HHsearch alignment of GI: 254780305 and MMDB domain: 1r1u_A_

>1r1u_A (A:) CZRA, repressor protein; zinc, DNA binding, transcriptional regulation, winged HTH protein, transcription repressor; 2.00A {Staphylococcus aureus}
Probab=95.65  E-value=0.01  Score=34.58  Aligned_cols=56  Identities=18%  Similarity=0.195  Sum_probs=50.8

Q ss_pred             CCHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCCEEEE
Q ss_conf             99899999998588988999999982999999999999999941798647986898
Q gi|254780305|r   32 TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL   87 (95)
Q Consensus        32 ~~~~~~~Il~~L~~~p~~iD~l~~~tgl~~~~v~~~LleLEL~G~i~~~pGg~v~l   87 (95)
                      .++.+.+|+..|...+..+.+|++.+|++.+.++..|-.|+=+|+|.....|+...
T Consensus        24 s~~~Rl~Il~~L~~~~~~~~ela~~l~is~stvs~HL~~L~~aglv~~~~~G~~~~   79 (106)
T 1r1u_A           24 GDYNRIRIMELLSVSEASVGHISHQLNLSQSNVSHQLKLLKSVHLVKAKRQGQSMI   79 (106)
T ss_dssp             CSHHHHHHHHHHHHCCBCHHHHHHHHTCCHHHHHHHHHHHHHTTSEEEEEETTEEE
T ss_pred             CCHHHHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHHHHHHCCCEEEEEECCEEE
T ss_conf             89999999999983994699999887658668999999999889148998878999