HHsearch results for GI: 254780305 and protein with PDBid: 2zkz_A

>2zkz_A Transcriptional repressor PAGR; protein-DNA, HTH motif, dimer, DNA-binding, plasmid, transcription regulation; 2.00A {Bacillus anthracis}
Probab=92.30  E-value=0.047  Score=30.22  Aligned_cols=53  Identities=17%  Similarity=0.219  Sum_probs=45.6

Q ss_pred             CCHHHHHHHHHHC-CCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCCEE
Q ss_conf             9989999999858-89889999999829999999999999999417986479868
Q gi|254780305|r   32 TQCERVRIKQSLN-NVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV   85 (95)
Q Consensus        32 ~~~~~~~Il~~L~-~~p~~iD~l~~~tgl~~~~v~~~LleLEL~G~i~~~pGg~v   85 (95)
                      .++.+.+|+..|. .++..+.+|++..|++.+.++-.|-.|+ +|.|...--|+.
T Consensus        25 ~~p~Rl~Il~~L~~~~~~~v~el~~~l~~s~stvS~HL~~L~-aglV~~~r~G~~   78 (99)
T 2zkz_A           25 AHPMRLKIVNELYKHKALNVTQIIQILKLPQSTVSQHLCKMR-GKVLKRNRQGLE   78 (99)
T ss_dssp             CSHHHHHHHHHHHHHSCEEHHHHHHHHTCCHHHHHHHHHHHB-TTTBEEEEETTE
T ss_pred             CCHHHHHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHHHHH-HCCCEEEEECCE
T ss_conf             899999999999778992799989988849769999999999-298738987588