HHsearch alignment of GI: 254780305 and MMDB domain: 1z6r_A_1-82_382-406

>1z6r_A (A:1-82,A:382-406) MLC protein; transcriptional repressor, ROK family protein, DNA binding protein, helix-turn-helix, phosphotransferase system, metalloprotein; 2.70A {Escherichia coli}
Probab=93.50  E-value=0.13  Score=28.61  Aligned_cols=47  Identities=9%  Similarity=0.012  Sum_probs=41.9

Q ss_pred             HHHHHHHHHHC-CCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHC
Q ss_conf             89999999858-898899999998299999999999999994179864
Q gi|254780305|r   34 CERVRIKQSLN-NVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHH   80 (95)
Q Consensus        34 ~~~~~Il~~L~-~~p~~iD~l~~~tgl~~~~v~~~LleLEL~G~i~~~   80 (95)
                      ..+..||+.|- ..+++.-+|++.+|++.++|+.++-+|+-+|+|+..
T Consensus        16 ~N~~~IL~lL~~~g~~Sr~eLA~~lgLS~~TVs~iv~eL~e~GlV~e~   63 (107)
T 1z6r_A           16 TNAGAVYRLIDQLGPVSRIDLSRLAQLAPASITKIVHEXLEAHLVQEL   63 (107)
T ss_dssp             HHHHHHHHHHHSSCSCCHHHHHHHTTCCHHHHHHHHHHHHHHTSEEEC
T ss_pred             HHHHHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHHHHHHCCCEEEC
T ss_conf             999999999998599189999988795999999999999988988962