HHsearch alignment of GI: 254780305 and MMDB domain: 3bj6_A_1-125

>3bj6_A (A:1-125) Transcriptional regulator, MARR family; helix-turn-helix, trasnscription regulator, structural genomics, PSI-2; 2.01A {Silicibacter pomeroyi dss-3}
Probab=92.22  E-value=0.12  Score=28.80  Aligned_cols=55  Identities=13%  Similarity=0.067  Sum_probs=48.5

Q ss_pred             CCCCCHHHHHHHHHHC-CCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             8799989999999858-898899999998299999999999999994179864798
Q gi|254780305|r   29 PEYTQCERVRIKQSLN-NVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEG   83 (95)
Q Consensus        29 p~~~~~~~~~Il~~L~-~~p~~iD~l~~~tgl~~~~v~~~LleLEL~G~i~~~pGg   83 (95)
                      ....+..+-.||..|. .+++.+.+|++..+++.+.++.++-.||=+|+|.+.+..
T Consensus        35 ~~~lt~~q~~iL~~l~~~~~~t~~~la~~~~~~~~~vs~~i~~L~~~GlV~r~~~~   90 (125)
T 3bj6_A           35 REGVTVGQRAILEGLSLTPGATAPQLGAALQXKRQYISRILQEVQRAGLIERRTNP   90 (125)
T ss_dssp             HTTCCHHHHHHHHHHHHSTTEEHHHHHHHHTCCHHHHHHHHHHHHHTTSEEEECCS
T ss_pred             HCCCCHHHHHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHHHHHHHCCEEEEECC
T ss_conf             76989999999999998699899999999886575899999999870655765526