HHsearch alignment for GI: 254780305 and conserved domain: TIGR02431

>TIGR02431 pcaR_pcaU beta-ketoadipate pathway transcriptional regulators, PcaR/PcaU/PobR family; InterPro: IPR012794 Members of this family are IclR-type transcriptional regulators with similar DNA binding sites, able to bind at least three different metabolites related to protocatechuate metabolism. Beta-ketoadipate is the inducer for PcaR, p-hydroxybenzoate for PobR, and protocatechuate for PcaU.; GO: 0003677 DNA binding, 0016563 transcription activator activity, 0045941 positive regulation of transcription, 0046278 protocatechuate metabolic process.
Probab=90.59  E-value=0.51  Score=25.80  Aligned_cols=50  Identities=18%  Similarity=0.228  Sum_probs=44.5

Q ss_pred             HHHHHHCC--CCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEE
Q ss_conf             99998588--9889999999829999999999999999417986479868981
Q gi|254780305|r   38 RIKQSLNN--VPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT   88 (95)
Q Consensus        38 ~Il~~L~~--~p~~iD~l~~~tgl~~~~v~~~LleLEL~G~i~~~pGg~v~l~   88 (95)
T Consensus        13 aVi~aF~~~~~~ltl~~vA~~TGL~RAaARR~LLTL~~LGY~-~~Dg~~F~LT   64 (252)
T TIGR02431        13 AVIEAFGEERPRLTLTDVAEATGLTRAAARRFLLTLVELGYV-ESDGRLFWLT   64 (252)
T ss_pred             HHHHHHCCCCCCCCHHHHHHHHCCCCHHHHHHHHHHHHHCCE-ECCCCCEECC
T ss_conf             999973103789898999987589947988899846562304-2179833102