HHsearch alignment of GI: 254780305 and MMDB domain: 1r1t_A_45-122

>1r1t_A (A:45-122) Transcriptional repressor SMTB; zinc, transcriptional regulation, winged HTH protein, DNA binding, transcription repressor; 1.70A {Synechococcus elongatus pcc 7942}
Probab=96.33  E-value=0.0057  Score=35.96  Aligned_cols=54  Identities=17%  Similarity=0.230  Sum_probs=49.3

Q ss_pred             CHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCCEEE
Q ss_conf             989999999858898899999998299999999999999994179864798689
Q gi|254780305|r   33 QCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS   86 (95)
Q Consensus        33 ~~~~~~Il~~L~~~p~~iD~l~~~tgl~~~~v~~~LleLEL~G~i~~~pGg~v~   86 (95)
                      |+.+.+|+..|...|..+.+|+...|++.++++-.|-.|+=+|+|...--|+..
T Consensus         1 dp~Rl~Il~~L~~~~~~~~ela~~l~~s~stvs~HL~~L~~aGlv~~~r~Gr~v   54 (78)
T 1r1t_A            1 DPNRLRLLSLLARSELCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRKQGRHV   54 (78)
T ss_dssp             CHHHHHHHHHHTTCCBCHHHHHHHHTCCHHHHHHHHHHHHHTTSEEEEEETTEE
T ss_pred             CHHHHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHHHHHHCCCEEEEEECCEE
T ss_conf             999999999998199569999999891988999999999988913789875889