HHsearch results for GI: 254780305 and protein with PDBid: 1u2w_A

>1u2w_A CADC repressor, cadmium efflux system accessory protein; zinc, LEAD, SOFT metal ION resistance, ARSR/SMTB family, DNA binding protein; 1.90A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 3f72_A
Probab=93.38  E-value=0.071  Score=29.22  Aligned_cols=56  Identities=25%  Similarity=0.255  Sum_probs=49.0

Q ss_pred             CHHHHHHHHHHC-CCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCCE---EEEE
Q ss_conf             989999999858-8988999999982999999999999999941798647986---8981
Q gi|254780305|r   33 QCERVRIKQSLN-NVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGK---VSLT   88 (95)
Q Consensus        33 ~~~~~~Il~~L~-~~p~~iD~l~~~tgl~~~~v~~~LleLEL~G~i~~~pGg~---v~l~   88 (95)
                      ++.+.+|+..|. ..+..+.+|++..|++.+.++-.|-.|+=+|+|.....|+   |+|.
T Consensus        41 dp~Rl~Il~~L~~~~~~~v~ela~~l~~s~s~vS~HL~~L~~aGlV~~~r~Gr~~~Y~l~  100 (122)
T 1u2w_A           41 DENRAKITYALCQDEELCVCDIANILGVTIANASHHLRTLYKQGVVNFRKEGKLALYSLG  100 (122)
T ss_dssp             SHHHHHHHHHHHHSSCEEHHHHHHHHTCCHHHHHHHHHHHHHTTSEEEC----CCEEEES
T ss_pred             CHHHHHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHHHHHHCCCEEEEEECCEEEEEEC
T ss_conf             999999999998788927999999988873269999999998890489998788999988