HHSEARCH alignment of GI: 254780305 and SCOP domain: d1p4xa2

Alignment
>d1p4xa2 a.4.5.28 (A:126-250) Staphylococcal accessory regulator A homolog, SarS {Staphylococcus aureus [TaxId: 1280]}
Probab=91.14  E-value=0.13  Score=26.51  Aligned_cols=52  Identities=15%  Similarity=0.129  Sum_probs=44.9

Q ss_pred             CCCHHHHHHHHHHCC---CCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             999899999998588---9889999999829999999999999999417986479
Q gi|254780305|r   31 YTQCERVRIKQSLNN---VPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPE   82 (95)
Q Consensus        31 ~~~~~~~~Il~~L~~---~p~~iD~l~~~tgl~~~~v~~~LleLEL~G~i~~~pG   82 (95)
                      ..+..+-.||..|..   .++.+.+|++..+++.+.++.++-.||=+|+|.+.+.
T Consensus        30 ~Ls~~q~~vL~~l~~~~~~~~~~~~ia~~l~~~~~~vs~~v~~L~~~glV~r~~~   84 (125)
T d1p4xa2          30 TLSFVEFTILAIITSQNKNIVLLKDLIETIHHKYPQTVRALNNLKKQGYLIKERS   84 (125)
T ss_dssp             SSCHHHHHHHHHHHTTTTCCEEHHHHHHHSSSCHHHHHHHHHHHHHHTSSEEEEC
T ss_pred             CCCHHHHHHHHHHHHCCCCCCCHHHHHHHHCCCCCHHHHHHHHHHHCCCEEEEEC
T ss_conf             9999999999999980378836999999978984249999999980057765421


SCOP domain information

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: MarR-like transcriptional regulators
domain: Staphylococcal accessory regulator A homolog, SarS
species: Staphylococcus aureus [TaxId: 1280]