HHSEARCH alignment of GI: 254780305 and SCOP domain: d1i1ga1

Alignment
>d1i1ga1 a.4.5.32 (A:2-61) LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]}
Probab=90.14  E-value=0.14  Score=26.37  Aligned_cols=46  Identities=17%  Similarity=0.125  Sum_probs=40.1

Q ss_pred             HHHHHHHHHCCC-CCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHC
Q ss_conf             999999985889-8899999998299999999999999994179864
Q gi|254780305|r   35 ERVRIKQSLNNV-PIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHH   80 (95)
Q Consensus        35 ~~~~Il~~L~~~-p~~iD~l~~~tgl~~~~v~~~LleLEL~G~i~~~   80 (95)
                      -..+|+..|..+ .++..+|++++|++.+.|..-+=.|+=.|.|.+.
T Consensus         4 ~D~kIl~~L~~n~r~s~~~lA~~~gls~~~v~~Ri~~L~~~giI~~~   50 (60)
T d1i1ga1           4 RDKIILEILEKDARTPFTEIAKKLGISETAVRKRVKALEEKGIIEGY   50 (60)
T ss_dssp             HHHHHHHHHHHCTTCCHHHHHHHHTSCHHHHHHHHHHHHHHTSSCCC
T ss_pred             HHHHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHHHHHHCCCEEEE
T ss_conf             99999999988499999999999892999999999999988975768


SCOP domain information

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: Lrp/AsnC-like transcriptional regulator N-terminal domain
domain: LprA
species: Archaeon Pyrococcus furiosus [TaxId: 2261]