HHsearch alignment for GI: 254780305 and conserved domain: smart00346

>smart00346 HTH_ICLR helix_turn_helix isocitrate lyase regulation.
Probab=97.07  E-value=0.00094  Score=40.54  Aligned_cols=52  Identities=13%  Similarity=0.220  Sum_probs=47.3

Q ss_pred             HHHHHHCC--CCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCC-CCEEEEEC
Q ss_conf             99998588--988999999982999999999999999941798647-98689813
Q gi|254780305|r   38 RIKQSLNN--VPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHP-EGKVSLTM   89 (95)
Q Consensus        38 ~Il~~L~~--~p~~iD~l~~~tgl~~~~v~~~LleLEL~G~i~~~p-Gg~v~l~~   89 (95)
T Consensus         9 ~IL~~l~~~~~~~sl~eia~~~~l~ksT~~RlL~tL~~~G~l~~~~~~~~Y~lG~   63 (91)
T smart00346        9 AVLRALAEEPGGLTLAELAERLGLSKSTAHRLLNTLQELGYVEQDGQNGRYRLGP   63 (91)
T ss_pred             HHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHHHHHHHCCCEEEECCCCEEEECH
T ss_conf             9999997289998999999998909999999999999889968849999775309