HHSEARCH alignment of GI: 254780305 and SCOP domain: d1z6ra1

Alignment
>d1z6ra1 a.4.5.63 (A:12-81) Mlc protein N-terminal domain {Escherichia coli [TaxId: 562]}
Probab=91.18  E-value=0.15  Score=26.26  Aligned_cols=46  Identities=9%  Similarity=0.063  Sum_probs=40.5

Q ss_pred             HHHHHHHHHCC-CCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHC
Q ss_conf             99999998588-98899999998299999999999999994179864
Q gi|254780305|r   35 ERVRIKQSLNN-VPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHH   80 (95)
Q Consensus        35 ~~~~Il~~L~~-~p~~iD~l~~~tgl~~~~v~~~LleLEL~G~i~~~   80 (95)
                      .+..|++.|-. .+++-.+|++.+|++.++|..++-+|+=.|+|...
T Consensus         6 N~~~Il~~i~~~g~~sr~eLa~~~gLS~~Tvs~iv~~L~~~glv~e~   52 (70)
T d1z6ra1           6 NAGAVYRLIDQLGPVSRIDLSRLAQLAPASITKIVHEMLEAHLVQEL   52 (70)
T ss_dssp             HHHHHHHHHHSSCSCCHHHHHHHTTCCHHHHHHHHHHHHHHTSEEEC
T ss_pred             HHHHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHHHHHHCCCEEEE
T ss_conf             99999999999499289999999894999999999999988997860


SCOP domain information

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: ROK associated domain
domain: Mlc protein N-terminal domain
species: Escherichia coli [TaxId: 562]