HHsearch results for GI: 254780305 and protein with PDBid: 2jsc_A

>2jsc_A Transcriptional regulator RV1994C/MT2050; cadmium, transcriptional repressor, solution structure, structural genomics; NMR {Mycobacterium tuberculosis H37RV}
Probab=95.23  E-value=0.0076  Score=34.46  Aligned_cols=57  Identities=23%  Similarity=0.177  Sum_probs=51.3

Q ss_pred             CCHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCCE---EEEE
Q ss_conf             99899999998588988999999982999999999999999941798647986---8981
Q gi|254780305|r   32 TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGK---VSLT   88 (95)
Q Consensus        32 ~~~~~~~Il~~L~~~p~~iD~l~~~tgl~~~~v~~~LleLEL~G~i~~~pGg~---v~l~   88 (95)
                      .++.+.+|+..|...|.++-+|+..+|++.+.++-.|-.|+-.|+|....-|+   |++.
T Consensus        19 ~dptRl~Il~~L~~~~~~v~ela~~lgis~stvS~HL~~L~~aglV~~~r~G~~~~Y~l~   78 (118)
T 2jsc_A           19 ADPTRCRILVALLDGVCYPGQLAAHLGLTRSNVSNHLSCLRGCGLVVATYEGRQVRYALA   78 (118)
T ss_dssp             SSHHHHHHHHHHHTTCCSTTTHHHHHSSCHHHHHHHHHHHTTTTSEEEEECSSSEEEEES
T ss_pred             CCHHHHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHHHHHHCCCEEEEEECCEEEEEEC
T ss_conf             899999999999819928999999989299999999999998896279988798999978