HHSEARCH alignment of GI: 254780305 and SCOP domain: d1ub9a_

Alignment
>d1ub9a_ a.4.5.28 (A:) Hypothetical protein PH1061 {Archaeon Pyrococcus horikoshii [TaxId: 53953]}
Probab=93.33  E-value=0.02  Score=30.95  Aligned_cols=49  Identities=12%  Similarity=-0.031  Sum_probs=44.4

Q ss_pred             CHHHHHHHHHHC-CCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             989999999858-8988999999982999999999999999941798647
Q gi|254780305|r   33 QCERVRIKQSLN-NVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHP   81 (95)
Q Consensus        33 ~~~~~~Il~~L~-~~p~~iD~l~~~tgl~~~~v~~~LleLEL~G~i~~~p   81 (95)
                      ++.+.+|+..|. .++.++.+|++..+++.+.++..|-.||=+|+|.+..
T Consensus        15 ~p~r~~IL~~L~~~~~~~~~eLa~~l~is~~~vs~~l~~L~~~glV~~~~   64 (100)
T d1ub9a_          15 NPVRLGIMIFLLPRRKAPFSQIQKVLDLTPGNLDSHIRVLERNGLVKTYK   64 (100)
T ss_dssp             SHHHHHHHHHHHHHSEEEHHHHHHHTTCCHHHHHHHHHHHHHTTSEEEEE
T ss_pred             CHHHHHHHHHHCCCCCEEHHHHHHHHHHCCCCCCHHHHHHHHHCEEEEEE
T ss_conf             99999999876047990199999998625432309999882310368887


SCOP domain information

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: MarR-like transcriptional regulators
domain: Hypothetical protein PH1061
species: Archaeon Pyrococcus horikoshii [TaxId: 53953]