HHsearch alignment of GI: 254780305 and MMDB domain: 1i1g_A_1-54

>1i1g_A (A:1-54) Transcriptional regulator LRPA; helix-turn-helix, LRP/ASNC family; 2.90A {Pyrococcus furiosus}
Probab=92.75  E-value=0.12  Score=28.77  Aligned_cols=48  Identities=17%  Similarity=0.126  Sum_probs=41.4

Q ss_pred             CHHHHHHHHHHCC-CCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHC
Q ss_conf             9899999998588-98899999998299999999999999994179864
Q gi|254780305|r   33 QCERVRIKQSLNN-VPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHH   80 (95)
Q Consensus        33 ~~~~~~Il~~L~~-~p~~iD~l~~~tgl~~~~v~~~LleLEL~G~i~~~   80 (95)
                      |.-..+|++.|.. ..+++.+|++.+|++.++|..-+-.||=+|+|++.
T Consensus         3 d~~D~~Il~~L~~n~r~s~~~la~~lgiS~~tv~~ri~kLe~~GvI~~y   51 (54)
T 1i1g_A            3 DERDKIILEILEKDARTPFTEIAKKLGISETAVRKRVKALEEKGIIEGY   51 (54)
T ss_dssp             CSHHHHHHHHHHHCTTCCHHHHHHHHTSCHHHHHHHHHHHHHHTSSCCC
T ss_pred             CHHHHHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHHHHHHCCCCCCC
T ss_conf             8899999999998589899999999890999999999998606961241