HHsearch results for GI: 254780305 and protein with PDBid: 3gwz_A

>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A*
Probab=92.28  E-value=0.076  Score=29.09  Aligned_cols=53  Identities=13%  Similarity=0.142  Sum_probs=45.8

Q ss_pred             HHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHC-CCCEEEEE
Q ss_conf             999999858898899999998299999999999999994179864-79868981
Q gi|254780305|r   36 RVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHH-PEGKVSLT   88 (95)
Q Consensus        36 ~~~Il~~L~~~p~~iD~l~~~tgl~~~~v~~~LleLEL~G~i~~~-pGg~v~l~   88 (95)
                      +-.|++.|...|.++++|++++|++...+...|--|.-.|++.+. .+|+|+++
T Consensus        60 eLglfd~L~~gp~T~~eLA~~~g~~~~~l~rlLr~L~a~Gll~~~~~~~~~~~t  113 (369)
T 3gwz_A           60 ELGVPELLQEGPRTATALAEATGAHEQTLRRLLRLLATVGVFDDLGHDDLFAQN  113 (369)
T ss_dssp             HHTTGGGGTTSCEEHHHHHHHHTCCHHHHHHHHHHHHHTTSSEECSSTTEEECC
T ss_pred             HCCHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHHHHHHCCCEEEECCCCCCCCC
T ss_conf             888779986699999999988791989999999999978927886888764578