HHsearch alignment for GI: 254780305 and conserved domain: COG1777

>COG1777 Predicted transcriptional regulators [Transcription].
Probab=90.27  E-value=0.71  Score=24.99  Aligned_cols=47  Identities=28%  Similarity=0.287  Sum_probs=44.1

Q ss_pred             CHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             98999999985889889999999829999999999999999417986
Q gi|254780305|r   33 QCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCH   79 (95)
Q Consensus        33 ~~~~~~Il~~L~~~p~~iD~l~~~tgl~~~~v~~~LleLEL~G~i~~   79 (95)
T Consensus        14 NetRR~Il~lLt~~p~yvsEiS~~lgvsqkAVl~HL~~LE~AGlveS   60 (217)
T COG1777          14 NETRRRILQLLTRRPCYVSEISRELGVSQKAVLKHLRILERAGLVES   60 (217)
T ss_pred             CCHHHHHHHHHHCCCHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCHH
T ss_conf             71799999998547139998776608678999999999998587121