HHsearch alignment for GI: 254780305 and conserved domain: TIGR01884

>TIGR01884 cas_HTH CRISPR locus-related DNA-binding protein; InterPro: IPR010163 Most but not all examples of this family are associated with CRISPR loci, a combination of DNA repeats and characteristic proteins encoded near the repeat cluster. The C-terminal region of this protein is homologous to DNA-binding helix-turn-helix domains with predicted transcriptional regulatory activity..
Probab=93.95  E-value=0.12  Score=29.10  Aligned_cols=58  Identities=14%  Similarity=0.149  Sum_probs=50.8

Q ss_pred             CCCCCCCCCHHHHHHHHHHCC--CCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             356887999899999998588--9889999999829999999999999999417986479
Q gi|254780305|r   25 ITHYPEYTQCERVRIKQSLNN--VPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPE   82 (95)
Q Consensus        25 ~~~~p~~~~~~~~~Il~~L~~--~p~~iD~l~~~tgl~~~~v~~~LleLEL~G~i~~~pG   82 (95)
T Consensus       160 ~~~~~~~~s~~~~~vL~~L~~~~Ge~~v~~iA~~lg~s~~T~~~~~~~Lek~gLv~~~~~  219 (231)
T TIGR01884       160 LVPLLAGLSREELKVLEALKAEKGEKSVKNIAKKLGKSLSTISRHLAELEKKGLVESKGR  219 (231)
T ss_pred             CCCCCCCCCHHHHHHHHHHHCCCCEECHHHHHHHHCCCHHHHHHHHHHHHHCCCEEEEEC
T ss_conf             224467888999999999850788052877998857888799999998874475456304