HHsearch alignment for GI: 254780305 and conserved domain: smart00420

>smart00420 HTH_DEOR helix_turn_helix, Deoxyribose operon repressor.
Probab=96.40  E-value=0.0027  Score=38.11  Aligned_cols=51  Identities=20%  Similarity=0.264  Sum_probs=46.7

Q ss_pred             HHHHHHHHCC-CCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCCEEE
Q ss_conf             9999998588-98899999998299999999999999994179864798689
Q gi|254780305|r   36 RVRIKQSLNN-VPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS   86 (95)
Q Consensus        36 ~~~Il~~L~~-~p~~iD~l~~~tgl~~~~v~~~LleLEL~G~i~~~pGg~v~   86 (95)
T Consensus         2 ~~~Il~~l~~~~~~~i~~La~~~~VS~~TiRRDl~~L~~~g~i~r~hGGA~s   53 (53)
T smart00420        2 QQQILELLAQQGKVSVEELAELLGVSEMTIRRDLNKLEEQGLLTRVHGGAVS   53 (53)
T ss_pred             HHHHHHHHHHCCCEEHHHHHHHHCCCHHHHHHHHHHHHHCCCEEEEECCEEC
T ss_conf             8999999998697979999999897999999969999988998997798839