HHsearch alignment for GI: 254780305 and conserved domain: PRK09802

>PRK09802 DNA-binding transcriptional regulator AgaR; Provisional.
Probab=95.90  E-value=0.016  Score=33.94  Aligned_cols=54  Identities=19%  Similarity=0.194  Sum_probs=49.0

Q ss_pred             HHHHHHHHCC-CCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEEC
Q ss_conf             9999998588-98899999998299999999999999994179864798689813
Q gi|254780305|r   36 RVRIKQSLNN-VPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTM   89 (95)
Q Consensus        36 ~~~Il~~L~~-~p~~iD~l~~~tgl~~~~v~~~LleLEL~G~i~~~pGg~v~l~~   89 (95)
T Consensus        19 ~~~Il~~L~~~g~v~v~eLae~~~VS~~TIRRDL~~Le~~g~l~R~hGGA~~~~~   73 (269)
T PRK09802         19 REQIIQRLRQQGSVQVNDLSALYGVSTVTIRNDLAFLEKQGIAVRAYGGALICDS   73 (269)
T ss_pred             HHHHHHHHHHCCCEEHHHHHHHHCCCHHHHHHHHHHHHHCCCEEEEECCEEECCC
T ss_conf             9999999998698999999998796988999809999878986999687897677