BLAST/PSIBLAST alignment of GI: 254780305 and GI: 90417726 at iteration 1
>gi|90417726|ref|ZP_01225638.1| DNA processing protein DprA, putative [Aurantimonas manganoxydans SI85-9A1] Length = 376
>gi|90337398|gb|EAS51049.1| DNA processing protein DprA, putative [Aurantimonas manganoxydans SI85-9A1] Length = 376
 Score = 64.7 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 34/60 (56%), Positives = 39/60 (65%)

Query: 30  EYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTM 89
           E  + ER RI ++L   PI +DDII HTG     V LVLLELDLAGRL  HP G VSL +
Sbjct: 317 EPAEGERERIVETLGPTPIDVDDIILHTGARPGAVQLVLLELDLAGRLERHPGGLVSLLL 376