.1| SMF protein [marine gamma proteobacterium HTCC2143] Length = 368 Score = 35.9 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YP N+ L E I G ISE P G Sbjct: 173 LGTGIDIVYPRRNKELFESIVCQ-GAVISEFPMG 205 >gi|119387028|ref|YP_918083.1| DNA protecting protein DprA [Paracoccus denitrificans PD1222] gi|119377623|gb|ABL72387.1| DNA protecting protein DprA [Paracoccus denitrificans PD1222] Length = 418 Score = 35.9 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 MAGG+D +YP EN L EEI + G+ ++E P G Sbjct: 182 MAGGIDKIYPGENAALAEEICET-GLLVTEQPPG 214 >gi|222530148|ref|YP_002574030.1| DNA protecting protein DprA [Caldicellulosiruptor bescii DSM 6725] gi|222456995|gb|ACM61257.1| DNA protecting protein DprA [Caldicellulosiruptor bescii DSM 6725] Length = 365 Score = 35.9 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YP EN L +I +N G +SE G Sbjct: 171 LGCGVDIVYPKENLKLYRQIIEN-GCVVSEFLPG 203 >gi|312882740|ref|ZP_07742475.1| nucleotide-binding protein [Vibrio caribbenthicus ATCC BAA-2122] gi|309369598|gb|EFP97115.1| nucleotide-binding protein [Vibrio caribbenthicus ATCC BAA-2122] Length = 372 Score = 35.9 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 10/33 (30%), Positives = 17/33 (51%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP ++R L + I G ++E P Sbjct: 172 LGCGLGNVYPAQHRGLAQRILAEKGALVAEFPP 204 >gi|299144231|ref|ZP_07037311.1| DNA processing protein DprA [Peptoniphilus sp. oral taxon 386 str. F0131] gi|298518716|gb|EFI42455.1| DNA processing protein DprA [Peptoniphilus sp. oral taxon 386 str. F0131] Length = 362 Score = 35.9 bits (82), Expect = 1.8, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G+D +YP +N+ L +I +N G +SE P Sbjct: 173 LGSGVDVIYPIKNKKLYYDIVEN-GAVVSEYPP 204 >gi|260431072|ref|ZP_05785043.1| DNA protecting protein DprA [Silicibacter lacuscaerulensis ITI-1157] gi|260414900|gb|EEX08159.1| DNA protecting protein DprA [Silicibacter lacuscaerulensis ITI-1157] Length = 378 Score = 35.9 bits (82), Expect = 1.8, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 MAGG+D +YP EN +L +I G+ +SE P G Sbjct: 180 MAGGVDIIYPAENADLARDI-SKRGLRLSEQPMG 212 >gi|83589873|ref|YP_429882.1| DNA processing protein DprA, putative [Moorella thermoacetica ATCC 39073] gi|83572787|gb|ABC19339.1| DNA protecting protein DprA [Moorella thermoacetica ATCC 39073] Length = 361 Score = 35.9 bits (82), Expect = 1.8, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YP E+R L ++ ++ G ISE P G Sbjct: 171 LGCGVDIVYPREHRELYRQVMEH-GAIISEFPPG 203 >gi|269955977|ref|YP_003325766.1| DNA protecting protein DprA [Xylanimonas cellulosilytica DSM 15894] gi|269304658|gb|ACZ30208.1| DNA protecting protein DprA [Xylanimonas cellulosilytica DSM 15894] Length = 402 Score = 35.9 bits (82), Expect = 1.8, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 MAGG+D YP N LL + G ++E+P G Sbjct: 195 MAGGVDRFYPQGNHELLRRV-AETGTVVAEVPPG 227 >gi|257465867|ref|ZP_05630178.1| Smf protein [Fusobacterium gonidiaformans ATCC 25563] gi|315917024|ref|ZP_07913264.1| conserved hypothetical protein [Fusobacterium gonidiaformans ATCC 25563] gi|313690899|gb|EFS27734.1| conserved hypothetical protein [Fusobacterium gonidiaformans ATCC 25563] Length = 283 Score = 35.9 bits (82), Expect = 1.9, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP +N NL I G+ +SE P G Sbjct: 100 GLDEIYPKQNTNLWNRI-AKEGLLVSEYPLG 129 >gi|257452341|ref|ZP_05617640.1| Smf protein [Fusobacterium sp. 3_1_5R] gi|317058884|ref|ZP_07923369.1| SMF family protein [Fusobacterium sp. 3_1_5R] gi|313684560|gb|EFS21395.1| SMF family protein [Fusobacterium sp. 3_1_5R] Length = 283 Score = 35.9 bits (82), Expect = 1.9, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP +N NL I G+ +SE P G Sbjct: 100 GLDEIYPKQNTNLWNRI-AKEGLLVSEYPLG 129 >gi|220917985|ref|YP_002493289.1| DNA protecting protein DprA [Anaeromyxobacter dehalogenans 2CP-1] gi|219955839|gb|ACL66223.1| DNA protecting protein DprA [Anaeromyxobacter dehalogenans 2CP-1] Length = 320 Score = 35.9 bits (82), Expect = 1.9, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 22/34 (64%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YP ++R L E I + GG +SE+P G Sbjct: 128 LGTGVDVVYPRQHRALFEGILETGGALVSELPDG 161 >gi|327399011|ref|YP_004339880.1| DNA protecting protein DprA [Hippea maritima DSM 10411] gi|327181640|gb|AEA33821.1| DNA protecting protein DprA [Hippea maritima DSM 10411] Length = 333 Score = 35.9 bits (82), Expect = 1.9, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YP EN+ L +++ G I+E P G Sbjct: 146 LGCGIDIIYPKENKPLFDKM-SQEGCIITEFPLG 178 >gi|306821569|ref|ZP_07455167.1| DNA protecting protein DprA [Eubacterium yurii subsp. margaretiae ATCC 43715] gi|304550314|gb|EFM38307.1| DNA protecting protein DprA [Eubacterium yurii subsp. margaretiae ATCC 43715] Length = 237 Score = 35.9 bits (82), Expect = 1.9, Method: Composition-based stats. Identities = 14/29 (48%), Positives = 19/29 (65%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISE 30 A +D +YP ENR L EE+ +G + ISE Sbjct: 44 ATSVDKIYPAENRYLYEEVLADGNLIISE 72 >gi|307292856|ref|ZP_07572702.1| DNA protecting protein DprA [Sphingobium chlorophenolicum L-1] gi|306880922|gb|EFN12138.1| DNA protecting protein DprA [Sphingobium chlorophenolicum L-1] Length = 360 Score = 35.9 bits (82), Expect = 1.9, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +A G+D +PPEN +L +E N G+ ++E P G Sbjct: 164 IACGIDIAFPPENADL-QEQVANEGLLVTEHPPG 196 >gi|260557578|ref|ZP_05829792.1| rossmann fold nucleotide-binding protein [Acinetobacter baumannii ATCC 19606] gi|260408751|gb|EEX02055.1| rossmann fold nucleotide-binding protein [Acinetobacter baumannii ATCC 19606] Length = 376 Score = 35.9 bits (82), Expect = 1.9, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 16/31 (51%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD YP +N+ L E I G I+E G Sbjct: 182 GLDTTYPAQNKKLAEHILAQNGAIITEFLPG 212 >gi|182416693|ref|ZP_02948094.1| DNA uptake protein [Clostridium butyricum 5521] gi|237667207|ref|ZP_04527191.1| DNA protecting protein DprA [Clostridium butyricum E4 str. BoNT E BL5262] gi|182379455|gb|EDT76948.1| DNA uptake protein [Clostridium butyricum 5521] gi|237655555|gb|EEP53111.1| DNA protecting protein DprA [Clostridium butyricum E4 str. BoNT E BL5262] Length = 353 Score = 35.9 bits (82), Expect = 1.9, Method: Composition-based stats. Identities = 12/30 (40%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISE 30 + G+D +YP EN+ L +I + G+ ISE Sbjct: 167 LGCGIDRVYPAENKKLFSQI-EEKGVVISE 195 >gi|319950989|ref|ZP_08024859.1| DNA protecting protein DprA [Dietzia cinnamea P4] gi|319435332|gb|EFV90582.1| DNA protecting protein DprA [Dietzia cinnamea P4] Length = 401 Score = 35.9 bits (82), Expect = 2.0, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGG+D LYP N LL E+ G IS P G Sbjct: 197 LAGGVDRLYPRGNDGLLREV-AETGAVISAQPPG 229 >gi|313836671|gb|EFS74385.1| DNA protecting protein DprA [Propionibacterium acnes HL037PA2] gi|314928178|gb|EFS92009.1| DNA protecting protein DprA [Propionibacterium acnes HL044PA1] gi|314972177|gb|EFT16274.1| DNA protecting protein DprA [Propionibacterium acnes HL037PA3] Length = 377 Score = 35.9 bits (82), Expect = 2.0, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +A GLD YP N +LE+I G ISE+P G Sbjct: 178 LACGLDTFYPRGNTAVLEKI-AETGALISELPPG 210 >gi|300813844|ref|ZP_07094149.1| DNA protecting protein DprA [Peptoniphilus sp. oral taxon 836 str. F0141] gi|300512031|gb|EFK39226.1| DNA protecting protein DprA [Peptoniphilus sp. oral taxon 836 str. F0141] Length = 360 Score = 35.9 bits (82), Expect = 2.0, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YP N NL + D +SE PFG Sbjct: 173 LGNGIDIIYPKANTNLYMNLLDKA-TIVSEYPFG 205 >gi|282883340|ref|ZP_06291934.1| DNA protecting protein DprA [Peptoniphilus lacrimalis 315-B] gi|281296844|gb|EFA89346.1| DNA protecting protein DprA [Peptoniphilus lacrimalis 315-B] Length = 360 Score = 35.9 bits (82), Expect = 2.0, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YP N NL + D +SE PFG Sbjct: 173 LGNGIDIIYPKANTNLYMNLLDKA-TIVSEYPFG 205 >gi|255319593|ref|ZP_05360805.1| DNA protecting protein DprA [Acinetobacter radioresistens SK82] gi|262380779|ref|ZP_06073932.1| DNA protecting protein DprA [Acinetobacter radioresistens SH164] gi|255303348|gb|EET82553.1| DNA protecting protein DprA [Acinetobacter radioresistens SK82] gi|262297727|gb|EEY85643.1| DNA protecting protein DprA [Acinetobacter radioresistens SH164] Length = 376 Score = 35.9 bits (82), Expect = 2.0, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 18/31 (58%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP NR L E+I GG +SE G Sbjct: 182 GLDLVYPAHNRKLQEQILQYGGTIVSEFLPG 212 >gi|298370610|ref|ZP_06981925.1| smf protein [Neisseria sp. oral taxon 014 str. F0314] gi|298281220|gb|EFI22710.1| smf protein [Neisseria sp. oral taxon 014 str. F0314] Length = 393 Score = 35.9 bits (82), Expect = 2.0, Method: Composition-based stats. Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 G+D +YPP N++L EI G+ +SE P Sbjct: 180 GIDRIYPPSNKSLAYEI-AEKGLIVSEFPL 208 >gi|169797635|ref|YP_001715428.1| putative Rossmann-fold nucleotide-binding protein involved in DNA uptake (Smf) [Acinetobacter baumannii AYE] gi|213155571|ref|YP_002317616.1| DNA protecting protein DprA [Acinetobacter baumannii AB0057] gi|215484989|ref|YP_002327230.1| DNA protecting protein DprA [Acinetobacter baumannii AB307-0294] gi|301346866|ref|ZP_07227607.1| DNA protecting protein DprA [Acinetobacter baumannii AB056] gi|301512294|ref|ZP_07237531.1| DNA protecting protein DprA [Acinetobacter baumannii AB058] gi|301594508|ref|ZP_07239516.1| DNA protecting protein DprA [Acinetobacter baumannii AB059] gi|169150562|emb|CAM88471.1| putative Rossmann-fold nucleotide-binding protein involved in DNA uptake (Smf) [Acinetobacter baumannii AYE] gi|213054731|gb|ACJ39633.1| DNA protecting protein DprA [Acinetobacter baumannii AB0057] gi|213988661|gb|ACJ58960.1| DNA protecting protein DprA [Acinetobacter baumannii AB307-0294] Length = 376 Score = 35.9 bits (82), Expect = 2.1, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 16/31 (51%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD YP +N+ L E I G I+E G Sbjct: 182 GLDTTYPAQNKKLAEHILAQNGAIITEFLPG 212 >gi|56459131|ref|YP_154412.1| DNA uptake Rossmann fold nucleotide-binding protein [Idiomarina loihiensis L2TR] gi|56178141|gb|AAV80863.1| Predicted Rossmann fold nucleotide-binding protein involved in DNA uptake [Idiomarina loihiensis L2TR] Length = 336 Score = 35.9 bits (82), Expect = 2.1, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D YP N+ L ++ + G+ ISE P G Sbjct: 145 LGTGIDQYYPRRNKAL-QDFIAHQGLLISEFPPG 177 >gi|253573510|ref|ZP_04850853.1| DNA protecting protein DprA [Paenibacillus sp. oral taxon 786 str. D14] gi|251847038|gb|EES75043.1| DNA protecting protein DprA [Paenibacillus sp. oral taxon 786 str. D14] Length = 373 Score = 35.9 bits (82), Expect = 2.1, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + +D YPPE+ ++ I + G+ ISE P G Sbjct: 182 LGTAIDVAYPPEHVSMYRRIAEQ-GLVISEYPIG 214 >gi|333024159|ref|ZP_08452223.1| putative DNA processing Smf-family protein [Streptomyces sp. Tu6071] gi|332744011|gb|EGJ74452.1| putative DNA processing Smf-family protein [Streptomyces sp. Tu6071] Length = 371 Score = 35.9 bits (82), Expect = 2.1, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +A G+D YPP + LL I + G+ + E+P G Sbjct: 163 LACGIDRAYPPGHARLLARIAEQ-GLLLGELPPG 195 >gi|193076054|gb|ABO10649.2| putative Rossmann-fold nucleotide-binding DNA uptake protein (Smf) [Acinetobacter baumannii ATCC 17978] Length = 383 Score = 35.9 bits (82), Expect = 2.1, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 16/31 (51%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD YP +N+ L E I G I+E G Sbjct: 189 GLDTTYPAQNKKLAEHILAQNGAIITEFLPG 219 >gi|153873640|ref|ZP_02002157.1| SMF protein [Beggiatoa sp. PS] gi|152069893|gb|EDN67842.1| SMF protein [Beggiatoa sp. PS] Length = 295 Score = 35.9 bits (82), Expect = 2.1, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + GLD +YPP +R L ++I G +SE P G Sbjct: 174 LGWGLDQIYPPAHRELGDKI-AETGALVSEFPPG 206 >gi|318056577|ref|ZP_07975300.1| DNA processing Smf-family protein [Streptomyces sp. SA3_actG] Length = 395 Score = 35.9 bits (82), Expect = 2.1, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +A G+D YPP + LL I + G+ + E+P G Sbjct: 187 LACGIDRAYPPGHARLLARIAEQ-GLLLGELPPG 219 >gi|332852663|ref|ZP_08434317.1| DNA protecting protein DprA [Acinetobacter baumannii 6013150] gi|332869379|ref|ZP_08438757.1| DNA protecting protein DprA [Acinetobacter baumannii 6013113] gi|332729131|gb|EGJ60478.1| DNA protecting protein DprA [Acinetobacter baumannii 6013150] gi|332732797|gb|EGJ64013.1| DNA protecting protein DprA [Acinetobacter baumannii 6013113] Length = 383 Score = 35.9 bits (82), Expect = 2.1, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 16/31 (51%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD YP +N+ L E I G I+E G Sbjct: 189 GLDTTYPAQNKKLAEHILAQNGAIITEFLPG 219 >gi|170783520|ref|YP_001742013.1| putative smf family protein [Arthrobacter sp. AK-1] gi|150035007|gb|ABR67018.1| putative smf family protein [Arthrobacter sp. AK-1] Length = 399 Score = 35.9 bits (82), Expect = 2.1, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YP N +L I N G+ +SE+P G Sbjct: 281 LAGGLDRDYPSGNADLAAAIRAN-GLTLSELPPG 313 >gi|302522170|ref|ZP_07274512.1| DNA processing Smf-family protein [Streptomyces sp. SPB78] gi|302431065|gb|EFL02881.1| DNA processing Smf-family protein [Streptomyces sp. SPB78] Length = 395 Score = 35.9 bits (82), Expect = 2.2, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +A G+D YPP + LL I + G+ + E+P G Sbjct: 187 LACGIDRAYPPGHARLLARIAEQ-GLLLGELPPG 219 >gi|257064734|ref|YP_003144406.1| predicted Rossmann fold nucleotide-binding protein involved in DNA uptake [Slackia heliotrinireducens DSM 20476] gi|256792387|gb|ACV23057.1| predicted Rossmann fold nucleotide-binding protein involved in DNA uptake [Slackia heliotrinireducens DSM 20476] Length = 231 Score = 35.9 bits (82), Expect = 2.2, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 17/31 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GLD YP +N +L + I GG ++E Sbjct: 102 LGSGLDNPYPSDNIDLFQAIVGGGGCVVTEY 132 >gi|85711004|ref|ZP_01042065.1| Predicted Rossmann fold nucleotide-binding protein involved in DNA uptake [Idiomarina baltica OS145] gi|85695408|gb|EAQ33345.1| Predicted Rossmann fold nucleotide-binding protein involved in DNA uptake [Idiomarina baltica OS145] Length = 347 Score = 35.5 bits (81), Expect = 2.2, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YP NR L E+ + G+ ISE G Sbjct: 157 LGTGIDQIYPRRNRELY-ELISHQGLIISEFSPG 189 >gi|331091326|ref|ZP_08340166.1| hypothetical protein HMPREF9477_00809 [Lachnospiraceae bacterium 2_1_46FAA] gi|330404487|gb|EGG84031.1| hypothetical protein HMPREF9477_00809 [Lachnospiraceae bacterium 2_1_46FAA] Length = 361 Score = 35.5 bits (81), Expect = 2.2, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D YP EN L E++ + GG +SE P G Sbjct: 171 LGSGVDVCYPRENIGLYEDLQEKGG-ILSEQPLG 203 >gi|328907959|gb|EGG27719.1| DNA protecting protein DprA [Propionibacterium sp. P08] Length = 391 Score = 35.5 bits (81), Expect = 2.2, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +A GLD YP N +LE+I G ISE+P G Sbjct: 192 LACGLDTFYPRGNTAVLEKI-AETGALISELPPG 224 >gi|315104185|gb|EFT76161.1| DNA protecting protein DprA [Propionibacterium acnes HL050PA2] Length = 377 Score = 35.5 bits (81), Expect = 2.2, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +A GLD LYP N +LE+I G +SE+P G Sbjct: 178 LACGLDTLYPRGNSAVLEQI-AGTGALVSELPTG 210 >gi|302554439|ref|ZP_07306781.1| DNA processing Smf-family protein [Streptomyces viridochromogenes DSM 40736] gi|302472057|gb|EFL35150.1| DNA processing Smf-family protein [Streptomyces viridochromogenes DSM 40736] Length = 386 Score = 35.5 bits (81), Expect = 2.2, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +A G+D YP + L+ I D G+ + E+P G Sbjct: 181 LACGVDRPYPRGHAQLITRIADQ-GLVVGELPPG 213 >gi|154250247|ref|YP_001411072.1| DNA protecting protein DprA [Fervidobacterium nodosum Rt17-B1] gi|154154183|gb|ABS61415.1| DNA protecting protein DprA [Fervidobacterium nodosum Rt17-B1] Length = 333 Score = 35.5 bits (81), Expect = 2.2, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G+D +YP N L +EI N G ISE Sbjct: 151 LGCGVDYIYPKSNERLYQEIIKN-GCVISEY 180 >gi|149197252|ref|ZP_01874304.1| SMF family protein involved in DNA uptake [Lentisphaera araneosa HTCC2155] gi|149139798|gb|EDM28199.1| SMF family protein involved in DNA uptake [Lentisphaera araneosa HTCC2155] Length = 380 Score = 35.5 bits (81), Expect = 2.2, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GG+ +YP +N L +I D+ G +SE P Sbjct: 175 LGGGIGKIYPKDNLKLARDICDH-GALVSEYPI 206 >gi|117621477|ref|YP_854788.1| DNA protecting protein DprA [Aeromonas hydrophila subsp. hydrophila ATCC 7966] gi|117562884|gb|ABK39832.1| DNA protecting protein DprA [Aeromonas hydrophila subsp. hydrophila ATCC 7966] Length = 371 Score = 35.5 bits (81), Expect = 2.2, Method: Composition-based stats. Identities = 15/31 (48%), Positives = 20/31 (64%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GLDCLYP ++ L EI GG+ ISE+ Sbjct: 174 LGSGLDCLYPKRHQGLAMEILVRGGLLISEL 204 >gi|83945523|ref|ZP_00957870.1| dprA protein [Oceanicaulis alexandrii HTCC2633] gi|83851099|gb|EAP88957.1| dprA protein [Oceanicaulis alexandrii HTCC2633] Length = 372 Score = 35.5 bits (81), Expect = 2.2, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +AGGL +YPPE+ L I G+ +SE P Sbjct: 171 LAGGLTSIYPPEHEALYHAI-SEQGLLVSESPP 202 >gi|314923937|gb|EFS87768.1| DNA protecting protein DprA [Propionibacterium acnes HL001PA1] gi|314966118|gb|EFT10217.1| DNA protecting protein DprA [Propionibacterium acnes HL082PA2] gi|315094913|gb|EFT66889.1| DNA protecting protein DprA [Propionibacterium acnes HL060PA1] gi|327328005|gb|EGE69774.1| DNA processing / uptake protein [Propionibacterium acnes HL103PA1] Length = 377 Score = 35.5 bits (81), Expect = 2.3, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +A GLD LYP N +LE+I G +SE+P G Sbjct: 178 LACGLDTLYPRGNSAVLEQI-AGTGALVSELPTG 210 >gi|170079101|ref|YP_001735739.1| DNA protecting protein [Synechococcus sp. PCC 7002] gi|169886770|gb|ACB00484.1| DNA protecting protein [Synechococcus sp. PCC 7002] Length = 381 Score = 35.5 bits (81), Expect = 2.3, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YP +RNL EI G+ +SE P G Sbjct: 175 LGTGIDQIYPASHRNLYNEILAQ-GLILSEYPAG 207 >gi|319945033|ref|ZP_08019295.1| DNA processing SMF protein [Lautropia mirabilis ATCC 51599] gi|319741603|gb|EFV94028.1| DNA processing SMF protein [Lautropia mirabilis ATCC 51599] Length = 424 Score = 35.5 bits (81), Expect = 2.3, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 18/31 (58%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP + L + + GG+ +SE P G Sbjct: 195 GIDRIYPAHHLPLARRVLEQGGLVLSEQPLG 225 >gi|297183540|gb|ADI19669.1| predicted rossmann fold nucleotide-binding protein involved in DNA uptake [uncultured Alteromonadales bacterium HF4000_16C08] Length = 373 Score = 35.5 bits (81), Expect = 2.3, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 17/34 (50%) Query: 1 [protein fragment, 34 aa] 34 M G D +YP +N L ++I G I+E G Sbjct: 178 MGTGPDKVYPRKNSALHQDIISANGACITEFFPG 211 >gi|259909965|ref|YP_002650321.1| DNA protecting protein [Erwinia pyrifoliae Ep1/96] gi|224965587|emb|CAX57119.1| DNA protecting protein [Erwinia pyrifoliae Ep1/96] gi|283480065|emb|CAY75981.1| Protein smf [Erwinia pyrifoliae DSM 12163] Length = 374 Score = 35.5 bits (81), Expect = 2.3, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 21/33 (63%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP +++ L ++I D+GG +SE P Sbjct: 167 LGSGLQAVYPRQHQALAQQIIDSGGALVSEFPL 199 >gi|86159122|ref|YP_465907.1| DNA processing protein DprA [Anaeromyxobacter dehalogenans 2CP-C] gi|85775633|gb|ABC82470.1| DNA protecting protein DprA [Anaeromyxobacter dehalogenans 2CP-C] Length = 291 Score = 35.5 bits (81), Expect = 2.3, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 19/34 (55%) Query: 1 [protein fragment, 34 aa] 34 + G+D YP ++R L I GG +SE+P G Sbjct: 99 LGTGVDVAYPAQHRALFARILGAGGALVSELPDG 132 >gi|119716495|ref|YP_923460.1| DNA protecting protein DprA [Nocardioides sp. JS614] gi|119537156|gb|ABL81773.1| DNA protecting protein DprA [Nocardioides sp. JS614] Length = 349 Score = 35.5 bits (81), Expect = 2.3, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + GG+D YP + LLE I G+ +SE P G Sbjct: 187 LPGGVDRPYPAAHAQLLEAI-AERGLVVSEAPPG 219 >gi|317494306|ref|ZP_07952720.1| DNA protecting protein DprA [Enterobacteriaceae bacterium 9_2_54FAA] gi|316917556|gb|EFV38901.1| DNA protecting protein DprA [Enterobacteriaceae bacterium 9_2_54FAA] Length = 377 Score = 35.5 bits (81), Expect = 2.4, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 17/33 (51%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G+ LYP + +L I +N G ISE P Sbjct: 172 LGCGIAQLYPTCHEHLAARIVENNGAIISEFPP 204 >gi|172040495|ref|YP_001800209.1| putative DNA processing protein [Corynebacterium urealyticum DSM 7109] gi|171851799|emb|CAQ04775.1| putative DNA processing protein [Corynebacterium urealyticum DSM 7109] Length = 416 Score = 35.5 bits (81), Expect = 2.4, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +A GLD YP ++ L ++I G+ +SE G Sbjct: 213 LACGLDVDYPRQHVGLFKQI-AESGVVVSEYALG 245 >gi|89092293|ref|ZP_01165247.1| SMF protein [Oceanospirillum sp. MED92] gi|89083381|gb|EAR62599.1| SMF protein [Oceanospirillum sp. MED92] Length = 373 Score = 35.5 bits (81), Expect = 2.4, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 19/34 (55%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YP N++L E I N G +SE G Sbjct: 179 LGTGVDRIYPSRNQSLAESILSNKGAWVSEFFPG 212 >gi|218283549|ref|ZP_03489539.1| hypothetical protein EUBIFOR_02129 [Eubacterium biforme DSM 3989] gi|218215817|gb|EEC89355.1| hypothetical protein EUBIFOR_02129 [Eubacterium biforme DSM 3989] Length = 243 Score = 35.5 bits (81), Expect = 2.4, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G++ +YP EN L E + N G+ ISE P Sbjct: 129 LGCGINVIYPKENTYLFERM-KNNGLIISEYPM 160 >gi|251793282|ref|YP_003008010.1| DNA-processing chain A [Aggregatibacter aphrophilus NJ8700] gi|247534677|gb|ACS97923.1| protein smf (DNA-processing chain A) [Aggregatibacter aphrophilus NJ8700] Length = 371 Score = 35.5 bits (81), Expect = 2.4, Method: Composition-based stats. Identities = 12/30 (40%), Positives = 19/30 (63%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISE 30 + GL+ +YP ++R L +EI N G +SE Sbjct: 170 LGSGLEEIYPTKHRKLAQEIIANNGALVSE 199 >gi|217967909|ref|YP_002353415.1| DNA protecting protein DprA [Dictyoglomus turgidum DSM 6724] gi|217337008|gb|ACK42801.1| DNA protecting protein DprA [Dictyoglomus turgidum DSM 6724] Length = 364 Score = 35.5 bits (81), Expect = 2.4, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + LD +YP N L E+I ++ G ISE P G Sbjct: 172 LGSSLDHIYPSGNLKLAEKIMES-GAIISEYPLG 204 >gi|152972194|ref|YP_001337340.1| DNA protecting protein DprA [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] gi|330002242|ref|ZP_08304253.1| DNA protecting protein DprA [Klebsiella sp. MS 92-3] gi|150957043|gb|ABR79073.1| putative competence protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] gi|328537381|gb|EGF63630.1| DNA protecting protein DprA [Klebsiella sp. MS 92-3] Length = 374 Score = 35.5 bits (81), Expect = 2.5, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP + L +I DNGG +SE P Sbjct: 167 LGNGLSQVYPRRHATLARQIIDNGGTLVSEFPL 199 >gi|53803082|ref|YP_115235.1| DNA processing protein DprA [Methylococcus capsulatus str. Bath] gi|53756843|gb|AAU91134.1| putative DNA processing protein DprA [Methylococcus capsulatus str. Bath] Length = 364 Score = 35.5 bits (81), Expect = 2.5, Method: Composition-based stats. Identities = 12/32 (37%), Positives = 19/32 (59%) Query: 3 GGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G D +YP ++ L + I +GG+ +SE P G Sbjct: 174 CGPDRVYPSRHQRLADAIVGSGGVLVSEAPPG 205 >gi|158313010|ref|YP_001505518.1| DNA protecting protein DprA [Frankia sp. EAN1pec] gi|158108415|gb|ABW10612.1| DNA protecting protein DprA [Frankia sp. EAN1pec] Length = 408 Score = 35.5 bits (81), Expect = 2.5, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGG+D YP + +LL+EI G+ +SE P G Sbjct: 184 LAGGVDVPYPAAHADLLDEI-AASGLVLSETPPG 216 >gi|295111023|emb|CBL27773.1| DNA protecting protein DprA [Synergistetes bacterium SGP1] Length = 363 Score = 35.5 bits (81), Expect = 2.5, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YP E+R L +I G +SE P G Sbjct: 168 LGTGIDRVYPMEHRELFAQI-AETGALVSEYPMG 200 >gi|91226256|ref|ZP_01261096.1| hypothetical protein V12G01_10321 [Vibrio alginolyticus 12G01] gi|91189267|gb|EAS75546.1| hypothetical protein V12G01_10321 [Vibrio alginolyticus 12G01] Length = 329 Score = 35.5 bits (81), Expect = 2.5, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 20/31 (64%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 +A GL+ +YP +N+ L EI + G+ I+E Sbjct: 169 LAHGLEKVYPAQNKELASEIVKSNGLLITEY 199 >gi|331269644|ref|YP_004396136.1| DNA uptake protein [Clostridium botulinum BKT015925] gi|329126194|gb|AEB76139.1| DNA uptake protein [Clostridium botulinum BKT015925] Length = 359 Score = 35.5 bits (81), Expect = 2.5, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YP EN+ L +I N G IS+ G Sbjct: 169 LGSGIDVIYPKENKYLYNDIIKN-GCVISQFLPG 201 >gi|126640267|ref|YP_001083251.1| putative Rossmann-fold nucleotide-binding DNA uptake protein (Smf) [Acinetobacter baumannii ATCC 17978] Length = 362 Score = 35.5 bits (81), Expect = 2.5, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 16/31 (51%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD YP +N+ L E I G I+E G Sbjct: 168 GLDTTYPAQNKKLAEHILAQNGAIITEFLPG 198 >gi|295093364|emb|CBK82455.1| DNA protecting protein DprA [Coprococcus sp. ART55/1] Length = 359 Score = 35.5 bits (81), Expect = 2.5, Method: Composition-based stats. Identities = 10/30 (33%), Positives = 19/30 (63%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISE 30 + G++ YP EN ++ +I + GG+ +SE Sbjct: 172 LGSGINVPYPRENYDIYHDIRNGGGVVLSE 201 >gi|15603464|ref|NP_246538.1| hypothetical protein PM1599 [Pasteurella multocida subsp. multocida str. Pm70] gi|12721995|gb|AAK03683.1| DprA [Pasteurella multocida subsp. multocida str. Pm70] Length = 373 Score = 35.5 bits (81), Expect = 2.6, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISE-IPF 33 + GL+ +YP ++R L E+I ++ G +SE +PF Sbjct: 169 LGSGLEVIYPKKHRGLAEKIIEHQGALVSEFLPF 202 >gi|238896782|ref|YP_002921527.1| DNA protecting protein DprA [Klebsiella pneumoniae NTUH-K2044] gi|238549109|dbj|BAH65460.1| putative competence protein [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044] Length = 374 Score = 35.5 bits (81), Expect = 2.6, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP + L +I DNGG +SE P Sbjct: 167 LGNGLSQVYPRRHATLARQIIDNGGTLVSEFPL 199 >gi|284992379|ref|YP_003410933.1| DNA protecting protein DprA [Geodermatophilus obscurus DSM 43160] gi|284065624|gb|ADB76562.1| DNA protecting protein DprA [Geodermatophilus obscurus DSM 43160] Length = 422 Score = 35.5 bits (81), Expect = 2.6, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +A G+D +YP + L I G+ +SE P G Sbjct: 215 LACGVDRVYPSAHGALFHRI-AESGLLVSEWPPG 247 >gi|262040755|ref|ZP_06013986.1| DNA protecting protein DprA [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC 13884] gi|259041899|gb|EEW42939.1| DNA protecting protein DprA [Klebsiella pneumoniae subsp. rhinoscleromatis ATCC 13884] Length = 379 Score = 35.5 bits (81), Expect = 2.6, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP + L +I DNGG +SE P Sbjct: 172 LGNGLSQVYPRRHATLARQIIDNGGTLVSEFPL 204 >gi|256545486|ref|ZP_05472848.1| DNA processing protein DprA [Anaerococcus vaginalis ATCC 51170] gi|256398882|gb|EEU12497.1| DNA processing protein DprA [Anaerococcus vaginalis ATCC 51170] Length = 359 Score = 35.5 bits (81), Expect = 2.7, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GLD +YP N+ L E+I + G ISE P Sbjct: 167 IGSGLDIIYPKANKYLYEKI-EEKGAIISEFPL 198 >gi|148654174|ref|YP_001281267.1| DNA protecting protein DprA [Psychrobacter sp. PRwf-1] gi|148573258|gb|ABQ95317.1| DNA protecting protein DprA [Psychrobacter sp. PRwf-1] Length = 421 Score = 35.5 bits (81), Expect = 2.7, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 19/34 (55%) Query: 1 [protein fragment, 34 aa] 34 M G+D YP +++ L + + GG +SE+ G Sbjct: 186 MGTGIDVCYPKQHQALFDRMIAEGGCIVSELFPG 219 >gi|325129152|gb|EGC52000.1| putative DNA processing protein DprA [Neisseria meningitidis N1568] Length = 397 Score = 35.5 bits (81), Expect = 2.7, Method: Composition-based stats. Identities = 14/30 (46%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 G+D +YPP N+NL EI G+ +SE P Sbjct: 180 GIDRIYPPSNKNLAYEI-AERGLIVSEFPL 208 >gi|145300984|ref|YP_001143825.1| DNA processing chain A [Aeromonas salmonicida subsp. salmonicida A449] gi|142853756|gb|ABO92077.1| DNA processing chain A [Aeromonas salmonicida subsp. salmonicida A449] Length = 371 Score = 35.5 bits (81), Expect = 2.7, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 22/31 (70%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GLDCLYP ++ L +I ++GG+ ISE+ Sbjct: 174 LGSGLDCLYPKRHQGLAGQILESGGLLISEL 204 >gi|113460558|ref|YP_718622.1| DNA processing chain A [Haemophilus somnus 129PT] gi|112822601|gb|ABI24690.1| DNA processing chain A [Haemophilus somnus 129PT] Length = 368 Score = 35.5 bits (81), Expect = 2.7, Method: Composition-based stats. Identities = 12/30 (40%), Positives = 21/30 (70%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISE 30 + GGL+ LYP +++ L +++ D GG +SE Sbjct: 170 LGGGLEELYPKQHKKLAQQMLDYGGALVSE 199 >gi|258514507|ref|YP_003190729.1| DNA protecting protein DprA [Desulfotomaculum acetoxidans DSM 771] gi|257778212|gb|ACV62106.1| DNA protecting protein DprA [Desulfotomaculum acetoxidans DSM 771] Length = 366 Score = 35.5 bits (81), Expect = 2.8, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ +YP ENR L+E I G ISE P Sbjct: 172 LGSGLNVIYPRENRKLMERI-AASGAVISEFPL 203 >gi|170783575|ref|YP_001740092.1| putative smf family protein [Arthrobacter sp. Chr15] gi|150035083|gb|ABR67079.1| putative smf family protein [Arthrobacter sp. Chr15] Length = 302 Score = 35.5 bits (81), Expect = 2.8, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YP N +L I G+ +SE+P G Sbjct: 184 LAGGLDRDYPSGNADLAAAI-RGNGLTLSELPPG 216 >gi|330831508|ref|YP_004394460.1| DNA processing chain A [Aeromonas veronii B565] gi|328806644|gb|AEB51843.1| DNA processing chain A [Aeromonas veronii B565] Length = 371 Score = 35.5 bits (81), Expect = 2.8, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 21/31 (67%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GLDCLYP ++ L +I + GG+ ISE+ Sbjct: 174 LGSGLDCLYPKRHQGLAGQILEKGGLLISEL 204 >gi|320103360|ref|YP_004178951.1| DNA protecting protein DprA [Isosphaera pallida ATCC 43644] gi|319750642|gb|ADV62402.1| DNA protecting protein DprA [Isosphaera pallida ATCC 43644] Length = 453 Score = 35.1 bits (80), Expect = 2.9, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 MA GL+ +YPPE+ L + I G +SE P Sbjct: 185 MANGLNSIYPPEHDRLADRIVQQ-GALLSESPM 216 >gi|184156508|ref|YP_001844847.1| Rossmann fold nucleotide-binding protein [Acinetobacter baumannii ACICU] gi|183208102|gb|ACC55500.1| predicted Rossmann fold nucleotide-binding protein [Acinetobacter baumannii ACICU] Length = 376 Score = 35.1 bits (80), Expect = 2.9, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 16/31 (51%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD YP +N+ L E I G I+E G Sbjct: 182 GLDTTYPAQNKKLAEHILAKNGAIITEFLPG 212 >gi|212695500|ref|ZP_03303628.1| hypothetical protein ANHYDRO_00016 [Anaerococcus hydrogenalis DSM 7454] gi|212677500|gb|EEB37107.1| hypothetical protein ANHYDRO_00016 [Anaerococcus hydrogenalis DSM 7454] Length = 359 Score = 35.1 bits (80), Expect = 2.9, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GLD +YP N+ L E+I + G+ ISE P Sbjct: 167 IGSGLDIIYPKANKYLYEKI-EEKGLIISEFPL 198 >gi|300871631|ref|YP_003786504.1| DNA protecting protein DprA [Brachyspira pilosicoli 95/1000] gi|300689332|gb|ADK32003.1| DNA protecting protein, DprA [Brachyspira pilosicoli 95/1000] Length = 401 Score = 35.1 bits (80), Expect = 2.9, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YP EN + ++ + G+ ISE G Sbjct: 164 LGCGIDNVYPSENLKVYNKLIE-KGLIISEFEVG 196 >gi|219871700|ref|YP_002476075.1| Smf protein, Rossmann fold nucleotide-binding protein involved in DNA uptake [Haemophilus parasuis SH0165] gi|219691904|gb|ACL33127.1| Smf protein, Rossmann fold nucleotide-binding protein involved in DNA uptake [Haemophilus parasuis SH0165] Length = 375 Score = 35.1 bits (80), Expect = 2.9, Method: Composition-based stats. Identities = 11/30 (36%), Positives = 17/30 (56%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISE 30 + GLD +YP ++ L E+I G +SE Sbjct: 169 LGSGLDQVYPARHKKLAEQIVATSGALVSE 198 >gi|121633994|ref|YP_974239.1| SMF-family protein [Neisseria meningitidis FAM18] gi|120865700|emb|CAM09427.1| SMF-family protein [Neisseria meningitidis FAM18] Length = 397 Score = 35.1 bits (80), Expect = 2.9, Method: Composition-based stats. Identities = 14/30 (46%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 G+D +YPP N+NL EI G+ +SE P Sbjct: 180 GIDRIYPPSNKNLAYEI-AERGLIVSEFPL 208 >gi|170718904|ref|YP_001784075.1| DNA protecting protein DprA [Haemophilus somnus 2336] gi|168827033|gb|ACA32404.1| DNA protecting protein DprA [Haemophilus somnus 2336] Length = 368 Score = 35.1 bits (80), Expect = 3.0, Method: Composition-based stats. Identities = 12/30 (40%), Positives = 21/30 (70%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISE 30 + GGL+ LYP +++ L +++ D GG +SE Sbjct: 170 LGGGLEELYPKQHKKLAQQMLDYGGALVSE 199 >gi|323516244|gb|ADX90625.1| Rossmann fold nucleotide-binding protein [Acinetobacter baumannii TCDC-AB0715] Length = 383 Score = 35.1 bits (80), Expect = 3.0, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 16/31 (51%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD YP +N+ L E I G I+E G Sbjct: 189 GLDTTYPAQNKKLAEHILAKNGAIITEFLPG 219 >gi|294631663|ref|ZP_06710223.1| smf family protein [Streptomyces sp. e14] gi|292834996|gb|EFF93345.1| smf family protein [Streptomyces sp. e14] Length = 376 Score = 35.1 bits (80), Expect = 3.0, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +A G+D YP + L++ I + G+ + E+P G Sbjct: 171 LACGVDRPYPRGHAALIDRIAEQ-GLVVGELPPG 203 >gi|162145885|ref|YP_001600343.1| DNA processing chain A [Gluconacetobacter diazotrophicus PAl 5] gi|161784459|emb|CAP53989.1| putative DNA processing chain A [Gluconacetobacter diazotrophicus PAl 5] Length = 395 Score = 35.1 bits (80), Expect = 3.0, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YPP++ L I + G+ ++E P G Sbjct: 168 VAGGLDRPYPPDHAELQGRIAQH-GVVVTETPLG 200 >gi|218960463|ref|YP_001740238.1| DNA processing protein DprA, putative (fragment) [Candidatus Cloacamonas acidaminovorans] gi|167729120|emb|CAO80031.1| DNA processing protein DprA, putative (fragment) [Candidatus Cloacamonas acidaminovorans] Length = 362 Score = 35.1 bits (80), Expect = 3.1, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 A GLD +YPP N+ L E I +N G +SE G Sbjct: 174 ASGLDNIYPPMNKTLAENICEN-GALVSEYEPG 205 >gi|296171474|ref|ZP_06852760.1| smf family protein [Mycobacterium parascrofulaceum ATCC BAA-614] gi|295894160|gb|EFG73920.1| smf family protein [Mycobacterium parascrofulaceum ATCC BAA-614] Length = 250 Score = 35.1 bits (80), Expect = 3.1, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YP + LL I G+ +E P G Sbjct: 184 LAGGLDVPYPSGHSALLHRI-GQHGLLFTEYPPG 216 >gi|260655606|ref|ZP_05861092.1| DNA protecting protein DprA [Jonquetella anthropi E3_33 E1] gi|260629659|gb|EEX47853.1| DNA protecting protein DprA [Jonquetella anthropi E3_33 E1] Length = 366 Score = 35.1 bits (80), Expect = 3.1, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 18/34 (52%) Query: 1 [protein fragment, 34 aa] 34 + G+D ++P + L I +GG ISE P G Sbjct: 170 LGTGVDVVWPRGHEELFSRIIGSGGSLISEYPLG 203 >gi|260907247|ref|ZP_05915569.1| DNA protecting protein DprA [Brevibacterium linens BL2] Length = 404 Score = 35.1 bits (80), Expect = 3.1, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 MAGG+D YP N L +++ ++ G +SE G Sbjct: 199 MAGGVDRFYPVANTELFQQVLED-GAIVSETAPG 231 >gi|150016069|ref|YP_001308323.1| DNA protecting protein DprA [Clostridium beijerinckii NCIMB 8052] gi|149902534|gb|ABR33367.1| DNA protecting protein DprA [Clostridium beijerinckii NCIMB 8052] Length = 351 Score = 35.1 bits (80), Expect = 3.1, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D YP EN+ L +I G+ ISE G Sbjct: 167 LGCGIDRTYPSENKMLFSKI-AEKGVVISEFLLG 199 >gi|323359718|ref|YP_004226114.1| Rossmann fold nucleotide-binding protein [Microbacterium testaceum StLB037] gi|323276089|dbj|BAJ76234.1| predicted Rossmann fold nucleotide-binding protein [Microbacterium testaceum StLB037] Length = 387 Score = 35.1 bits (80), Expect = 3.1, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGG+D YP + LL+ I D G SE P G Sbjct: 194 LAGGVDRAYPRGHEGLLDRIADT-GAVWSETPCG 226 >gi|306836382|ref|ZP_07469360.1| DNA protecting protein DprA [Corynebacterium accolens ATCC 49726] gi|304567742|gb|EFM43329.1| DNA protecting protein DprA [Corynebacterium accolens ATCC 49726] Length = 393 Score = 35.1 bits (80), Expect = 3.1, Method: Composition-based stats. Identities = 14/29 (48%), Positives = 18/29 (62%), Gaps = 1/29 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISE 30 A G+D YP NR L ++I DN G +SE Sbjct: 193 ACGIDKNYPARNRGLFDQIADN-GCIVSE 220 >gi|226324651|ref|ZP_03800169.1| hypothetical protein COPCOM_02436 [Coprococcus comes ATCC 27758] gi|225207099|gb|EEG89453.1| hypothetical protein COPCOM_02436 [Coprococcus comes ATCC 27758] Length = 365 Score = 35.1 bits (80), Expect = 3.1, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + GG D YP ++ L +++ GG +SE P G Sbjct: 171 LGGGADVCYPAAHKGLYKDLIKRGG-ILSEQPPG 203 >gi|317508418|ref|ZP_07966088.1| DNA recombination-mediator protein A [Segniliparus rugosus ATCC BAA-974] gi|316253265|gb|EFV12665.1| DNA recombination-mediator protein A [Segniliparus rugosus ATCC BAA-974] Length = 382 Score = 35.1 bits (80), Expect = 3.2, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +A G+D YP + L I N G +SE P G Sbjct: 188 LACGVDVAYPAGHVQLFRRIAAN-GAVLSEYPPG 220 >gi|313206318|ref|YP_004045495.1| DNA protecting protein dpra [Riemerella anatipestifer DSM 15868] gi|312445634|gb|ADQ81989.1| DNA protecting protein DprA [Riemerella anatipestifer DSM 15868] gi|315023184|gb|EFT36195.1| Smf protein DNA processing chain A [Riemerella anatipestifer RA-YM] gi|325336237|gb|ADZ12511.1| Predicted Rossmann fold nucleotide-binding protein involved in DNA uptake [Riemerella anatipestifer RA-GD] Length = 367 Score = 35.1 bits (80), Expect = 3.2, Method: Composition-based stats. Identities = 14/30 (46%), Positives = 20/30 (66%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISE 30 +A GL +YP +++ L EEI +NGG SE Sbjct: 174 LAHGLHIIYPSKHKILAEEILNNGGALFSE 203 >gi|302558131|ref|ZP_07310473.1| SMF protein [Streptomyces griseoflavus Tu4000] gi|302475749|gb|EFL38842.1| SMF protein [Streptomyces griseoflavus Tu4000] Length = 386 Score = 35.1 bits (80), Expect = 3.2, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +A G+D YP + L+ I + G+ + E+P G Sbjct: 181 LACGVDRPYPRGHTGLIGRIAEQ-GLVVGELPPG 213 >gi|209543807|ref|YP_002276036.1| DNA protecting protein DprA [Gluconacetobacter diazotrophicus PAl 5] gi|209531484|gb|ACI51421.1| DNA protecting protein DprA [Gluconacetobacter diazotrophicus PAl 5] Length = 395 Score = 35.1 bits (80), Expect = 3.2, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YPP++ L I + G+ ++E P G Sbjct: 168 VAGGLDRPYPPDHAELQGRIAQH-GVVVTETPLG 200 >gi|229552205|ref|ZP_04440930.1| Rossmann fold nucleotide-binding protein for DNA uptake [Lactobacillus rhamnosus LMS2-1] gi|229314427|gb|EEN80400.1| Rossmann fold nucleotide-binding protein for DNA uptake [Lactobacillus rhamnosus LMS2-1] Length = 271 Score = 35.1 bits (80), Expect = 3.3, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +A G+D +YP +NR+L +I G+ +SE P G Sbjct: 152 IANGIDQVYPAKNRSLQRQI-SRVGLVVSEYPPG 184 >gi|199599535|ref|ZP_03212923.1| Rossmann fold nucleotide-binding protein for DNA uptake [Lactobacillus rhamnosus HN001] gi|258508405|ref|YP_003171156.1| DNA processing SMF protein [Lactobacillus rhamnosus GG] gi|199589576|gb|EDY97694.1| Rossmann fold nucleotide-binding protein for DNA uptake [Lactobacillus rhamnosus HN001] gi|257148332|emb|CAR87305.1| DNA processing SMF protein [Lactobacillus rhamnosus GG] gi|259649720|dbj|BAI41882.1| putative DNA processing protein [Lactobacillus rhamnosus GG] Length = 271 Score = 35.1 bits (80), Expect = 3.3, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +A G+D +YP +NR+L +I G+ +SE P G Sbjct: 152 IANGIDQVYPAKNRSLQRQI-SRVGLVVSEYPPG 184 >gi|57234466|ref|YP_181459.1| DNA processing protein DprA, putative [Dehalococcoides ethenogenes 195] gi|57224914|gb|AAW39971.1| DNA processing protein DprA, putative [Dehalococcoides ethenogenes 195] Length = 406 Score = 35.1 bits (80), Expect = 3.3, Method: Composition-based stats. Identities = 15/32 (46%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Query: 3 GGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP EN L +I +N G +SE P G Sbjct: 208 CGLDIIYPSENSCLARQIAEN-GALVSEHPPG 238 >gi|332976751|gb|EGK13582.1| DNA processing protein DprA [Desmospora sp. 8437] Length = 396 Score = 35.1 bits (80), Expect = 3.3, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YP +R+L +E+ G ISE+P G Sbjct: 205 LGCGVDVVYPRHHRDLYKEVV-RKGAVISEVPPG 237 >gi|258517150|ref|YP_003193372.1| DNA protecting protein DprA [Desulfotomaculum acetoxidans DSM 771] gi|257780855|gb|ACV64749.1| DNA protecting protein DprA [Desulfotomaculum acetoxidans DSM 771] Length = 368 Score = 35.1 bits (80), Expect = 3.4, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G+D YP E+R L++ I G+ +SE P Sbjct: 171 LGCGVDVCYPAEHRGLMDRI-AEEGVLLSEYPP 202 >gi|258539619|ref|YP_003174118.1| DNA processing SMF protein [Lactobacillus rhamnosus Lc 705] gi|257151295|emb|CAR90267.1| DNA processing SMF protein [Lactobacillus rhamnosus Lc 705] Length = 271 Score = 35.1 bits (80), Expect = 3.4, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +A G+D +YP +NR+L +I G+ +SE P G Sbjct: 152 IANGIDQVYPAKNRSLQRQI-SRVGLVVSEYPPG 184 >gi|325473778|gb|EGC76966.1| DNA processing protein DprA [Treponema denticola F0402] Length = 310 Score = 35.1 bits (80), Expect = 3.4, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 19/34 (55%) Query: 1 [protein fragment, 34 aa] 34 +A G + +YP N+ L I ++GG +SE G Sbjct: 174 LACGPEMIYPRSNKKLAANILESGGCILSEYAPG 207 >gi|17228820|ref|NP_485368.1| DNA processing protein [Nostoc sp. PCC 7120] gi|17130672|dbj|BAB73282.1| DNA processing protein [Nostoc sp. PCC 7120] Length = 372 Score = 35.1 bits (80), Expect = 3.4, Method: Composition-based stats. Identities = 13/32 (40%), Positives = 22/32 (68%), Gaps = 1/32 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIP 32 + G+D +YP +NR+L ++I N G+ +SE P Sbjct: 177 LGTGVDVVYPHKNRDLYQQILTN-GLVVSEYP 207 >gi|256847172|ref|ZP_05552618.1| DNA protecting protein DprA [Lactobacillus coleohominis 101-4-CHN] gi|256715836|gb|EEU30811.1| DNA protecting protein DprA [Lactobacillus coleohominis 101-4-CHN] Length = 293 Score = 35.1 bits (80), Expect = 3.5, Method: Composition-based stats. Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 GL+ +YPPE+ L +I + G+ ISE P Sbjct: 171 GLNRIYPPEHDRLQRQIKRH-GLLISEYPL 199 >gi|332967865|gb|EGK06961.1| SMF-family protein [Kingella kingae ATCC 23330] Length = 401 Score = 35.1 bits (80), Expect = 3.5, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP N+ L +I G ISE P G Sbjct: 185 GIDRIYPQSNQKLAYQI-AERGAIISEFPLG 214 >gi|253682393|ref|ZP_04863190.1| DNA protecting protein DprA [Clostridium botulinum D str. 1873] gi|253562105|gb|EES91557.1| DNA protecting protein DprA [Clostridium botulinum D str. 1873] Length = 359 Score = 35.1 bits (80), Expect = 3.5, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YP EN+ L EI N G IS+ G Sbjct: 169 LGSGIDVIYPKENKYLYSEIIKN-GCVISQFLPG 201 >gi|291557378|emb|CBL34495.1| Predicted Rossmann fold nucleotide-binding protein involved in DNA uptake [Eubacterium siraeum V10Sc8a] Length = 492 Score = 35.1 bits (80), Expect = 3.5, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 19/31 (61%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 +A G+ YP + L + I DNGG+ +SE+ Sbjct: 167 LACGITIDYPNNSFGLRKNIIDNGGLILSEL 197 >gi|302525184|ref|ZP_07277526.1| DNA processing chain A [Streptomyces sp. AA4] gi|302434079|gb|EFL05895.1| DNA processing chain A [Streptomyces sp. AA4] Length = 390 Score = 35.1 bits (80), Expect = 3.5, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 15/33 (45%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + +D YP N LL+ I GG +SE Sbjct: 191 LGCAVDYSYPVGNSGLLDRIVAEGGAIVSEYAP 223 >gi|93007287|ref|YP_581724.1| DNA processing protein DprA, putative [Psychrobacter cryohalolentis K5] gi|92394965|gb|ABE76240.1| DNA processing protein DprA, putative [Psychrobacter cryohalolentis K5] Length = 407 Score = 35.1 bits (80), Expect = 3.6, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 17/31 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 M G+D YP + L +I + GG ISE+ Sbjct: 186 MGTGIDVNYPNHHDRLFSQIIEQGGCIISEL 216 >gi|219847449|ref|YP_002461882.1| DNA protecting protein DprA [Chloroflexus aggregans DSM 9485] gi|219541708|gb|ACL23446.1| DNA protecting protein DprA [Chloroflexus aggregans DSM 9485] Length = 362 Score = 35.1 bits (80), Expect = 3.6, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +A G D +YP NR L E+I G IS+ P G Sbjct: 173 LACGADRVYPERNRILAEQIVT-AGALISDYPLG 205 >gi|312194959|ref|YP_004015020.1| DNA protecting protein DprA [Frankia sp. EuI1c] gi|311226295|gb|ADP79150.1| DNA protecting protein DprA [Frankia sp. EuI1c] Length = 414 Score = 35.1 bits (80), Expect = 3.6, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +A G+D YP + LL+EI G+ +SE+P G Sbjct: 186 LACGVDIPYPAAHLRLLDEI-RERGLLVSEVPPG 218 >gi|227488615|ref|ZP_03918931.1| DNA processing protein [Corynebacterium glucuronolyticum ATCC 51867] gi|227543218|ref|ZP_03973267.1| DNA processing protein [Corynebacterium glucuronolyticum ATCC 51866] gi|227091509|gb|EEI26821.1| DNA processing protein [Corynebacterium glucuronolyticum ATCC 51867] gi|227181027|gb|EEI61999.1| DNA processing protein [Corynebacterium glucuronolyticum ATCC 51866] Length = 412 Score = 35.1 bits (80), Expect = 3.7, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 A GLD YP N +L I + G +SE P G Sbjct: 214 ASGLDVTYPASNADLFARIATH-GCLVSEYPPG 245 >gi|146329048|ref|YP_001209084.1| DNA processing protein DprA [Dichelobacter nodosus VCS1703A] gi|146232518|gb|ABQ13496.1| DNA processing protein DprA [Dichelobacter nodosus VCS1703A] Length = 382 Score = 35.1 bits (80), Expect = 3.7, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP +R L +I N G +SE P G Sbjct: 179 GLDRVYPARHRELAHQIAAN-GAIVSEFPVG 208 >gi|166031219|ref|ZP_02234048.1| hypothetical protein DORFOR_00906 [Dorea formicigenerans ATCC 27755] gi|166029066|gb|EDR47823.1| hypothetical protein DORFOR_00906 [Dorea formicigenerans ATCC 27755] Length = 364 Score = 35.1 bits (80), Expect = 3.7, Method: Composition-based stats. Identities = 13/32 (40%), Positives = 17/32 (53%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIP 32 + G+D YP EN L +I GGI +IP Sbjct: 171 LGCGVDICYPRENIGLYMDIQREGGIISEQIP 202 >gi|148269810|ref|YP_001244270.1| DNA protecting protein DprA [Thermotoga petrophila RKU-1] gi|147735354|gb|ABQ46694.1| DNA protecting protein DprA [Thermotoga petrophila RKU-1] Length = 337 Score = 34.8 bits (79), Expect = 3.7, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YP N L EI N G +SE P G Sbjct: 156 LGTGVDVVYPRSNERLFHEIVKN-GCVVSEYPMG 188 >gi|325267229|ref|ZP_08133892.1| DNA protecting protein DprA [Kingella denitrificans ATCC 33394] gi|324981290|gb|EGC16939.1| DNA protecting protein DprA [Kingella denitrificans ATCC 33394] Length = 397 Score = 34.8 bits (79), Expect = 3.8, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP N+ L +I + G +SE P G Sbjct: 178 GIDRIYPQSNQKLAYQIAEQ-GAIVSEFPLG 207 >gi|294791551|ref|ZP_06756708.1| DNA protecting protein DprA [Scardovia inopinata F0304] gi|294458022|gb|EFG26376.1| DNA protecting protein DprA [Scardovia inopinata F0304] Length = 356 Score = 34.8 bits (79), Expect = 3.8, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 18/32 (56%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 AGGLD P N L + I ++ G ISE+P Sbjct: 229 AGGLDTCGPHRNARLFQTIENHHGALISELPP 260 >gi|283778858|ref|YP_003369613.1| DNA protecting protein DprA [Pirellula staleyi DSM 6068] gi|283437311|gb|ADB15753.1| DNA protecting protein DprA [Pirellula staleyi DSM 6068] Length = 401 Score = 34.8 bits (79), Expect = 3.8, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL C+YPPE+ +L +EI G +SE P Sbjct: 184 LGSGLACIYPPEHLDLAKEI-AEKGALLSEQPP 215 >gi|260438814|ref|ZP_05792630.1| DNA processing protein DprA [Butyrivibrio crossotus DSM 2876] gi|292808803|gb|EFF68008.1| DNA processing protein DprA [Butyrivibrio crossotus DSM 2876] Length = 360 Score = 34.8 bits (79), Expect = 3.8, Method: Composition-based stats. Identities = 15/32 (46%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIP 32 +AGG++ YP N NL +I + GG ISE P Sbjct: 170 LAGGVEKCYPAGNFNLYMDIQNRGG-IISEYP 200 >gi|150398880|ref|YP_001322647.1| SMF family protein [Methanococcus vannielii SB] gi|150011583|gb|ABR54035.1| SMF family protein [Methanococcus vannielii SB] Length = 352 Score = 34.8 bits (79), Expect = 3.8, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 19/31 (61%) Query: 3 GGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 G LD ++P EN L E+I GG +SE+P Sbjct: 207 GLLDPIFPKENMELSEKILKMGGFLVSELPP 237 >gi|289423506|ref|ZP_06425307.1| DNA protecting protein DprA [Peptostreptococcus anaerobius 653-L] gi|289156008|gb|EFD04672.1| DNA protecting protein DprA [Peptostreptococcus anaerobius 653-L] Length = 423 Score = 34.8 bits (79), Expect = 3.8, Method: Composition-based stats. Identities = 12/27 (44%), Positives = 19/27 (70%) Query: 5 LDCLYPPENRNLLEEIWDNGGIAISEI 31 +D +YP +NR L +EI + GG+ +SE Sbjct: 194 IDQVYPKKNRKLRDEILEKGGLILSEY 220 >gi|256425884|ref|YP_003126537.1| DNA protecting protein DprA [Chitinophaga pinensis DSM 2588] gi|256040792|gb|ACU64336.1| DNA protecting protein DprA [Chitinophaga pinensis DSM 2588] Length = 378 Score = 34.8 bits (79), Expect = 3.9, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 23/32 (71%), Gaps = 1/32 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIP 32 +A GLD +YP ++R+ E+ DNGG+ ++E P Sbjct: 181 LAHGLDRIYPQQHRSTAMEMIDNGGL-LTEFP 211 >gi|254422740|ref|ZP_05036458.1| DNA protecting protein DprA, putative [Synechococcus sp. PCC 7335] gi|196190229|gb|EDX85193.1| DNA protecting protein DprA, putative [Synechococcus sp. PCC 7335] Length = 411 Score = 34.8 bits (79), Expect = 3.9, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 22/31 (70%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP N++L +++ +N G+ +SE P G Sbjct: 178 GVDIVYPARNQSLYQQVVEN-GLVVSEYPDG 207 >gi|171913964|ref|ZP_02929434.1| putative protein required for chromosomal DNA transformation [Verrucomicrobium spinosum DSM 4136] Length = 367 Score = 34.8 bits (79), Expect = 3.9, Method: Composition-based stats. Identities = 16/33 (48%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G LYPPEN+ L E+I +N G ISE P Sbjct: 172 IGSGHGKLYPPENKALAEKIAEN-GAVISEFPV 203 >gi|254463451|ref|ZP_05076867.1| DNA protecting protein DprA [Rhodobacterales bacterium HTCC2083] gi|206680040|gb|EDZ44527.1| DNA protecting protein DprA [Rhodobacteraceae bacterium HTCC2083] Length = 356 Score = 34.8 bits (79), Expect = 3.9, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGG+D +YP E NL + D G +SE P G Sbjct: 153 LAGGVDVIYPNEKLNLASSMLDE-GALLSEQPIG 185 >gi|168700980|ref|ZP_02733257.1| DNA protecting protein DprA [Gemmata obscuriglobus UQM 2246] Length = 396 Score = 34.8 bits (79), Expect = 3.9, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +AGGL +YPPE+ +L E+ G ++E P Sbjct: 172 LAGGLSSIYPPEHADLAAEV-AGNGCLVTETPM 203 >gi|270308041|ref|YP_003330099.1| Rossmann fold DNA uptake nucleotide-binding protein [Dehalococcoides sp. VS] gi|270153933|gb|ACZ61771.1| Rossmann fold DNA uptake nucleotide-binding protein [Dehalococcoides sp. VS] Length = 373 Score = 34.8 bits (79), Expect = 3.9, Method: Composition-based stats. Identities = 15/32 (46%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Query: 3 GGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP EN L +I +N G +SE P G Sbjct: 175 CGLDIIYPSENSCLARQIAEN-GALVSEHPPG 205 >gi|159036855|ref|YP_001536108.1| DNA protecting protein DprA [Salinispora arenicola CNS-205] gi|157915690|gb|ABV97117.1| DNA protecting protein DprA [Salinispora arenicola CNS-205] Length = 452 Score = 34.8 bits (79), Expect = 3.9, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +A GLD YP N L + I D G+ +SE G Sbjct: 223 LACGLDRPYPMGNAALFDRIADT-GLLVSEWMPG 255 >gi|254463787|ref|ZP_05077198.1| DNA protecting protein DprA [Rhodobacterales bacterium Y4I] gi|206684695|gb|EDZ45177.1| DNA protecting protein DprA [Rhodobacterales bacterium Y4I] Length = 365 Score = 34.8 bits (79), Expect = 4.0, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGG D +YP EN L EEI G+ +SE P G Sbjct: 153 LAGGADVIYPAENTRLAEEIC-KTGLRLSEQPMG 185 >gi|297243647|ref|ZP_06927578.1| DNA-uptake Rossmann fold nucleotide-binding protein [Gardnerella vaginalis AMD] gi|296888398|gb|EFH27139.1| DNA-uptake Rossmann fold nucleotide-binding protein [Gardnerella vaginalis AMD] Length = 514 Score = 34.8 bits (79), Expect = 4.0, Method: Composition-based stats. Identities = 14/30 (46%), Positives = 18/30 (60%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 AGGL+ + P N L E+I GG ISE+ Sbjct: 298 AGGLNHMGPRCNYQLFEQIIAKGGACISEL 327 >gi|116671018|ref|YP_831951.1| DNA protecting protein DprA [Arthrobacter sp. FB24] gi|116611127|gb|ABK03851.1| DNA protecting protein DprA [Arthrobacter sp. FB24] Length = 394 Score = 34.8 bits (79), Expect = 4.0, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 MAGG+D YP N LL + N G ++E+P G Sbjct: 197 MAGGVDRFYPSGNEELLRTV-ANQGAVLAEVPPG 229 >gi|222099410|ref|YP_002533978.1| DNA protecting protein DprA [Thermotoga neapolitana DSM 4359] gi|221571800|gb|ACM22612.1| DNA protecting protein DprA [Thermotoga neapolitana DSM 4359] Length = 337 Score = 34.8 bits (79), Expect = 4.1, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YP N L I ++ G +SE P G Sbjct: 156 LGAGVDVIYPRSNEGLFYRILES-GCVVSEYPMG 188 >gi|134299832|ref|YP_001113328.1| DNA protecting protein DprA [Desulfotomaculum reducens MI-1] gi|134052532|gb|ABO50503.1| DNA protecting protein DprA [Desulfotomaculum reducens MI-1] Length = 364 Score = 34.8 bits (79), Expect = 4.2, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G D +YP EN L+++I + G I+E P G Sbjct: 172 LGCGPDIVYPRENEKLMKQIIE-KGAIITEFPPG 204 >gi|310287689|ref|YP_003938947.1| SMF family protein [Bifidobacterium bifidum S17] gi|309251625|gb|ADO53373.1| SMF family protein [Bifidobacterium bifidum S17] Length = 504 Score = 34.8 bits (79), Expect = 4.2, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 19/33 (57%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGGL+ P N L + I +NGG +SE+ G Sbjct: 235 AGGLNHAGPQCNSELFDGIAENGGALVSELCPG 267 >gi|15643022|ref|NP_228064.1| DNA processing chain A [Thermotoga maritima MSB8] gi|170288496|ref|YP_001738734.1| DNA protecting protein DprA [Thermotoga sp. RQ2] gi|4980749|gb|AAD35341.1|AE001708_9 DNA processing chain A [Thermotoga maritima MSB8] gi|170175999|gb|ACB09051.1| DNA protecting protein DprA [Thermotoga sp. RQ2] Length = 337 Score = 34.8 bits (79), Expect = 4.2, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YP N L EI N G +SE P G Sbjct: 156 LGTGVDVVYPRSNERLFHEIVKN-GCVVSEYPMG 188 >gi|302872580|ref|YP_003841216.1| DNA protecting protein DprA [Caldicellulosiruptor obsidiansis OB47] gi|302575439|gb|ADL43230.1| DNA protecting protein DprA [Caldicellulosiruptor obsidiansis OB47] Length = 365 Score = 34.8 bits (79), Expect = 4.3, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YP EN L +I ++ G +SE G Sbjct: 171 LGCGVDIVYPKENLKLYRQIIES-GCVVSEFLPG 203 >gi|258517114|ref|YP_003193336.1| Mg chelatase, subunit ChlI [Desulfotomaculum acetoxidans DSM 771] gi|257780819|gb|ACV64713.1| Mg chelatase, subunit ChlI [Desulfotomaculum acetoxidans DSM 771] Length = 748 Score = 34.8 bits (79), Expect = 4.3, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G+D YP E+R L++ I G+ +SE P Sbjct: 551 LGCGVDVCYPAEHRGLMDRI-AEEGVLLSEYPP 582 >gi|189218918|ref|YP_001939559.1| DNA uptake Rossmann fold nucleotide-binding protein [Methylacidiphilum infernorum V4] gi|189185776|gb|ACD82961.1| Rossmann fold nucleotide-binding protein involved in DNA uptake [Methylacidiphilum infernorum V4] Length = 380 Score = 34.8 bits (79), Expect = 4.3, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D YP +N L E I G+ ISE P G Sbjct: 183 LGSGIDHCYPAQNYELSERI-SAQGLLISEFPMG 215 >gi|269119854|ref|YP_003308031.1| SMF family protein [Sebaldella termitidis ATCC 33386] gi|268613732|gb|ACZ08100.1| SMF family protein [Sebaldella termitidis ATCC 33386] Length = 234 Score = 34.8 bits (79), Expect = 4.3, Method: Composition-based stats. Identities = 16/31 (51%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD ++P E+R L E I +N G+ ISE P G Sbjct: 163 GLDKIFPYESRKLWERIPEN-GMLISEYPPG 192 >gi|308180666|ref|YP_003924794.1| DNA processing protein [Lactobacillus plantarum subsp. plantarum ST-III] gi|308046157|gb|ADN98700.1| DNA processing protein [Lactobacillus plantarum subsp. plantarum ST-III] Length = 288 Score = 34.8 bits (79), Expect = 4.4, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD YP ++R+L ++I G+ ISE P G Sbjct: 172 GLDISYPRQHRDLQQQI-SQVGLLISEYPLG 201 >gi|325965583|ref|YP_004243487.1| DNA protecting protein DprA [Arthrobacter phenanthrenivorans Sphe3] gi|323471670|gb|ADX75353.1| DNA protecting protein DprA [Arthrobacter phenanthrenivorans Sphe3] Length = 302 Score = 34.8 bits (79), Expect = 4.4, Method: Composition-based stats. Identities = 16/34 (47%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YP N +L I N G+ +SE+P G Sbjct: 184 LAGGLDRDYPSGNADLAAAIRAN-GLTLSELPPG 216 >gi|296535601|ref|ZP_06897782.1| DNA protecting protein DprA [Roseomonas cervicalis ATCC 49957] gi|296264117|gb|EFH10561.1| DNA protecting protein DprA [Roseomonas cervicalis ATCC 49957] Length = 364 Score = 34.8 bits (79), Expect = 4.4, Method: Composition-based stats. Identities = 13/32 (40%), Positives = 19/32 (59%), Gaps = 1/32 (3%) Query: 3 GGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GGLD YPPE+ L + + G+ ++E P G Sbjct: 166 GGLDRAYPPEHAEL-QSLIAERGLVVAEAPLG 196 >gi|291531139|emb|CBK96724.1| Predicted Rossmann fold nucleotide-binding protein involved in DNA uptake [Eubacterium siraeum 70/3] Length = 500 Score = 34.8 bits (79), Expect = 4.5, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 19/31 (61%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 +A G+ YP + L + I DNGG+ +SE+ Sbjct: 167 LACGITIDYPNNSFGLRKNIIDNGGLILSEL 197 >gi|297202659|ref|ZP_06920056.1| DNA processing Smf-family protein [Streptomyces sviceus ATCC 29083] gi|197713234|gb|EDY57268.1| DNA processing Smf-family protein [Streptomyces sviceus ATCC 29083] Length = 385 Score = 34.8 bits (79), Expect = 4.6, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +A G+D YP + L+ I + G+ I E+P G Sbjct: 180 LACGVDRPYPRGHAQLITRIAEQ-GLVIGELPPG 212 >gi|197104784|ref|YP_002130161.1| dprA protein [Phenylobacterium zucineum HLK1] gi|196478204|gb|ACG77732.1| dprA protein [Phenylobacterium zucineum HLK1] Length = 362 Score = 34.8 bits (79), Expect = 4.6, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + GG+D +YPPE+R L E + + G +SE G Sbjct: 169 LGGGIDDVYPPEHRPLYERLVE-AGCVVSESEPG 201 >gi|118617634|ref|YP_905966.1| hypothetical protein MUL_2062 [Mycobacterium ulcerans Agy99] gi|118569744|gb|ABL04495.1| conserved hypothetical membrane protein [Mycobacterium ulcerans Agy99] Length = 391 Score = 34.8 bits (79), Expect = 4.6, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGG+D YP + LL I G+ ++E P G Sbjct: 183 LAGGIDIPYPTGHSALLHWI-GQHGLLVTEYPPG 215 >gi|313905318|ref|ZP_07838684.1| DNA protecting protein DprA [Eubacterium cellulosolvens 6] gi|313469788|gb|EFR65124.1| DNA protecting protein DprA [Eubacterium cellulosolvens 6] Length = 375 Score = 34.8 bits (79), Expect = 4.6, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 16/34 (47%) Query: 1 [protein fragment, 34 aa] 34 + G+D YP +N L I GG ISE G Sbjct: 125 LGTGVDVCYPKQNYALYRRIIREGGGIISEFEPG 158 >gi|167750872|ref|ZP_02422999.1| hypothetical protein EUBSIR_01856 [Eubacterium siraeum DSM 15702] gi|167656051|gb|EDS00181.1| hypothetical protein EUBSIR_01856 [Eubacterium siraeum DSM 15702] Length = 500 Score = 34.8 bits (79), Expect = 4.6, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 19/31 (61%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 +A G+ YP + L + I DNGG+ +SE+ Sbjct: 167 LACGITIDYPNNSFGLRKNIIDNGGLILSEL 197 >gi|254361451|ref|ZP_04977591.1| SMF family Rossmann fold nucleotide-binding protein [Mannheimia haemolytica PHL213] gi|153092961|gb|EDN73987.1| SMF family Rossmann fold nucleotide-binding protein [Mannheimia haemolytica PHL213] Length = 382 Score = 34.8 bits (79), Expect = 4.6, Method: Composition-based stats. Identities = 12/30 (40%), Positives = 19/30 (63%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISE 30 + GL+ +YP ++ L E+I D GG +SE Sbjct: 169 LGSGLNQVYPARHKKLAEQIVDLGGALVSE 198 >gi|302036384|ref|YP_003796706.1| protein SMF, putative DNA protecting protein DprA [Candidatus Nitrospira defluvii] gi|300604448|emb|CBK40780.1| Protein SMF, putative DNA protecting protein DprA [Candidatus Nitrospira defluvii] Length = 378 Score = 34.8 bits (79), Expect = 4.6, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 M GLD YP ++R L E I + G +SE+P G Sbjct: 176 MGCGLDRTYPADHRQLRETI-EQHGAVLSELPLG 208 >gi|300774691|ref|ZP_07084554.1| SMF family DNA processing protein [Chryseobacterium gleum ATCC 35910] gi|300506506|gb|EFK37641.1| SMF family DNA processing protein [Chryseobacterium gleum ATCC 35910] Length = 369 Score = 34.8 bits (79), Expect = 4.6, Method: Composition-based stats. Identities = 14/30 (46%), Positives = 19/30 (63%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISE 30 +A G LYP +NR L E+I + GG I+E Sbjct: 173 LAHGFQYLYPAKNRRLSEKILNEGGALITE 202 >gi|119509167|ref|ZP_01628318.1| SMF protein [Nodularia spumigena CCY9414] gi|119466333|gb|EAW47219.1| SMF protein [Nodularia spumigena CCY9414] Length = 372 Score = 34.8 bits (79), Expect = 4.6, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G+D +YPP+NR+L ++I G+ +SE Sbjct: 177 LGTGVDVIYPPKNRDLYKQILTQ-GLVVSEY 206 >gi|50083491|ref|YP_045001.1| putative Rossmann-fold nucleotide-binding protein [Acinetobacter sp. ADP1] gi|49529467|emb|CAG67179.1| putative Rossmann-fold nucleotide-binding protein involved in DNA uptake (Smf) [Acinetobacter sp. ADP1] Length = 383 Score = 34.8 bits (79), Expect = 4.6, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 17/31 (54%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD YP N+ L + I D GG +SE G Sbjct: 182 GLDLCYPSGNKALKQHIRDQGGAIVSEFLPG 212 >gi|311064587|ref|YP_003971312.1| Smf family protein [Bifidobacterium bifidum PRL2010] gi|310866906|gb|ADP36275.1| Smf family protein [Bifidobacterium bifidum PRL2010] Length = 504 Score = 34.8 bits (79), Expect = 4.7, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 19/33 (57%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGGL+ P N L + I +NGG +SE+ G Sbjct: 235 AGGLNHAGPQCNSELFDGIAENGGALVSELCPG 267 >gi|237806931|ref|YP_002891371.1| DNA protecting protein DprA [Tolumonas auensis DSM 9187] gi|237499192|gb|ACQ91785.1| DNA protecting protein DprA [Tolumonas auensis DSM 9187] Length = 374 Score = 34.8 bits (79), Expect = 4.7, Method: Composition-based stats. Identities = 11/28 (39%), Positives = 17/28 (60%) Query: 3 GGLDCLYPPENRNLLEEIWDNGGIAISE 30 GL +YP +++ L +I + GG ISE Sbjct: 179 CGLRHVYPAKHKRLASQILEQGGALISE 206 >gi|223937270|ref|ZP_03629176.1| SMF family protein [bacterium Ellin514] gi|223894055|gb|EEF60510.1| SMF family protein [bacterium Ellin514] Length = 252 Score = 34.8 bits (79), Expect = 4.7, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G++ ++PPEN +L E I N G +S+ PF Sbjct: 56 LGTGINLVFPPENADLFERIAAN-GAVLSQFPF 87 >gi|322506376|gb|ADX01830.1| Rossmann-fold nucleotide-binding protein [Acinetobacter baumannii 1656-2] Length = 376 Score = 34.8 bits (79), Expect = 4.7, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 16/31 (51%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD YP +N+ L E I G I+E G Sbjct: 182 GLDTTYPAQNKKLAEYILAKNGAIITEFLPG 212 >gi|311696637|gb|ADP99510.1| DNA protecting protein DprA [marine bacterium HP15] Length = 380 Score = 34.8 bits (79), Expect = 4.7, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + GLD +YP ++R L E + + G+ ISE P G Sbjct: 180 IGCGLDRVYPHQHRRLGERVVAD-GLMISEYPPG 212 >gi|295696103|ref|YP_003589341.1| DNA protecting protein DprA [Bacillus tusciae DSM 2912] gi|295411705|gb|ADG06197.1| DNA protecting protein DprA [Bacillus tusciae DSM 2912] Length = 384 Score = 34.8 bits (79), Expect = 4.7, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +AGG LYPPE+R+L + G ISE P Sbjct: 184 LAGGFHHLYPPEHRSLAAAV-ARSGALISEQPP 215 >gi|289768831|ref|ZP_06528209.1| DNA processing Smf-family protein [Streptomyces lividans TK24] gi|289699030|gb|EFD66459.1| DNA processing Smf-family protein [Streptomyces lividans TK24] Length = 413 Score = 34.8 bits (79), Expect = 4.7, Method: Composition-based stats. Identities = 11/32 (34%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Query: 3 GGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D YPP + L+ I + G+ + E+P G Sbjct: 210 CGVDRPYPPGHTALITRIAEQ-GLVVGELPPG 240 >gi|281412306|ref|YP_003346385.1| DNA protecting protein DprA [Thermotoga naphthophila RKU-10] gi|281373409|gb|ADA66971.1| DNA protecting protein DprA [Thermotoga naphthophila RKU-10] Length = 337 Score = 34.8 bits (79), Expect = 4.7, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YP N L EI N G +SE P G Sbjct: 156 LGTGVDVVYPRSNERLFHEIVKN-GCVVSEYPMG 188 >gi|210622560|ref|ZP_03293242.1| hypothetical protein CLOHIR_01190 [Clostridium hiranonis DSM 13275] gi|210154143|gb|EEA85149.1| hypothetical protein CLOHIR_01190 [Clostridium hiranonis DSM 13275] Length = 379 Score = 34.8 bits (79), Expect = 4.7, Method: Composition-based stats. Identities = 12/30 (40%), Positives = 17/30 (56%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISE 30 + G+D P N L+ +I D+GG ISE Sbjct: 179 LGSGIDNPLPKTNIWLMNKIVDSGGAVISE 208 >gi|332875642|ref|ZP_08443454.1| DNA protecting protein DprA [Acinetobacter baumannii 6014059] gi|332736215|gb|EGJ67230.1| DNA protecting protein DprA [Acinetobacter baumannii 6014059] Length = 383 Score = 34.8 bits (79), Expect = 4.8, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 16/31 (51%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD YP +N+ L E I G I+E G Sbjct: 189 GLDTTYPAQNKKLAEYILAKNGAIITEFLPG 219 >gi|282856249|ref|ZP_06265532.1| DNA protecting protein DprA [Pyramidobacter piscolens W5455] gi|282586008|gb|EFB91293.1| DNA protecting protein DprA [Pyramidobacter piscolens W5455] Length = 355 Score = 34.8 bits (79), Expect = 4.8, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D ++PPE+ L + I G +SE P G Sbjct: 167 LGTGVDVVWPPEHDELFDNIL-RRGALLSEYPLG 199 >gi|148658666|ref|YP_001278871.1| DNA protecting protein DprA [Roseiflexus sp. RS-1] gi|148570776|gb|ABQ92921.1| DNA protecting protein DprA [Roseiflexus sp. RS-1] Length = 360 Score = 34.8 bits (79), Expect = 4.8, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YP + L I D+ G ISE P G Sbjct: 171 LPCGIDLVYPERHDTLARRITDH-GALISEFPPG 203 >gi|72161075|ref|YP_288732.1| SMF protein [Thermobifida fusca YX] gi|71914807|gb|AAZ54709.1| SMF protein [Thermobifida fusca YX] Length = 394 Score = 34.8 bits (79), Expect = 4.8, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +A G+D YP + L E+ ++ G+ +SE P G Sbjct: 192 LACGVDLAYPKGHEQLFAEVVNH-GVVVSEYPPG 224 >gi|330720128|gb|EGG98532.1| Rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [gamma proteobacterium IMCC2047] Length = 383 Score = 34.4 bits (78), Expect = 4.9, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 MA G+D +YP ++ L ++I G ++E P G Sbjct: 184 MATGIDQIYPKQHVALAQQI-RQRGALVTEFPLG 216 >gi|259503395|ref|ZP_05746297.1| DNA protecting protein DprA [Lactobacillus antri DSM 16041] gi|259168640|gb|EEW53135.1| DNA protecting protein DprA [Lactobacillus antri DSM 16041] Length = 285 Score = 34.4 bits (78), Expect = 4.9, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + GLD YPPENR L +E + G+ +SE G Sbjct: 168 VGCGLDRAYPPENRQL-QEAVADRGLVLSEYGRG 200 >gi|193873566|gb|ACF23472.1| DNA protecting protein [uncultured bacterium] Length = 160 Score = 34.4 bits (78), Expect = 4.9, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP +N L I + GI +SE P G Sbjct: 72 GLDRVYPRQNLGLARRIAAH-GILVSEYPLG 101 >gi|254556723|ref|YP_003063140.1| DNA processing protein [Lactobacillus plantarum JDM1] gi|254045650|gb|ACT62443.1| DNA processing protein [Lactobacillus plantarum JDM1] Length = 288 Score = 34.4 bits (78), Expect = 4.9, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD YP ++R+L ++I G+ ISE P G Sbjct: 172 GLDISYPRQHRDLQQQI-SQVGLLISEYPLG 201 >gi|257463631|ref|ZP_05628022.1| Smf protein [Fusobacterium sp. D12] gi|317061183|ref|ZP_07925668.1| SMF family protein [Fusobacterium sp. D12] gi|313686859|gb|EFS23694.1| SMF family protein [Fusobacterium sp. D12] Length = 283 Score = 34.4 bits (78), Expect = 5.0, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP +N NL + + G+ +SE P G Sbjct: 100 GLDEIYPKQNTNLWKRV-AKEGLLVSEYPLG 129 >gi|297544718|ref|YP_003677020.1| DNA protecting protein DprA [Thermoanaerobacter mathranii subsp. mathranii str. A3] gi|296842493|gb|ADH61009.1| DNA protecting protein DprA [Thermoanaerobacter mathranii subsp. mathranii str. A3] Length = 362 Score = 34.4 bits (78), Expect = 5.0, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G++ +YP EN+ L+E+I G+ +SE P Sbjct: 171 LGNGINIVYPRENKKLMEQI-SEEGLLVSEFPL 202 >gi|226366014|ref|YP_002783797.1| DNA processing protein [Rhodococcus opacus B4] gi|226244504|dbj|BAH54852.1| putative DNA processing protein [Rhodococcus opacus B4] Length = 384 Score = 34.4 bits (78), Expect = 5.0, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +A G+D YP + LL +I G ISE G Sbjct: 193 LACGVDRAYPSGHARLLRQI-AQNGAVISEYAPG 225 >gi|325272508|ref|ZP_08138886.1| DNA protecting protein DprA [Pseudomonas sp. TJI-51] gi|324102369|gb|EGB99837.1| DNA protecting protein DprA [Pseudomonas sp. TJI-51] Length = 285 Score = 34.4 bits (78), Expect = 5.0, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL LYP + L + I D+GG +SE P Sbjct: 101 LGTGLQKLYPQRHTALAQAIIDSGGALVSEYPL 133 >gi|261250602|ref|ZP_05943177.1| rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Vibrio orientalis CIP 102891] gi|260939171|gb|EEX95158.1| rossmann fold nucleotide-binding protein Smf possibly involved in DNA uptake [Vibrio orientalis CIP 102891] Length = 371 Score = 34.4 bits (78), Expect = 5.0, Method: Composition-based stats. Identities = 12/30 (40%), Positives = 19/30 (63%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISE 30 + GL+ +YP +R+L I D+GG +SE Sbjct: 171 LGCGLNTIYPARHRDLALRIIDSGGALVSE 200 >gi|227486583|ref|ZP_03916899.1| SMF family DNA processing protein [Anaerococcus lactolyticus ATCC 51172] gi|227235401|gb|EEI85416.1| SMF family DNA processing protein [Anaerococcus lactolyticus ATCC 51172] Length = 363 Score = 34.4 bits (78), Expect = 5.0, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G+D +YP N+ L E+I + G+ +SE P Sbjct: 172 IGCGIDQVYPTANKFLYEKI-EEDGLILSEFPL 203 >gi|291520056|emb|CBK75277.1| Predicted Rossmann fold nucleotide-binding protein involved in DNA uptake [Butyrivibrio fibrisolvens 16/4] Length = 256 Score = 34.4 bits (78), Expect = 5.1, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD YP E+ L ++ G IS+ P G Sbjct: 177 GLDIYYPREHMELF-DMISQNGAVISQFPPG 206 >gi|224283319|ref|ZP_03646641.1| hypothetical protein BbifN4_05770 [Bifidobacterium bifidum NCIMB 41171] gi|313140471|ref|ZP_07802664.1| conserved hypothetical protein [Bifidobacterium bifidum NCIMB 41171] gi|313132981|gb|EFR50598.1| conserved hypothetical protein [Bifidobacterium bifidum NCIMB 41171] Length = 504 Score = 34.4 bits (78), Expect = 5.1, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 19/33 (57%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGGL+ P N L + I +NGG +SE+ G Sbjct: 235 AGGLNHAGPQCNSELFDGIAENGGALVSELCPG 267 >gi|116333444|ref|YP_794971.1| Rossmann fold nucleotide-binding protein for DNA uptake [Lactobacillus brevis ATCC 367] gi|116098791|gb|ABJ63940.1| Rossmann fold nucleotide-binding protein for DNA uptake [Lactobacillus brevis ATCC 367] Length = 296 Score = 34.4 bits (78), Expect = 5.1, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD YP NR+L+ E+ + + ISE P+G Sbjct: 178 GLDHCYPAGNRDLMTELAHHH-LVISEYPWG 207 >gi|28378509|ref|NP_785401.1| DNA processing protein [Lactobacillus plantarum WCFS1] gi|300767455|ref|ZP_07077367.1| DNA protecting protein DprA [Lactobacillus plantarum subsp. plantarum ATCC 14917] gi|28271345|emb|CAD64250.1| DNA processing protein [Lactobacillus plantarum WCFS1] gi|300495274|gb|EFK30430.1| DNA protecting protein DprA [Lactobacillus plantarum subsp. plantarum ATCC 14917] Length = 288 Score = 34.4 bits (78), Expect = 5.1, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD YP ++R+L ++I G+ ISE P G Sbjct: 172 GLDISYPRQHRDLQQQI-SQVGLLISEYPLG 201 >gi|289578442|ref|YP_003477069.1| DNA protecting protein DprA [Thermoanaerobacter italicus Ab9] gi|289528155|gb|ADD02507.1| DNA protecting protein DprA [Thermoanaerobacter italicus Ab9] Length = 362 Score = 34.4 bits (78), Expect = 5.2, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G++ +YP EN+ L+E+I G+ +SE P Sbjct: 171 LGNGINIVYPRENKKLMEQI-SEEGLLVSEFPL 202 >gi|256784938|ref|ZP_05523369.1| DNA processing Smf-family protein [Streptomyces lividans TK24] Length = 432 Score = 34.4 bits (78), Expect = 5.3, Method: Composition-based stats. Identities = 11/32 (34%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Query: 3 GGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D YPP + L+ I + G+ + E+P G Sbjct: 229 CGVDRPYPPGHTALITRIAEQ-GLVVGELPPG 259 >gi|86742265|ref|YP_482665.1| DNA processing protein DprA [Frankia sp. CcI3] gi|86569127|gb|ABD12936.1| DNA protecting protein DprA [Frankia sp. CcI3] Length = 446 Score = 34.4 bits (78), Expect = 5.3, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGG+D YP + LLEEI G +SE+ G Sbjct: 195 LAGGVDVPYPTAHVELLEEI-ARTGAVVSEVSPG 227 >gi|146313351|ref|YP_001178425.1| DNA protecting protein DprA [Enterobacter sp. 638] gi|145320227|gb|ABP62374.1| DNA protecting protein DprA [Enterobacter sp. 638] Length = 374 Score = 34.4 bits (78), Expect = 5.4, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 19/33 (57%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP + +L ++I + GG ISE P Sbjct: 167 LGNGLSGIYPKRHASLADKIIEAGGAVISEFPL 199 >gi|310658803|ref|YP_003936524.1| DNA processing protein [Clostridium sticklandii DSM 519] gi|308825581|emb|CBH21619.1| DNA processing protein (smf family) (modular protein) [Clostridium sticklandii] Length = 356 Score = 34.4 bits (78), Expect = 5.5, Method: Composition-based stats. Identities = 10/31 (32%), Positives = 17/31 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + + YP N L++ + D+GG+ ISE Sbjct: 166 LGSSITKPYPKTNAKLMQSVIDSGGLVISEY 196 >gi|301058272|ref|ZP_07199312.1| DNA protecting protein DprA [delta proteobacterium NaphS2] gi|300447606|gb|EFK11331.1| DNA protecting protein DprA [delta proteobacterium NaphS2] Length = 369 Score = 34.4 bits (78), Expect = 5.5, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D +YP N+ L E+I + G +SE P G Sbjct: 176 LGTGIDVVYPGSNQKLFEKIME-AGAIVSEFPMG 208 >gi|227115517|ref|ZP_03829173.1| hypothetical protein PcarbP_21290 [Pectobacterium carotovorum subsp. brasiliensis PBR1692] Length = 364 Score = 34.4 bits (78), Expect = 5.5, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 16/33 (48%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP + L E I GG +SE P Sbjct: 158 LGSGLKNIYPKRHAKLAERICGGGGALVSEFPL 190 >gi|167645473|ref|YP_001683136.1| DNA protecting protein DprA [Caulobacter sp. K31] gi|167347903|gb|ABZ70638.1| DNA protecting protein DprA [Caulobacter sp. K31] Length = 366 Score = 34.4 bits (78), Expect = 5.5, Method: Composition-based stats. Identities = 12/30 (40%), Positives = 17/30 (56%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISE 30 + GG+ +YPPE+ L I GG +SE Sbjct: 170 LGGGVCDIYPPEHAALHARIAGEGGCIVSE 199 >gi|33599233|ref|NP_886793.1| hypothetical protein BB0244 [Bordetella bronchiseptica RB50] gi|33575279|emb|CAE30742.1| conserved hypothetical protein [Bordetella bronchiseptica RB50] Length = 370 Score = 34.4 bits (78), Expect = 5.6, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 M G+D +YP +R+L I + G +SE+P G Sbjct: 182 MGTGIDRIYPAAHRDLAHRIVQH-GALVSELPLG 214 >gi|284032637|ref|YP_003382568.1| DNA protecting protein DprA [Kribbella flavida DSM 17836] gi|283811930|gb|ADB33769.1| DNA protecting protein DprA [Kribbella flavida DSM 17836] Length = 445 Score = 34.4 bits (78), Expect = 5.6, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +A G+D YP N L + I G+ +SE+P G Sbjct: 246 LACGVDVSYPKRNSALFDRI-AAEGLLLSELPPG 278 >gi|33594956|ref|NP_882599.1| hypothetical protein BPP0240 [Bordetella parapertussis 12822] gi|33565032|emb|CAE39981.1| conserved hypothetical protein [Bordetella parapertussis] Length = 370 Score = 34.4 bits (78), Expect = 5.6, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 M G+D +YP +R+L I + G +SE+P G Sbjct: 182 MGTGIDRIYPAAHRDLAHRIVQH-GALVSELPLG 214 >gi|256750729|ref|ZP_05491614.1| DNA protecting protein DprA [Thermoanaerobacter ethanolicus CCSD1] gi|256750312|gb|EEU63331.1| DNA protecting protein DprA [Thermoanaerobacter ethanolicus CCSD1] Length = 362 Score = 34.4 bits (78), Expect = 5.7, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G++ +YP EN+ L+E+I G+ +SE P Sbjct: 171 LGNGINIVYPRENKKLMEQI-SEEGLLVSEFPL 202 >gi|163791332|ref|ZP_02185745.1| DNA processing protein DprA, putative [Carnobacterium sp. AT7] gi|159873411|gb|EDP67502.1| DNA processing protein DprA, putative [Carnobacterium sp. AT7] Length = 289 Score = 34.4 bits (78), Expect = 5.7, Method: Composition-based stats. Identities = 16/31 (51%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD YP EN L +EI N + ISE P G Sbjct: 175 GLDQFYPFENEKLQKEIAKNH-LLISEYPLG 204 >gi|158522455|ref|YP_001530325.1| DNA protecting protein DprA [Desulfococcus oleovorans Hxd3] gi|158511281|gb|ABW68248.1| DNA protecting protein DprA [Desulfococcus oleovorans Hxd3] Length = 389 Score = 34.4 bits (78), Expect = 5.7, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YPPEN L I G ISE P Sbjct: 171 LGSGLCRIYPPENMELARRI-AGQGAVISEFPL 202 >gi|75909996|ref|YP_324292.1| SMF protein [Anabaena variabilis ATCC 29413] gi|75703721|gb|ABA23397.1| SMF protein [Anabaena variabilis ATCC 29413] Length = 372 Score = 34.4 bits (78), Expect = 5.8, Method: Composition-based stats. Identities = 13/32 (40%), Positives = 22/32 (68%), Gaps = 1/32 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIP 32 + G+D +YP +NR+L ++I N G+ +SE P Sbjct: 177 LGTGVDVVYPHKNRDLYKQILTN-GLVVSEYP 207 >gi|325963703|ref|YP_004241609.1| DNA protecting protein DprA [Arthrobacter phenanthrenivorans Sphe3] gi|323469790|gb|ADX73475.1| DNA protecting protein DprA [Arthrobacter phenanthrenivorans Sphe3] Length = 400 Score = 34.4 bits (78), Expect = 5.8, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 MAGG+D YP N +LL + N G ++E+P G Sbjct: 203 MAGGVDRFYPSGNEDLLRAVC-NQGAVLAEVPPG 235 >gi|261823199|ref|YP_003261305.1| DNA protecting protein DprA [Pectobacterium wasabiae WPP163] gi|261607212|gb|ACX89698.1| DNA protecting protein DprA [Pectobacterium wasabiae WPP163] Length = 373 Score = 34.4 bits (78), Expect = 5.8, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ +YP + L E I +GG +SE P Sbjct: 167 LGSGLENIYPKRHAKLAERICGDGGALVSEFPL 199 >gi|310765563|gb|ADP10513.1| DNA protecting protein [Erwinia sp. Ejp617] Length = 374 Score = 34.4 bits (78), Expect = 5.9, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 20/33 (60%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL +YP +++ L +I D+GG +SE P Sbjct: 167 LGSGLQAVYPRQHQALARQIIDSGGALVSEFPL 199 >gi|227503374|ref|ZP_03933423.1| DNA processing protein [Corynebacterium accolens ATCC 49725] gi|227075877|gb|EEI13840.1| DNA processing protein [Corynebacterium accolens ATCC 49725] Length = 393 Score = 34.4 bits (78), Expect = 5.9, Method: Composition-based stats. Identities = 13/29 (44%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISE 30 A G+D YP N L ++I DN G +SE Sbjct: 193 ACGIDKNYPARNGGLFDQIADN-GCIVSE 220 >gi|294782849|ref|ZP_06748175.1| DNA processing chain A [Fusobacterium sp. 1_1_41FAA] gi|294481490|gb|EFG29265.1| DNA processing chain A [Fusobacterium sp. 1_1_41FAA] Length = 304 Score = 34.4 bits (78), Expect = 5.9, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Query: 1 MAGGLD-CLYPPENRNLLEEIWDNGGIAISEI 31 + GLD +YP EN NL++ I +N G +SE+ Sbjct: 183 LGQGLDLEIYPRENINLVDRILENNGFLLSEL 214 >gi|283783113|ref|YP_003373867.1| DNA protecting protein DprA [Gardnerella vaginalis 409-05] gi|298253874|ref|ZP_06977461.1| DNA-uptake Rossmann fold nucleotide-binding protein [Gardnerella vaginalis 5-1] gi|283441767|gb|ADB14233.1| DNA protecting protein DprA [Gardnerella vaginalis 409-05] gi|297532017|gb|EFH70992.1| DNA-uptake Rossmann fold nucleotide-binding protein [Gardnerella vaginalis 5-1] Length = 514 Score = 34.4 bits (78), Expect = 5.9, Method: Composition-based stats. Identities = 14/30 (46%), Positives = 19/30 (63%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 AGGL+ + P N L E+I GG+ ISE+ Sbjct: 298 AGGLNHMGPRCNYQLFEQIIAKGGVCISEL 327 >gi|26986814|ref|NP_742239.1| DNA protecting protein DprA [Pseudomonas putida KT2440] gi|24981411|gb|AAN65703.1|AE016197_1 smf protein [Pseudomonas putida KT2440] Length = 365 Score = 34.4 bits (78), Expect = 6.0, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 19/33 (57%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL LYP +R+L + + DNG +SE P Sbjct: 181 LGTGLQKLYPQRHRDLAQAMIDNGSALVSEYPL 213 >gi|310778327|ref|YP_003966660.1| DNA protecting protein DprA [Ilyobacter polytropus DSM 2926] gi|309747650|gb|ADO82312.1| DNA protecting protein DprA [Ilyobacter polytropus DSM 2926] Length = 357 Score = 34.4 bits (78), Expect = 6.1, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP EN + E + + G ISE P G Sbjct: 170 GLDIVYPQENSKIWERM-EREGTIISEFPLG 199 >gi|256824961|ref|YP_003148921.1| DNA protecting protein DprA [Kytococcus sedentarius DSM 20547] gi|256688354|gb|ACV06156.1| DNA protecting protein DprA [Kytococcus sedentarius DSM 20547] Length = 371 Score = 34.4 bits (78), Expect = 6.1, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGG+D LYP N +LL E+ G +SE G Sbjct: 178 LAGGVDRLYPAGNADLLTEVV-RTGAVVSESAPG 210 >gi|255325243|ref|ZP_05366349.1| DNA protecting protein DprA [Corynebacterium tuberculostearicum SK141] gi|255297808|gb|EET77119.1| DNA protecting protein DprA [Corynebacterium tuberculostearicum SK141] Length = 393 Score = 34.4 bits (78), Expect = 6.1, Method: Composition-based stats. Identities = 14/29 (48%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISE 30 A G+D YP N NL +I DN G +SE Sbjct: 193 ACGIDRDYPARNANLFAKIADN-GCIVSE 220 >gi|23099000|ref|NP_692466.1| DNA processing protein [Oceanobacillus iheyensis HTE831] gi|22777228|dbj|BAC13501.1| DNA processing protein (Smf family) [Oceanobacillus iheyensis HTE831] Length = 294 Score = 34.4 bits (78), Expect = 6.1, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GG +YP E+ +L EI G+ ++E P Sbjct: 172 LGGGFHHIYPREHLSLFHEI-TQKGLVLTEYPP 203 >gi|240948039|ref|ZP_04752456.1| Smf protein [Actinobacillus minor NM305] gi|240297655|gb|EER48132.1| Smf protein [Actinobacillus minor NM305] Length = 382 Score = 34.4 bits (78), Expect = 6.2, Method: Composition-based stats. Identities = 11/30 (36%), Positives = 18/30 (60%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISE 30 + GL +YP ++ L E+I + GG +SE Sbjct: 169 LGSGLAQIYPARHKKLAEQIIEKGGALVSE 198 >gi|221638586|ref|YP_002524848.1| DNA protecting protein DprA [Rhodobacter sphaeroides KD131] gi|221159367|gb|ACM00347.1| DNA protecting protein DprA [Rhodobacter sphaeroides KD131] Length = 372 Score = 34.4 bits (78), Expect = 6.2, Method: Composition-based stats. Identities = 17/33 (51%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGG+D +YP EN L EI G ISE P G Sbjct: 177 AGGVDVIYPAENAGLAAEI-AARGCRISEQPMG 208 >gi|220912959|ref|YP_002488268.1| DNA protecting protein DprA [Arthrobacter chlorophenolicus A6] gi|219859837|gb|ACL40179.1| DNA protecting protein DprA [Arthrobacter chlorophenolicus A6] Length = 402 Score = 34.4 bits (78), Expect = 6.2, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 MAGG+D YP N +LL + N G ++E+P G Sbjct: 205 MAGGVDRFYPSGNEDLLRAVC-NQGAVLAEVPPG 237 >gi|313496441|gb|ADR57807.1| DprA [Pseudomonas putida BIRD-1] Length = 365 Score = 34.4 bits (78), Expect = 6.2, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 19/33 (57%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL LYP +R+L + + DNG +SE P Sbjct: 181 LGTGLQKLYPQRHRDLAQAMIDNGSALVSEYPL 213 >gi|270602100|ref|ZP_06221567.1| smf protein [Haemophilus influenzae HK1212] gi|270318248|gb|EFA29440.1| smf protein [Haemophilus influenzae HK1212] Length = 144 Score = 34.4 bits (78), Expect = 6.3, Method: Composition-based stats. Identities = 10/30 (33%), Positives = 19/30 (63%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISE 30 + GL+ +YP +++ L +I +N G +SE Sbjct: 93 LGSGLEQIYPSKHQRLSAQIIENNGALVSE 122 >gi|311739717|ref|ZP_07713552.1| DNA protecting protein DprA [Corynebacterium pseudogenitalium ATCC 33035] gi|311305533|gb|EFQ81601.1| DNA protecting protein DprA [Corynebacterium pseudogenitalium ATCC 33035] Length = 393 Score = 34.4 bits (78), Expect = 6.3, Method: Composition-based stats. Identities = 14/29 (48%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISE 30 A G+D YP N NL +I DN G +SE Sbjct: 193 ACGIDRDYPARNANLFAKIADN-GCIVSE 220 >gi|261867100|ref|YP_003255022.1| DNA-processing chain A [Aggregatibacter actinomycetemcomitans D11S-1] gi|261412432|gb|ACX81803.1| protein smf (DNA-processing chain A) [Aggregatibacter actinomycetemcomitans D11S-1] Length = 372 Score = 34.0 bits (77), Expect = 6.4, Method: Composition-based stats. Identities = 11/30 (36%), Positives = 20/30 (66%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISE 30 + GL+ +YP ++R L + I ++GG +SE Sbjct: 170 LGSGLEEVYPAKHRKLAQNIIEHGGALVSE 199 >gi|237740066|ref|ZP_04570547.1| DNA processing chain A [Fusobacterium sp. 2_1_31] gi|229422083|gb|EEO37130.1| DNA processing chain A [Fusobacterium sp. 2_1_31] Length = 267 Score = 34.0 bits (77), Expect = 6.4, Method: Composition-based stats. Identities = 15/32 (46%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Query: 1 MAGGLD-CLYPPENRNLLEEIWDNGGIAISEI 31 + GLD +YP EN NL E+I +N G +SE+ Sbjct: 183 LGQGLDLEIYPRENINLAEKILENNGFLLSEL 214 >gi|28867415|ref|NP_790034.1| DNA processing protein DprA [Pseudomonas syringae pv. tomato str. DC3000] gi|28850649|gb|AAO53729.1| DNA processing protein DprA, putative [Pseudomonas syringae pv. tomato str. DC3000] Length = 394 Score = 34.0 bits (77), Expect = 6.4, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL LYP ++R L +I GG ISE P Sbjct: 204 LGTGLGKLYPQQHRALATQIAAQGGAVISEFPL 236 >gi|33591759|ref|NP_879403.1| hypothetical protein BP0555 [Bordetella pertussis Tohama I] gi|33571402|emb|CAE44883.1| conserved hypothetical protein [Bordetella pertussis Tohama I] gi|332381176|gb|AEE66023.1| hypothetical protein BPTD_0564 [Bordetella pertussis CS] Length = 370 Score = 34.0 bits (77), Expect = 6.4, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 M G+D +YP +R+L I + G +SE+P G Sbjct: 182 MGTGIDRIYPAAHRDLAHRIVQH-GALVSELPLG 214 >gi|170783523|ref|YP_001742016.1| putative smf family protein [Arthrobacter sp. AK-1] gi|150035010|gb|ABR67021.1| putative smf family protein [Arthrobacter sp. AK-1] Length = 302 Score = 34.0 bits (77), Expect = 6.5, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +AGGLD YP N +L I G+ +SE+P G Sbjct: 184 LAGGLDRDYPSGNADLAAAI-RGTGLTLSELPPG 216 >gi|237801644|ref|ZP_04590105.1| DNA processing protein DprA [Pseudomonas syringae pv. oryzae str. 1_6] gi|331024503|gb|EGI04559.1| DNA processing protein DprA [Pseudomonas syringae pv. oryzae str. 1_6] Length = 371 Score = 34.0 bits (77), Expect = 6.7, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 19/33 (57%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ LYP ++R L + + GG ISE P Sbjct: 181 LGTGLEKLYPQQHRALADRMAAQGGAVISEFPL 213 >gi|145593869|ref|YP_001158166.1| DNA protecting protein DprA [Salinispora tropica CNB-440] gi|145303206|gb|ABP53788.1| DNA protecting protein DprA [Salinispora tropica CNB-440] Length = 444 Score = 34.0 bits (77), Expect = 6.7, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +A GLD YP N L + I D G+ +SE G Sbjct: 222 LACGLDRPYPMGNAALFDRIADT-GLLVSEWIPG 254 >gi|145224718|ref|YP_001135396.1| DNA protecting protein DprA [Mycobacterium gilvum PYR-GCK] gi|315445048|ref|YP_004077927.1| DNA protecting protein DprA [Mycobacterium sp. Spyr1] gi|145217204|gb|ABP46608.1| DNA protecting protein DprA [Mycobacterium gilvum PYR-GCK] gi|315263351|gb|ADU00093.1| DNA protecting protein DprA [Mycobacterium sp. Spyr1] Length = 388 Score = 34.0 bits (77), Expect = 6.9, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +A GLD YP + LL + G+ +SE P G Sbjct: 184 LAAGLDVPYPAGHSALLHRV-GKHGLLVSEYPPG 216 >gi|328462260|gb|EGF34367.1| DNA processing SMF protein [Lactobacillus rhamnosus MTCC 5462] Length = 190 Score = 34.0 bits (77), Expect = 7.0, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +A G+D +YP +NR+L +I G+ +SE P G Sbjct: 148 IANGIDQVYPAKNRSLQRQI-SRVGLVVSEYPPG 180 >gi|29829173|ref|NP_823807.1| DNA processing Smf-family protein [Streptomyces avermitilis MA-4680] gi|29606279|dbj|BAC70342.1| putative DNA processing Smf-family protein [Streptomyces avermitilis MA-4680] Length = 381 Score = 34.0 bits (77), Expect = 7.0, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +A G+D YP + L+ I + G+ + E+P G Sbjct: 176 LACGVDQPYPRGHTELITRIAEQ-GLVVGELPPG 208 >gi|326382894|ref|ZP_08204584.1| DNA protecting protein DprA [Gordonia neofelifaecis NRRL B-59395] gi|326198484|gb|EGD55668.1| DNA protecting protein DprA [Gordonia neofelifaecis NRRL B-59395] Length = 374 Score = 34.0 bits (77), Expect = 7.0, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +A G+D YP + LL EI G ++E P G Sbjct: 182 LACGIDRDYPAGHAQLLREI-GERGAVLTEYPPG 214 >gi|220907030|ref|YP_002482341.1| DNA protecting protein DprA [Cyanothece sp. PCC 7425] gi|219863641|gb|ACL43980.1| DNA protecting protein DprA [Cyanothece sp. PCC 7425] Length = 370 Score = 34.0 bits (77), Expect = 7.0, Method: Composition-based stats. Identities = 13/29 (44%), Positives = 19/29 (65%), Gaps = 1/29 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIP 32 G+D +YPP N+ L E+I G+ +SE P Sbjct: 180 GVDLVYPPRNKFLYEKILQQ-GLVLSEYP 207 >gi|160896284|ref|YP_001561866.1| DNA protecting protein DprA [Delftia acidovorans SPH-1] gi|160361868|gb|ABX33481.1| DNA protecting protein DprA [Delftia acidovorans SPH-1] Length = 405 Score = 34.0 bits (77), Expect = 7.0, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP + L E+ + G+ +SE P G Sbjct: 207 GLDQVYPRRHIGLAREVASH-GLIVSEYPLG 236 >gi|146296271|ref|YP_001180042.1| DNA protecting protein DprA [Caldicellulosiruptor saccharolyticus DSM 8903] gi|145409847|gb|ABP66851.1| DNA protecting protein DprA [Caldicellulosiruptor saccharolyticus DSM 8903] Length = 380 Score = 34.0 bits (77), Expect = 7.0, Method: Composition-based stats. Identities = 12/30 (40%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISE 30 + G+D +YP EN L +I + G ISE Sbjct: 188 LGCGVDIVYPKENYKLYNQIVE-KGCVISE 216 >gi|258545463|ref|ZP_05705697.1| DNA processing protein DprA [Cardiobacterium hominis ATCC 15826] gi|258519296|gb|EEV88155.1| DNA processing protein DprA [Cardiobacterium hominis ATCC 15826] Length = 369 Score = 34.0 bits (77), Expect = 7.1, Method: Composition-based stats. Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP + +L I G +SE P G Sbjct: 178 GLDRVYPARHHDLAHRI-SAQGAIVSEYPIG 207 >gi|253690149|ref|YP_003019339.1| DNA protecting protein DprA [Pectobacterium carotovorum subsp. carotovorum PC1] gi|251756727|gb|ACT14803.1| DNA protecting protein DprA [Pectobacterium carotovorum subsp. carotovorum PC1] Length = 373 Score = 34.0 bits (77), Expect = 7.1, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ +YP + L E I +GG +SE P Sbjct: 167 LGSGLENIYPKRHAKLAERICGDGGALVSEFPL 199 >gi|90415411|ref|ZP_01223345.1| DNA processing chain A [marine gamma proteobacterium HTCC2207] gi|90332734|gb|EAS47904.1| DNA processing chain A [marine gamma proteobacterium HTCC2207] Length = 360 Score = 34.0 bits (77), Expect = 7.1, Method: Composition-based stats. Identities = 13/30 (43%), Positives = 19/30 (63%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISE 30 MA G++ +YP + L E+I D GG I+E Sbjct: 174 MATGIEAVYPRAHLKLAEQIIDQGGTLITE 203 >gi|261491953|ref|ZP_05988530.1| SMF family Rossmann fold nucleotide-binding protein [Mannheimia haemolytica serotype A2 str. BOVINE] gi|261496244|ref|ZP_05992649.1| SMF family Rossmann fold nucleotide-binding protein [Mannheimia haemolytica serotype A2 str. OVINE] gi|261308075|gb|EEY09373.1| SMF family Rossmann fold nucleotide-binding protein [Mannheimia haemolytica serotype A2 str. OVINE] gi|261312420|gb|EEY13546.1| SMF family Rossmann fold nucleotide-binding protein [Mannheimia haemolytica serotype A2 str. BOVINE] Length = 381 Score = 34.0 bits (77), Expect = 7.2, Method: Composition-based stats. Identities = 11/30 (36%), Positives = 20/30 (66%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISE 30 + GL+ +YP ++ L E+I ++GG +SE Sbjct: 168 LGSGLNRIYPARHQKLAEQIVESGGALVSE 197 >gi|332557608|ref|ZP_08411930.1| hypothetical protein RSWS8N_01115 [Rhodobacter sphaeroides WS8N] gi|332275320|gb|EGJ20635.1| hypothetical protein RSWS8N_01115 [Rhodobacter sphaeroides WS8N] Length = 372 Score = 34.0 bits (77), Expect = 7.3, Method: Composition-based stats. Identities = 17/33 (51%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGG+D +YP EN L EI G ISE P G Sbjct: 177 AGGVDVIYPAENAGLAAEI-AARGCRISEQPMG 208 >gi|308235790|ref|ZP_07666527.1| DNA protecting protein DprA [Gardnerella vaginalis ATCC 14018] gi|311114449|ref|YP_003985670.1| DNA protecting protein DprA [Gardnerella vaginalis ATCC 14019] gi|310945943|gb|ADP38647.1| DNA protecting protein DprA [Gardnerella vaginalis ATCC 14019] Length = 504 Score = 34.0 bits (77), Expect = 7.3, Method: Composition-based stats. Identities = 13/30 (43%), Positives = 18/30 (60%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 AGGL+ + P N L + I +GG ISE+ Sbjct: 295 AGGLNKMGPSSNAQLFDAILSSGGACISEL 324 >gi|300087797|ref|YP_003758319.1| DNA protecting protein DprA [Dehalogenimonas lykanthroporepellens BL-DC-9] gi|299527530|gb|ADJ25998.1| DNA protecting protein DprA [Dehalogenimonas lykanthroporepellens BL-DC-9] Length = 362 Score = 34.0 bits (77), Expect = 7.3, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G+ +YP EN+ L +EI ++ G ISE P Sbjct: 174 LGSGIGEIYPRENKKLADEITEH-GAVISEFPL 205 >gi|86137984|ref|ZP_01056560.1| DNA processing protein DprA, putative [Roseobacter sp. MED193] gi|85825576|gb|EAQ45775.1| DNA processing protein DprA, putative [Roseobacter sp. MED193] Length = 368 Score = 34.0 bits (77), Expect = 7.3, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 +AGG D +YP +N L ++I G+ +SE P Sbjct: 117 LAGGCDVIYPSQNSALAQDI-AAKGLILSEQPM 148 >gi|326799926|ref|YP_004317745.1| DNA protecting protein DprA [Sphingobacterium sp. 21] gi|326550690|gb|ADZ79075.1| DNA protecting protein DprA [Sphingobacterium sp. 21] Length = 364 Score = 34.0 bits (77), Expect = 7.5, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + GLD +YP NR L ++ NGG+ ++E P G Sbjct: 171 LGHGLDRIYPAINRTLATDMLKNGGL-LTEYPSG 203 >gi|154174599|ref|YP_001408002.1| DNA protecting protein DprA [Campylobacter curvus 525.92] gi|112803316|gb|EAU00660.1| DNA protecting protein DprA [Campylobacter curvus 525.92] Length = 257 Score = 34.0 bits (77), Expect = 7.5, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 A GLD +YPP N ++EI++N +A+SE G Sbjct: 92 ASGLDIIYPPSNAKFIKEIYENS-LALSEYENG 123 >gi|167040338|ref|YP_001663323.1| DNA protecting protein DprA [Thermoanaerobacter sp. X514] gi|300914422|ref|ZP_07131738.1| DNA protecting protein DprA [Thermoanaerobacter sp. X561] gi|307724342|ref|YP_003904093.1| DNA protecting protein DprA [Thermoanaerobacter sp. X513] gi|166854578|gb|ABY92987.1| DNA protecting protein DprA [Thermoanaerobacter sp. X514] gi|300889357|gb|EFK84503.1| DNA protecting protein DprA [Thermoanaerobacter sp. X561] gi|307581403|gb|ADN54802.1| DNA protecting protein DprA [Thermoanaerobacter sp. X513] Length = 362 Score = 34.0 bits (77), Expect = 7.7, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G++ +YP EN+ L+E+I G+ +SE P Sbjct: 171 LGNGINIVYPRENKKLMEQI-SEKGLLVSEFPL 202 >gi|33867059|ref|NP_898617.1| putative DNA uptake protein [Rhodococcus erythropolis] gi|33668893|gb|AAP73887.1| putative DNA uptake protein [Rhodococcus erythropolis] Length = 307 Score = 34.0 bits (77), Expect = 7.7, Method: Composition-based stats. Identities = 9/32 (28%), Positives = 18/32 (56%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 A +D +P + + +I ++GG+ +SE P Sbjct: 189 AASIDRAHPATHERMFRDISEHGGLVVSEYPP 220 >gi|295107976|emb|CBL21929.1| DNA protecting protein DprA [Ruminococcus obeum A2-162] Length = 295 Score = 34.0 bits (77), Expect = 7.8, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 16/34 (47%) Query: 1 [protein fragment, 34 aa] 34 + G D YP NR L + I GG ISE G Sbjct: 104 LGNGPDICYPAGNRGLYQRILRTGGGIISEQTPG 137 >gi|183601407|ref|ZP_02962777.1| hypothetical protein BIFLAC_02087 [Bifidobacterium animalis subsp. lactis HN019] gi|241191093|ref|YP_002968487.1| hypothetical protein Balac_1067 [Bifidobacterium animalis subsp. lactis Bl-04] gi|241196499|ref|YP_002970054.1| hypothetical protein Balat_1067 [Bifidobacterium animalis subsp. lactis DSM 10140] gi|183219013|gb|EDT89654.1| hypothetical protein BIFLAC_02087 [Bifidobacterium animalis subsp. lactis HN019] gi|240249485|gb|ACS46425.1| hypothetical protein Balac_1067 [Bifidobacterium animalis subsp. lactis Bl-04] gi|240251053|gb|ACS47992.1| hypothetical protein Balat_1067 [Bifidobacterium animalis subsp. lactis DSM 10140] gi|289178837|gb|ADC86083.1| Smf protein [Bifidobacterium animalis subsp. lactis BB-12] gi|295794082|gb|ADG33617.1| hypothetical protein BalV_1029 [Bifidobacterium animalis subsp. lactis V9] Length = 381 Score = 34.0 bits (77), Expect = 7.8, Method: Composition-based stats. Identities = 13/29 (44%), Positives = 15/29 (51%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISE 30 AGGLD P N L E+I G +SE Sbjct: 255 AGGLDHCGPTTNMRLFEQICAQHGALVSE 283 >gi|77462726|ref|YP_352230.1| hypothetical protein RSP_2177 [Rhodobacter sphaeroides 2.4.1] gi|77387144|gb|ABA78329.1| hypothetical protein RSP_2177 [Rhodobacter sphaeroides 2.4.1] Length = 372 Score = 34.0 bits (77), Expect = 7.8, Method: Composition-based stats. Identities = 17/33 (51%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGG+D +YP EN L EI G ISE P G Sbjct: 177 AGGVDVIYPAENAGLAAEI-AARGCRISEQPMG 208 >gi|126461618|ref|YP_001042732.1| DNA protecting protein DprA [Rhodobacter sphaeroides ATCC 17029] gi|126103282|gb|ABN75960.1| DNA protecting protein DprA [Rhodobacter sphaeroides ATCC 17029] Length = 372 Score = 34.0 bits (77), Expect = 7.8, Method: Composition-based stats. Identities = 17/33 (51%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGG+D +YP EN L EI G ISE P G Sbjct: 177 AGGVDVIYPAENAGLAAEI-AARGCRISEQPMG 208 >gi|328957577|ref|YP_004374963.1| DNA processing Smf single strand binding protein [Carnobacterium sp. 17-4] gi|328673901|gb|AEB29947.1| DNA processing Smf single strand binding protein [Carnobacterium sp. 17-4] Length = 289 Score = 34.0 bits (77), Expect = 7.9, Method: Composition-based stats. Identities = 16/31 (51%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD YP EN +L EI N + ISE P G Sbjct: 175 GLDHYYPFENESLQREIAKNH-LLISEYPLG 204 >gi|223041758|ref|ZP_03611951.1| protein smf (DNA-processing chain A) [Actinobacillus minor 202] gi|223017442|gb|EEF15860.1| protein smf (DNA-processing chain A) [Actinobacillus minor 202] Length = 382 Score = 34.0 bits (77), Expect = 7.9, Method: Composition-based stats. Identities = 11/30 (36%), Positives = 18/30 (60%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISE 30 + GL +YP ++ L E+I + GG +SE Sbjct: 169 LGSGLAQIYPARHKKLAEQIIEKGGALVSE 198 >gi|326389491|ref|ZP_08211058.1| DNA protecting protein DprA [Thermoanaerobacter ethanolicus JW 200] gi|325994496|gb|EGD52921.1| DNA protecting protein DprA [Thermoanaerobacter ethanolicus JW 200] Length = 362 Score = 34.0 bits (77), Expect = 8.0, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G++ +YP EN+ L+E+I G+ +SE P Sbjct: 171 LGNGINIVYPRENKKLMEQI-SEEGLLVSEFPL 202 >gi|307264857|ref|ZP_07546419.1| DNA protecting protein DprA [Thermoanaerobacter wiegelii Rt8.B1] gi|306920115|gb|EFN50327.1| DNA protecting protein DprA [Thermoanaerobacter wiegelii Rt8.B1] Length = 362 Score = 34.0 bits (77), Expect = 8.0, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G++ +YP EN+ L+E+I G+ +SE P Sbjct: 171 LGNGINIVYPRENKKLMEQI-SEEGLLVSEFPL 202 >gi|302386227|ref|YP_003822049.1| DNA protecting protein DprA [Clostridium saccharolyticum WM1] gi|302196855|gb|ADL04426.1| DNA protecting protein DprA [Clostridium saccharolyticum WM1] Length = 366 Score = 34.0 bits (77), Expect = 8.0, Method: Composition-based stats. Identities = 11/32 (34%), Positives = 17/32 (53%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIP 32 + G++ YP EN L + + D GGI +P Sbjct: 176 LGCGINLCYPKENFGLYQRMVDQGGIITEFLP 207 >gi|119503588|ref|ZP_01625671.1| SMF protein [marine gamma proteobacterium HTCC2080] gi|119460650|gb|EAW41742.1| SMF protein [marine gamma proteobacterium HTCC2080] Length = 380 Score = 34.0 bits (77), Expect = 8.0, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 MA G+D +YP E+ L EE+ G +SE G Sbjct: 177 MATGMDRIYPSEHYRLAEEVAAQ-GALLSEFCPG 209 >gi|317125405|ref|YP_004099517.1| DNA protecting protein DprA [Intrasporangium calvum DSM 43043] gi|315589493|gb|ADU48790.1| DNA protecting protein DprA [Intrasporangium calvum DSM 43043] Length = 389 Score = 34.0 bits (77), Expect = 8.1, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +A G+D YP + L+E I G +SE+ G Sbjct: 166 LASGIDRPYPSGHARLIERI-AETGAVLSEVAPG 198 >gi|289450127|ref|YP_003475174.1| DNA protecting protein DprA [Clostridiales genomosp. BVAB3 str. UPII9-5] gi|289184674|gb|ADC91099.1| DNA protecting protein DprA [Clostridiales genomosp. BVAB3 str. UPII9-5] Length = 416 Score = 34.0 bits (77), Expect = 8.1, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +A G+D YP +NR + E IW + + +SE P G Sbjct: 218 LANGIDICYPRQNRPIYEAIWRSQ-VLVSEYPPG 250 >gi|126737264|ref|ZP_01752999.1| DNA processing protein DprA, putative [Roseobacter sp. SK209-2-6] gi|126721849|gb|EBA18552.1| DNA processing protein DprA, putative [Roseobacter sp. SK209-2-6] Length = 423 Score = 34.0 bits (77), Expect = 8.1, Method: Composition-based stats. Identities = 17/34 (50%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 MAGG D +YP EN L EI G+ +SE P G Sbjct: 180 MAGGCDRIYPTENTELGVEIATQ-GLRLSEQPMG 212 >gi|89902621|ref|YP_525092.1| DNA processing protein DprA [Rhodoferax ferrireducens T118] gi|89347358|gb|ABD71561.1| DNA processing protein DprA, putative [Rhodoferax ferrireducens T118] Length = 409 Score = 34.0 bits (77), Expect = 8.2, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP + L I G+ ISE P G Sbjct: 213 GLDRVYPKRHLALAHRI-AQNGLLISEYPLG 242 >gi|150390497|ref|YP_001320546.1| DNA protecting protein DprA [Alkaliphilus metalliredigens QYMF] gi|149950359|gb|ABR48887.1| DNA protecting protein DprA [Alkaliphilus metalliredigens QYMF] Length = 365 Score = 34.0 bits (77), Expect = 8.2, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 18/34 (52%) Query: 1 [protein fragment, 34 aa] 34 + GL+ YP N+ L +I ++ G +SE G Sbjct: 173 LGCGLEQCYPASNQMLFNKIIESDGCILSEYAPG 206 >gi|262067114|ref|ZP_06026726.1| DNA processing chain A [Fusobacterium periodonticum ATCC 33693] gi|291379169|gb|EFE86687.1| DNA processing chain A [Fusobacterium periodonticum ATCC 33693] Length = 304 Score = 34.0 bits (77), Expect = 8.2, Method: Composition-based stats. Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Query: 1 MAGGLD-CLYPPENRNLLEEIWDNGGIAISEI 31 + GLD +YP EN L E+I +N G +SE+ Sbjct: 183 LGQGLDLEVYPKENIKLAEKILENNGFLLSEL 214 >gi|219683464|ref|YP_002469847.1| DNA protecting protein DprA [Bifidobacterium animalis subsp. lactis AD011] gi|219621114|gb|ACL29271.1| DNA protecting protein DprA [Bifidobacterium animalis subsp. lactis AD011] Length = 361 Score = 34.0 bits (77), Expect = 8.2, Method: Composition-based stats. Identities = 13/29 (44%), Positives = 15/29 (51%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISE 30 AGGLD P N L E+I G +SE Sbjct: 235 AGGLDHCGPTTNMRLFEQICAQHGALVSE 263 >gi|153854395|ref|ZP_01995673.1| hypothetical protein DORLON_01668 [Dorea longicatena DSM 13814] gi|149752921|gb|EDM62852.1| hypothetical protein DORLON_01668 [Dorea longicatena DSM 13814] Length = 238 Score = 34.0 bits (77), Expect = 8.2, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G+D YP EN L +I + GG +SE G Sbjct: 48 LGCGVDVCYPRENIGLYMDIQEKGG-IVSEFSPG 80 >gi|167037677|ref|YP_001665255.1| DNA protecting protein DprA [Thermoanaerobacter pseudethanolicus ATCC 33223] gi|320116092|ref|YP_004186251.1| DNA protecting protein DprA [Thermoanaerobacter brockii subsp. finnii Ako-1] gi|166856511|gb|ABY94919.1| DNA protecting protein DprA [Thermoanaerobacter pseudethanolicus ATCC 33223] gi|319929183|gb|ADV79868.1| DNA protecting protein DprA [Thermoanaerobacter brockii subsp. finnii Ako-1] Length = 362 Score = 34.0 bits (77), Expect = 8.2, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + G++ +YP EN+ L+E+I G+ +SE P Sbjct: 171 LGNGINIVYPRENKKLMEQI-SEEGLLVSEFPL 202 >gi|325067042|ref|ZP_08125715.1| DNA protecting protein DprA [Actinomyces oris K20] Length = 459 Score = 33.6 bits (76), Expect = 8.4, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGG+D LYP N +LE + + G ++E+P G Sbjct: 253 AGGVDRLYPAGNTGVLEAVIAS-GALVAEVPPG 284 >gi|114462408|gb|ABI75144.1| SMF protein [Anabaena circinalis AWQC131C] Length = 310 Score = 33.6 bits (76), Expect = 8.5, Method: Composition-based stats. Identities = 15/32 (46%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIP 32 M G+D +YP +NR+L ++I GI ISE P Sbjct: 115 MGTGVDVIYPHKNRDLYQQIL-KSGIVISEYP 145 >gi|149375616|ref|ZP_01893385.1| probable smf protein [Marinobacter algicola DG893] gi|149360018|gb|EDM48473.1| probable smf protein [Marinobacter algicola DG893] Length = 388 Score = 33.6 bits (76), Expect = 8.7, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D YP +R L E I G+ +SE P G Sbjct: 195 GVDKPYPYRHRTLSERI-AGEGVIVSEYPPG 224 >gi|149174899|ref|ZP_01853523.1| DNA processing chain A [Planctomyces maris DSM 8797] gi|148846236|gb|EDL60575.1| DNA processing chain A [Planctomyces maris DSM 8797] Length = 376 Score = 33.6 bits (76), Expect = 8.7, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 MA GL +YPPE+R L E G ++E P Sbjct: 180 MATGLAHIYPPEHREL-SEAVALQGAIVTEFPL 211 >gi|311109269|ref|YP_003982122.1| DNA protecting protein DprA [Achromobacter xylosoxidans A8] gi|310763958|gb|ADP19407.1| DNA protecting protein DprA [Achromobacter xylosoxidans A8] Length = 370 Score = 33.6 bits (76), Expect = 9.0, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 M G+D +YP ++R+L I + G +SE+P G Sbjct: 182 MGTGIDRIYPAKHRDLAHRIAAH-GALVSELPLG 214 >gi|4100626|gb|AAD00901.1| FIR2 [Rhodococcus fascians] Length = 293 Score = 33.6 bits (76), Expect = 9.0, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 M GLD YP + LLE + + G+ +SE FG Sbjct: 174 MPCGLDRAYPSGHARLLERVAEQ-GVVVSEYSFG 206 >gi|251788005|ref|YP_003002726.1| DNA protecting protein DprA [Dickeya zeae Ech1591] gi|247536626|gb|ACT05247.1| DNA protecting protein DprA [Dickeya zeae Ech1591] Length = 377 Score = 33.6 bits (76), Expect = 9.0, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 18/33 (54%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ LYP ++ L + I GG +SE P Sbjct: 167 LGSGLNQLYPRRHQALADAIVAKGGALVSEFPL 199 >gi|241766762|ref|ZP_04764592.1| DNA protecting protein DprA [Acidovorax delafieldii 2AN] gi|241362868|gb|EER58607.1| DNA protecting protein DprA [Acidovorax delafieldii 2AN] Length = 390 Score = 33.6 bits (76), Expect = 9.0, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 GLD +YP +N L I G+ +SE P G Sbjct: 195 GLDRVYPRQNLGLARRIAAQ-GLLVSEYPLG 224 >gi|15837526|ref|NP_298214.1| DNA processing chain A [Xylella fastidiosa 9a5c] gi|9105845|gb|AAF83734.1|AE003931_11 DNA processing chain A [Xylella fastidiosa 9a5c] Length = 387 Score = 33.6 bits (76), Expect = 9.1, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + G D YP ++ L I + G ISE P G Sbjct: 184 LGTGPDVPYPARHKKLYARITTD-GAVISEYPPG 216 >gi|270264339|ref|ZP_06192605.1| DNA protecting protein DprA [Serratia odorifera 4Rx13] gi|270041475|gb|EFA14573.1| DNA protecting protein DprA [Serratia odorifera 4Rx13] Length = 373 Score = 33.6 bits (76), Expect = 9.2, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 19/31 (61%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL +YP +R L E+I ++GG ISE Sbjct: 167 LGSGLANIYPRRHRRLAEQIVEHGGAVISEY 197 >gi|186682634|ref|YP_001865830.1| DNA protecting protein DprA [Nostoc punctiforme PCC 73102] gi|186465086|gb|ACC80887.1| DNA protecting protein DprA [Nostoc punctiforme PCC 73102] Length = 371 Score = 33.6 bits (76), Expect = 9.2, Method: Composition-based stats. Identities = 12/32 (37%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIP 32 + G+D +YP +NR+L ++I G+ +SE P Sbjct: 177 LGTGVDVIYPHKNRDLYKQILT-AGLVVSEYP 207 >gi|160872061|ref|ZP_02062193.1| protein smf (DNA-processing chain A) [Rickettsiella grylli] gi|159120860|gb|EDP46198.1| protein smf (DNA-processing chain A) [Rickettsiella grylli] Length = 384 Score = 33.6 bits (76), Expect = 9.2, Method: Composition-based stats. Identities = 13/30 (43%), Positives = 20/30 (66%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISE 30 + G++C+YP +R L EI + GG+ ISE Sbjct: 174 LGSGIECIYPSCHRALANEIVEKGGLLISE 203 >gi|332289297|ref|YP_004420149.1| DNA protecting protein DprA [Gallibacterium anatis UMN179] gi|330432193|gb|AEC17252.1| DNA protecting protein DprA [Gallibacterium anatis UMN179] Length = 398 Score = 33.6 bits (76), Expect = 9.3, Method: Composition-based stats. Identities = 11/31 (35%), Positives = 20/31 (64%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + GL+ LYP ++ L ++I +N G +SE+ Sbjct: 169 LGSGLNELYPARHKKLAQQILENNGALLSEL 199 >gi|291454421|ref|ZP_06593811.1| DNA processing Smf-family protein [Streptomyces albus J1074] gi|291357370|gb|EFE84272.1| DNA processing Smf-family protein [Streptomyces albus J1074] Length = 402 Score = 33.6 bits (76), Expect = 9.3, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 20/34 (58%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +A G+D YP + L+ I + G+ +SE+P G Sbjct: 185 LACGVDSPYPRGHAQLITRIAEQ-GLVVSELPPG 217 >gi|297717816|gb|ADI50051.1| putative DNA processing protein DprA [Candidatus Odyssella thessalonicensis L13] Length = 361 Score = 33.6 bits (76), Expect = 9.4, Method: Composition-based stats. Identities = 10/27 (37%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Query: 8 LYPPENRNLLEEIWDNGGIAISEIPFG 34 +YPPE+ +L +I + G +SE+ G Sbjct: 167 IYPPEHEDLYNDIQRH-GCIVSEMLIG 192 >gi|254488483|ref|ZP_05101688.1| DNA processing protein [Roseobacter sp. GAI101] gi|214045352|gb|EEB85990.1| DNA processing protein [Roseobacter sp. GAI101] Length = 347 Score = 33.6 bits (76), Expect = 9.4, Method: Composition-based stats. Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 2 AGGLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 AGG+D +YP EN L +I G+ +SE P G Sbjct: 147 AGGVDVMYPAENTQLAADI-AASGLRLSEQPMG 178 >gi|158320506|ref|YP_001513013.1| DNA protecting protein DprA [Alkaliphilus oremlandii OhILAs] gi|158140705|gb|ABW19017.1| DNA protecting protein DprA [Alkaliphilus oremlandii OhILAs] Length = 365 Score = 33.6 bits (76), Expect = 9.5, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 + GLD YP N L+ + +N G +SE P G Sbjct: 174 LGCGLDQCYPASNERLMSTMIEN-GCVLSEYPLG 206 >gi|15895060|ref|NP_348409.1| DNA uptake protein [Clostridium acetobutylicum ATCC 824] gi|15024755|gb|AAK79749.1|AE007687_6 DNA uptake protein [Clostridium acetobutylicum ATCC 824] gi|325509198|gb|ADZ20834.1| DNA uptake protein [Clostridium acetobutylicum EA 2018] Length = 354 Score = 33.6 bits (76), Expect = 9.5, Method: Composition-based stats. Identities = 13/31 (41%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEI 31 + G D +YP EN+NL +I N G IS+ Sbjct: 160 LGCGADVIYPKENKNLYCQIIRN-GCIISQY 189 >gi|300865695|ref|ZP_07110461.1| DNA processing protein [Oscillatoria sp. PCC 6506] gi|300336291|emb|CBN55611.1| DNA processing protein [Oscillatoria sp. PCC 6506] Length = 369 Score = 33.6 bits (76), Expect = 9.6, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 1/31 (3%) Query: 4 GLDCLYPPENRNLLEEIWDNGGIAISEIPFG 34 G+D +YP N+ L E + + G+AISE P G Sbjct: 161 GVDIVYPAANKKLAERVLEQ-GLAISEYPAG 190 >gi|167031106|ref|YP_001666337.1| DNA protecting protein DprA [Pseudomonas putida GB-1] gi|166857594|gb|ABY96001.1| DNA protecting protein DprA [Pseudomonas putida GB-1] Length = 365 Score = 33.6 bits (76), Expect = 9.7, Method: Composition-based stats. Identities = 12/33 (36%), Positives = 17/33 (51%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL LYP + L + + DNG +SE P Sbjct: 181 LGTGLQKLYPQRHHELAQAMIDNGSALVSEYPL 213 >gi|290957087|ref|YP_003488269.1| DNA mediated transformation protein [Streptomyces scabiei 87.22] gi|260646613|emb|CBG69710.1| putative DNA mediated transformation protein [Streptomyces scabiei 87.22] Length = 390 Score = 33.6 bits (76), Expect = 9.8, Method: Composition-based stats. Identities = 11/34 (32%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 1 [protein fragment, 34 aa] 34 +A G+D YP + L+ I + G+ + E+P G Sbjct: 185 LACGVDRPYPRGHAQLISRIAEQ-GLVVGELPPG 217 >gi|330957383|gb|EGH57643.1| DNA processing protein DprA [Pseudomonas syringae pv. maculicola str. ES4326] Length = 371 Score = 33.6 bits (76), Expect = 10.0, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 20/33 (60%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISEIPF 33 + GL+ LYP ++R L ++ + GG ISE P Sbjct: 181 LGTGLEKLYPQQHRALAAQMAEQGGAVISEFPL 213 >gi|145638193|ref|ZP_01793803.1| 2-isopropylmalate synthase [Haemophilus influenzae PittII] gi|145272522|gb|EDK12429.1| 2-isopropylmalate synthase [Haemophilus influenzae PittII] gi|309751349|gb|ADO81333.1| DNA processing chain A [Haemophilus influenzae R2866] Length = 373 Score = 33.6 bits (76), Expect = 10.0, Method: Composition-based stats. Identities = 10/30 (33%), Positives = 19/30 (63%) Query: 1 MAGGLDCLYPPENRNLLEEIWDNGGIAISE 30 + GL+ +YP +++ L +I +N G +SE Sbjct: 170 LGSGLEQIYPSKHQRLSAQIIENNGALVSE 199 Database: nr Posted date: May 22, 2011 12:22 AM Number of letters in database: 999,999,966 Number of sequences in database: 2,987,313 Database: /data/usr2/db/fasta/nr.01 Posted date: May 22, 2011 12:30 AM Number of letters in database: 999,999,796 Number of sequences in database: 2,903,041 Database: /data/usr2/db/fasta/nr.02 Posted date: May 22, 2011 12:36 AM Number of letters in database: 999,999,281 Number of sequences in database: 2,904,016 Database: /data/usr2/db/fasta/nr.03 Posted date: May 22, 2011 12:41 AM Number of letters in database: 999,999,960 Number of sequences in database: 2,935,328 Database: /data/usr2/db/fasta/nr.04 Posted date: May 22, 2011 12:46 AM Number of letters in database: 842,794,627 Number of sequences in database: 2,394,679 Lambda K H 0.318 0.163 0.542 Lambda K H 0.267 0.0497 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 884,089,377 Number of Sequences: 14124377 Number of extensions: 19906616 Number of successful extensions: 53872 Number of sequences better than 10.0: 1053 Number of HSP's better than 10.0 without gapping: 756 Number of HSP's successfully gapped in prelim test: 569 Number of HSP's that attempted gapping in prelim test: 52859 Number of HSP's gapped (non-prelim): 1325 length of query: 34 length of database: 4,842,793,630 effective HSP length: 8 effective length of query: 26 effective length of database: 4,729,798,614 effective search space: 122974763964 effective search space used: 122974763964 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.4 bits) S2: 76 (33.6 bits)