HHsearch results for GI: 254780305 and protein with PDBid: 1y0u_A

>1y0u_A Arsenical resistance operon repressor, putative; structural genomics, protein structure initiative, PSI; HET: MSE; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.4.5.5
Probab=94.91  E-value=0.038  Score=30.67  Aligned_cols=56  Identities=14%  Similarity=0.052  Sum_probs=48.2

Q ss_pred             CCHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEEC
Q ss_conf             9989999999858898899999998299999999999999994179864798689813
Q gi|254780305|r   32 TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTM   89 (95)
Q Consensus        32 ~~~~~~~Il~~L~~~p~~iD~l~~~tgl~~~~v~~~LleLEL~G~i~~~pGg~v~l~~   89 (95)
                      .++.+.+|+..|. ++..+.+|+..+|++.+.++-.|-.|+=+|+|... ++.|+++.
T Consensus        29 s~p~R~~IL~~L~-~~~~~~eLa~~lg~s~stvs~HL~~L~~aGLV~~~-~~~y~lt~   84 (96)
T 1y0u_A           29 TNPVRRKILRMLD-KGRSEEEIMQTLSLSKKQLDYHLKVLEAGFCIERV-GERWVVTD   84 (96)
T ss_dssp             SCHHHHHHHHHHH-TTCCHHHHHHHHTCCHHHHHHHHHHHHHTTSEEEE-TTEEEECT
T ss_pred             CCHHHHHHHHHHC-CCCCHHHHHHHHCCCHHHHHHHHHHHHHCCCEEEE-CCEEEECC
T ss_conf             7989999999835-79979999999891998999999999988967984-79899865