HHsearch alignment of GI: 254780305 and MMDB domain: 3f6v_A_1-131

>3f6v_A (A:1-131) Possible transcriptional regulator, ARSR family protein; probable transcriptional repressor ARSR family, structural genomics, PSI-2; 1.48A {Rhodococcus SP}
Probab=96.36  E-value=0.002  Score=38.44  Aligned_cols=52  Identities=19%  Similarity=0.225  Sum_probs=48.6

Q ss_pred             CHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCCE
Q ss_conf             9899999998588988999999982999999999999999941798647986
Q gi|254780305|r   33 QCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGK   84 (95)
Q Consensus        33 ~~~~~~Il~~L~~~p~~iD~l~~~tgl~~~~v~~~LleLEL~G~i~~~pGg~   84 (95)
                      ++.+.+|+..|...|..+.+|++.+|++.+.++..|-.|+=+|+|.....|+
T Consensus        57 ~~~R~~Il~~L~~~~~~~~eLa~~l~is~~tvS~HL~~L~~aGlV~~~r~G~  108 (131)
T 3f6v_A           57 EPTRRRLVQLLTSGEQTVNNLAAHFPASRSAISQHLRVLTEAGLVTPRKDGR  108 (131)
T ss_dssp             SHHHHHHHHHGGGCCEEHHHHHTTSSSCHHHHHHHHHHHHHTTSEEEEEETT
T ss_pred             CHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHHHHHCCEEEEEEECC
T ss_conf             9999999999982991799999998878778999875498699357898779