HHsearch alignment of GI: 254780305 and MMDB domain: 3fm5_A_1-124

>3fm5_A (A:1-124) Transcriptional regulator; MCSG, PF04017, PSI, MARR, structural genomics, protein structure initiative; HET: GOL; 2.00A {Rhodococcus jostii RHA1}
Probab=91.33  E-value=0.24  Score=27.20  Aligned_cols=57  Identities=9%  Similarity=0.092  Sum_probs=49.3

Q ss_pred             CCCCCCCHHHHHHHHHHC-C-CCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             688799989999999858-8-98899999998299999999999999994179864798
Q gi|254780305|r   27 HYPEYTQCERVRIKQSLN-N-VPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEG   83 (95)
Q Consensus        27 ~~p~~~~~~~~~Il~~L~-~-~p~~iD~l~~~tgl~~~~v~~~LleLEL~G~i~~~pGg   83 (95)
                      ......+..+-.||..|. . .++.+.+|+..++++.+.++..+-.||=+|+|.+.+..
T Consensus        32 ~~~~~lt~~q~~iL~~l~~~~~~~t~~ela~~~~~~~~~vs~~i~~L~~~glI~r~~~~   90 (124)
T 3fm5_A           32 LVPTGLRVRSYSVLVLACEQAEGVNQRGVAATXGLDPSQIVGLVDELEERGLVVRTLDP   90 (124)
T ss_dssp             HGGGTCCHHHHHHHHHHHHSTTCCCSHHHHHHHTCCHHHHHHHHHHHHTTTSEEC----
T ss_pred             HHHCCCCHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHHHHHHHCCCEEECCCC
T ss_conf             98849899999999999985989899999999788777788999999986985651488