HHsearch alignment of GI: 254780305 and MMDB domain: 2o0y_A_1-95

>2o0y_A (A:1-95) Transcriptional regulator; ICLR-family, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.00A {Rhodococcus SP}
Probab=97.03  E-value=0.0006  Score=41.27  Aligned_cols=52  Identities=12%  Similarity=0.171  Sum_probs=48.2

Q ss_pred             HHHHHHC--CCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEEC
Q ss_conf             9999858--898899999998299999999999999994179864798689813
Q gi|254780305|r   38 RIKQSLN--NVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTM   89 (95)
Q Consensus        38 ~Il~~L~--~~p~~iD~l~~~tgl~~~~v~~~LleLEL~G~i~~~pGg~v~l~~   89 (95)
                      +||+++.  ..+..+-+|++++|++.+.++.+|-.||=.|+|.+.+.|+|+++.
T Consensus        27 ~iL~~l~~~~~~~~~~eia~~lgl~~st~~RlL~tL~~~G~v~~~~~g~y~lG~   80 (95)
T 2o0y_A           27 DLLELFDAAHPTRSLKELVEGTKLPKTTVVRLVATXCARSVLTSRADGSYSLGP   80 (95)
T ss_dssp             HHHTTCBTTBSSBCHHHHHHHHCCCHHHHHHHHHHHHHTTSEEECTTSCEEECH
T ss_pred             HHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHHHHHHHCCEEEEECCCCCCCCC
T ss_conf             999999747999899999999792989999999999966908984255531381