HHsearch alignment of GI: 254780305 and MMDB domain: 3cuo_A_10-99

>3cuo_A (A:10-99) Uncharacterized HTH-type transcriptional regulator YGAV; DNA-binding transcriptional regulator, structural genomics, PSI, MCSG; 2.00A {Escherichia coli K12}
Probab=94.94  E-value=0.038  Score=31.50  Aligned_cols=57  Identities=16%  Similarity=0.183  Sum_probs=49.6

Q ss_pred             CCHHHHHHHHHHCC-CCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCCE---EEEE
Q ss_conf             99899999998588-988999999982999999999999999941798647986---8981
Q gi|254780305|r   32 TQCERVRIKQSLNN-VPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGK---VSLT   88 (95)
Q Consensus        32 ~~~~~~~Il~~L~~-~p~~iD~l~~~tgl~~~~v~~~LleLEL~G~i~~~pGg~---v~l~   88 (95)
                      .++.+.+|+..|.. ++..+.+|++..|++.+.++-.|-.|+=.|+|....-|+   |++.
T Consensus        13 ~~~~R~~Il~~L~~~~~~~~~ela~~l~is~~tvs~HL~~L~~~Glv~~~~~g~~~~y~l~   73 (90)
T 3cuo_A           13 SHPKRLLILCMLSGSPGTSAGELTRITGLSASATSQHLARMRDEGLIDSQRDAQRILYSIK   73 (90)
T ss_dssp             CSHHHHHHHHHHTTCCSEEHHHHHHHHCCCHHHHHHHHHHHHHTTSEEEEECSSCEEEEEC
T ss_pred             CCHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHHHHHHHCCCEEEEEECCEEEEEEC
T ss_conf             8999999999997699941999999989298789999999998895179988899999988