HHsearch alignment for GI: 254780305 and conserved domain: PRK10411

>PRK10411 DNA-binding transcriptional activator FucR; Provisional.
Probab=95.32  E-value=0.014  Score=34.17  Aligned_cols=53  Identities=13%  Similarity=0.174  Sum_probs=48.1

Q ss_pred             HHHHHHHHCC-CCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEE
Q ss_conf             9999998588-9889999999829999999999999999417986479868981
Q gi|254780305|r   36 RVRIKQSLNN-VPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT   88 (95)
Q Consensus        36 ~~~Il~~L~~-~p~~iD~l~~~tgl~~~~v~~~LleLEL~G~i~~~pGg~v~l~   88 (95)
T Consensus         6 ~~~Il~~L~~~g~v~v~eLa~~~~VS~~TIRRDL~~Le~~G~l~R~hGGA~~~~   59 (240)
T PRK10411          6 QQAIVDLLLNHTSLTTEALAEQLNVSKETIRRDLNELQTQGKILRNHGRAKYIH   59 (240)
T ss_pred             HHHHHHHHHHCCCEEHHHHHHHHCCCHHHHHHHHHHHHHCCCEEEEEEEEEECC
T ss_conf             999999999869799999999889599899982998977898899942499756