HHsearch alignment of GI: 254780305 and MMDB domain: 2vxz_A_

>2vxz_A (A:) Pyrsv_GP04; viral protein, SSPF, ORF165A; 1.7A {Pyrobaculum spherical virus}
Probab=95.94  E-value=0.0063  Score=35.75  Aligned_cols=54  Identities=17%  Similarity=0.115  Sum_probs=49.3

Q ss_pred             CHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCCEEE
Q ss_conf             989999999858898899999998299999999999999994179864798689
Q gi|254780305|r   33 QCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS   86 (95)
Q Consensus        33 ~~~~~~Il~~L~~~p~~iD~l~~~tgl~~~~v~~~LleLEL~G~i~~~pGg~v~   86 (95)
                      ++-+.+|+..|...+..+.+|++.+|++.+.|+..|-.|+=+|+|.+.-.|+..
T Consensus        10 ~ptRl~Il~~L~~g~~tv~eLa~~lgis~~tvS~HL~~L~~~GlV~~~r~Gr~~   63 (165)
T 2vxz_A           10 LVRLRDILALLADGCKTTSLIQQRLGLSHGRAKALIYVLEKEGRVTRVAFGNVA   63 (165)
T ss_dssp             HHHHHHHHHHHTTCCEEHHHHHHHHTCCHHHHHHHHHHHHHTTSCEEEEETTEE
T ss_pred             HHHHHHHHHHHHCCCHHHHHHHHHHCCHHHHHHHHHHHHHHCCCEEEEEECCEE
T ss_conf             999999999997545089999998265089999999999866816999863447