HHsearch alignment of GI: 254780305 and MMDB domain: 1mkm_A_1-64

>1mkm_A (A:1-64) ICLR transcriptional regulator; structural genomics, winged helix-turn-helix, PSI, protein structure initiative; 2.20A {Thermotoga maritima}
Probab=97.39  E-value=0.0002  Score=43.80  Aligned_cols=51  Identities=10%  Similarity=0.150  Sum_probs=47.9

Q ss_pred             HHHHHHC--CCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEE
Q ss_conf             9999858--89889999999829999999999999999417986479868981
Q gi|254780305|r   38 RIKQSLN--NVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT   88 (95)
Q Consensus        38 ~Il~~L~--~~p~~iD~l~~~tgl~~~~v~~~LleLEL~G~i~~~pGg~v~l~   88 (95)
                      +|+++++  ..++.+.+|++++|+|.++++.+|-.|+=.|+|.+.+.|+|++.
T Consensus        12 ~iL~~l~~~~~~~t~~eia~~~glp~st~~Rll~tL~~~g~l~~~~~~~Y~lG   64 (64)
T 1mkm_A           12 EILDFIVKNPGDVSVSEIAEKFNMSVSNAYKYMVVLEEKGFVLRKKDKRYVPG   64 (64)
T ss_dssp             HHHHHHHHCSSCBCHHHHHHHTTCCHHHHHHHHHHHHHTTSEEECTTSCEEEC
T ss_pred             HHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHHHHHHHCCCEEECCCCCEECC
T ss_conf             99999972899989999999879199999999999997798640577544227