HHSEARCH alignment of GI: 254780305 and SCOP domain: d2fxaa1

Alignment
>d2fxaa1 a.4.5.28 (A:6-167) Protease production regulatory protein Hpr {Bacillus subtilis [TaxId: 1423]}
Probab=90.74  E-value=0.096  Score=27.24  Aligned_cols=56  Identities=13%  Similarity=0.021  Sum_probs=49.0

Q ss_pred             CCCCCCHHHHHHHHHHCC-CCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             887999899999998588-98899999998299999999999999994179864798
Q gi|254780305|r   28 YPEYTQCERVRIKQSLNN-VPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEG   83 (95)
Q Consensus        28 ~p~~~~~~~~~Il~~L~~-~p~~iD~l~~~tgl~~~~v~~~LleLEL~G~i~~~pGg   83 (95)
                      .+-..+..+-.||..|+. +++++.+|++.++++.+.++.++-.||=+|+|.+.+.-
T Consensus        35 k~~~Lt~~q~~vL~~l~~~~~~t~~~la~~~~l~~~tvs~~i~rL~~~gli~r~~~~   91 (162)
T d2fxaa1          35 KPYDLNINEHHILWIAYQLNGASISEIAKFGVMHVSTAFNFSKKLEERGYLRFSKRL   91 (162)
T ss_dssp             GGGTCCHHHHHHHHHHHHHTSEEHHHHHHHTTCCHHHHHHHHHHHHHHTSEEEECC-
T ss_pred             CCCCCCHHHHHHHHHHCCCCCCCHHHHHHHHCCCCHHHHHHHHHHHHCCCCEEECCC
T ss_conf             425999899999965211899189999999769940319989999977772342056


SCOP domain information

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: MarR-like transcriptional regulators
domain: Protease production regulatory protein Hpr
species: Bacillus subtilis [TaxId: 1423]