HHsearch alignment of GI: 254780305 and MMDB domain: 1fx7_A_1-141

>1fx7_A (A:1-141) Iron-dependent repressor IDER; DTXR, iron-dependent regulator, signaling protein; 2.00A {Mycobacterium tuberculosis}
Probab=96.41  E-value=0.0059  Score=35.88  Aligned_cols=57  Identities=14%  Similarity=0.092  Sum_probs=49.6

Q ss_pred             CCHHHHHHHHHH-----CCCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEE
Q ss_conf             998999999985-----889889999999829999999999999999417986479868981
Q gi|254780305|r   32 TQCERVRIKQSL-----NNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT   88 (95)
Q Consensus        32 ~~~~~~~Il~~L-----~~~p~~iD~l~~~tgl~~~~v~~~LleLEL~G~i~~~pGg~v~l~   88 (95)
                      .+..+..++.+|     ...++.+.+|+++.|++.+.|..+|-.||=+|+|.+.+.++|+++
T Consensus         4 Lt~~q~~~L~~I~~l~~~~~~v~~~eLA~~l~vs~~tvt~~l~kLe~~glv~~~~~~~v~lT   65 (141)
T 1fx7_A            4 LVDTTEMYLRTIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSRMERDGLLRVAGDRHLELT   65 (141)
T ss_dssp             TSSHHHHHHHHHHHHHHHTSCCCHHHHHHHHTCCHHHHHHHHHHHHHTTSEEECTTSCEEEC
T ss_pred             CCHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCCHHHHHHHHHHHHCCCEEECCCCCEEEC
T ss_conf             67789999999999984499751999999978991689999999987998897399877888