HHsearch results for GI: 254780305 and protein with PDBid: 2x4h_A

>2x4h_A Hypothetical protein SSO2273; transcription; 2.30A {Sulfolobus solfataricus}
Probab=91.09  E-value=0.39  Score=25.24  Aligned_cols=50  Identities=22%  Similarity=0.269  Sum_probs=41.4

Q ss_pred             HHHHHHC-CCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEE
Q ss_conf             9999858-89889999999829999999999999999417986479868981
Q gi|254780305|r   38 RIKQSLN-NVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT   88 (95)
Q Consensus        38 ~Il~~L~-~~p~~iD~l~~~tgl~~~~v~~~LleLEL~G~i~~~pGg~v~l~   88 (95)
                      .|+.... ..++.+.+|++..+++.+.|..++-.|+=+|.|..-..| |.|+
T Consensus        21 aI~~l~~~~~~v~~~~iA~~L~vs~~svt~~l~~L~~~Glv~~~~~g-i~LT   71 (139)
T 2x4h_A           21 TIKRYNDSGEGAKINRIAKDLKIAPSSVFEEVSHLEEKGLVKKKEDG-VWIT   71 (139)
T ss_dssp             HHHHHHTTTSCBCHHHHHHHHTCCHHHHHHHHHHHHHTTSEEEETTE-EEEC
T ss_pred             HHHHHHHCCCCCCHHHHHHHHCCCCHHHHHHHHHHHHCCCEEEECCC-CEEC
T ss_conf             99999975998669999999688907999999999988995450477-1578