HHsearch alignment for GI: 254780305 and conserved domain: pfam08220

>pfam08220 HTH_DeoR DeoR-like helix-turn-helix domain.
Probab=95.97  E-value=0.0063  Score=36.07  Aligned_cols=53  Identities=21%  Similarity=0.255  Sum_probs=48.2

Q ss_pred             HHHHHHHHCC-CCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEE
Q ss_conf             9999998588-9889999999829999999999999999417986479868981
Q gi|254780305|r   36 RVRIKQSLNN-VPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT   88 (95)
Q Consensus        36 ~~~Il~~L~~-~p~~iD~l~~~tgl~~~~v~~~LleLEL~G~i~~~pGg~v~l~   88 (95)
T Consensus         2 ~~~Il~~l~~~~~v~i~~La~~f~VS~~TiRRDl~~L~~~g~i~R~~GGA~~~~   55 (57)
T pfam08220         2 IQQILELLKQQGTLSVEELAELLGVSEMTIRRDLNELEEQGLLTRTHGGAVSNS   55 (57)
T ss_pred             HHHHHHHHHHCCCEEHHHHHHHHCCCHHHHHHHHHHHHHCCCEEEEECCEECCC
T ss_conf             899999999869797999999989599999996999998899899749577588