BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780305|ref|YP_003064718.1| hypothetical protein
CLIBASIA_00950 [Candidatus Liberibacter asiaticus str. psy62]
         (95 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|222085614|ref|YP_002544144.1| DNA protecting protein DprA [Agrobacterium radiobacter K84]
 gi|221723062|gb|ACM26218.1| DNA protecting protein DprA [Agrobacterium radiobacter K84]
          Length = 383

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 34/88 (38%), Positives = 46/88 (52%)

Query: 2   VHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEA 61
           + P  E + F  Q      +  +    P     +R +I  +L   P+ IDDII HTG   
Sbjct: 294 LRPLAEPDLFRPQLAEAPVEKNDKALSPPPDDTDRDQIVDALGPTPVEIDDIIRHTGASV 353

Query: 62  PVVYLVLLELDLAGRLCHHPEGKVSLTM 89
             V+ VLLELD+AGRL  HP G VS++M
Sbjct: 354 SSVHSVLLELDMAGRLHRHPGGLVSISM 381


>gi|254780305|ref|YP_003064718.1| hypothetical protein CLIBASIA_00950 [Candidatus Liberibacter
          asiaticus str. psy62]
 gi|254039982|gb|ACT56778.1| hypothetical protein CLIBASIA_00950 [Candidatus Liberibacter
          asiaticus str. psy62]
          Length = 95

 Score =  107 bits (267), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 95/95 (100%), Positives = 95/95 (100%)

Query: 1  MVHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIE 60
          MVHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIE
Sbjct: 1  MVHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIE 60

Query: 61 APVVYLVLLELDLAGRLCHHPEGKVSLTMHLPSPQ 95
          APVVYLVLLELDLAGRLCHHPEGKVSLTMHLPSPQ
Sbjct: 61 APVVYLVLLELDLAGRLCHHPEGKVSLTMHLPSPQ 95


>gi|15965054|ref|NP_385407.1| hypothetical protein SMc01363 [Sinorhizobium meliloti 1021]
 gi|15074233|emb|CAC45880.1| Conserved hypothetical protein [Sinorhizobium meliloti 1021]
          Length = 383

 Score = 96.4 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 29/88 (32%), Positives = 45/88 (51%)

Query: 2   VHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEA 61
           + P    + FS       +              +R R+ ++L   P+ IDD+I +TG+ A
Sbjct: 294 LAPLSRDDLFSRLEANEPSAEEPRPMPQPPDDTDRSRVVEALGPTPVAIDDLIRYTGLAA 353

Query: 62  PVVYLVLLELDLAGRLCHHPEGKVSLTM 89
           P +++VL+ELDLAG+LC H    VSL  
Sbjct: 354 PQIHMVLVELDLAGQLCRHGGNLVSLAT 381


>gi|307317859|ref|ZP_07597297.1| DNA protecting protein DprA [Sinorhizobium meliloti AK83]
 gi|306896621|gb|EFN27369.1| DNA protecting protein DprA [Sinorhizobium meliloti AK83]
          Length = 383

 Score = 96.1 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 29/88 (32%), Positives = 45/88 (51%)

Query: 2   VHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEA 61
           + P    + FS       +              +R R+ ++L   P+ IDD+I +TG+ A
Sbjct: 294 LAPLSRDDLFSRLEANEPSAEEPRPMPQPPDDTDRSRVVEALGPTPVAIDDLIRYTGLAA 353

Query: 62  PVVYLVLLELDLAGRLCHHPEGKVSLTM 89
           P +++VL+ELDLAG+LC H    VSL  
Sbjct: 354 PQIHMVLVELDLAGQLCRHGGNLVSLAT 381


>gi|86357273|ref|YP_469165.1| DNA processing chain A protein [Rhizobium etli CFN 42]
 gi|86281375|gb|ABC90438.1| probable DNA processing chain A protein [Rhizobium etli CFN 42]
          Length = 380

 Score = 95.3 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 33/87 (37%), Positives = 45/87 (51%), Gaps = 1/87 (1%)

Query: 2   VHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEA 61
           + P  +   F S               P     +R+RI  +L   P+ IDD+I HTG+ A
Sbjct: 294 LAPLAQLELFPSSRAEAPAGESKPITMP-PGDSDRMRIIDALGPTPVEIDDVIRHTGLPA 352

Query: 62  PVVYLVLLELDLAGRLCHHPEGKVSLT 88
             VYL+LLELD++GRL  H  G VSL+
Sbjct: 353 SAVYLILLELDISGRLHRHQGGLVSLS 379


>gi|222148310|ref|YP_002549267.1| DNA protecting protein DprA [Agrobacterium vitis S4]
 gi|221735298|gb|ACM36261.1| DNA protecting protein DprA [Agrobacterium vitis S4]
          Length = 383

 Score = 95.3 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 32/87 (36%), Positives = 44/87 (50%)

Query: 2   VHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEA 61
           + P    + FS           + T      + +R RI  +L   P+ +DDII HT +  
Sbjct: 294 LSPLSSIDLFSQPQVEEPVYEESETFNQPPGEQDRSRIIDALGITPVEVDDIIRHTQLPP 353

Query: 62  PVVYLVLLELDLAGRLCHHPEGKVSLT 88
             VYLV+LELD+AGRL  HP G VS+ 
Sbjct: 354 SAVYLVMLELDIAGRLHRHPGGLVSIA 380


>gi|241204123|ref|YP_002975219.1| DNA protecting protein DprA [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240858013|gb|ACS55680.1| DNA protecting protein DprA [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 380

 Score = 95.3 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 33/87 (37%), Positives = 46/87 (52%), Gaps = 1/87 (1%)

Query: 2   VHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEA 61
           + P  + + F S        +      P     +R RI  +L   P+ IDD+I HTG+ A
Sbjct: 294 LAPLAQFDLFPSSMAEEPAPDGKPMSVP-PGDSDRNRIIDALGPTPVEIDDVIRHTGLSA 352

Query: 62  PVVYLVLLELDLAGRLCHHPEGKVSLT 88
             VYL+LLELD++GRL  H  G VSL+
Sbjct: 353 SAVYLILLELDISGRLHRHQGGLVSLS 379


>gi|116251502|ref|YP_767340.1| smf protein [Rhizobium leguminosarum bv. viciae 3841]
 gi|115256150|emb|CAK07231.1| putative smf protein [Rhizobium leguminosarum bv. viciae 3841]
          Length = 380

 Score = 95.3 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 32/87 (36%), Positives = 45/87 (51%), Gaps = 1/87 (1%)

Query: 2   VHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEA 61
           + P  + + F S        +            +R RI  +L   P+ IDD+I HTG+ A
Sbjct: 294 LAPLAQFDLFPSSMAEKPAPDGK-AMSVPPGDSDRNRIIDALGPTPVEIDDVIRHTGLSA 352

Query: 62  PVVYLVLLELDLAGRLCHHPEGKVSLT 88
             VYL+LLELD++GRL  H  G VSL+
Sbjct: 353 SAVYLILLELDISGRLHRHQGGLVSLS 379


>gi|209548899|ref|YP_002280816.1| DNA protecting protein DprA [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|209534655|gb|ACI54590.1| DNA protecting protein DprA [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 380

 Score = 94.1 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 33/87 (37%), Positives = 45/87 (51%), Gaps = 1/87 (1%)

Query: 2   VHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEA 61
           + P  +   F S       ++            +R RI  +L   P+ IDDII HTG+ A
Sbjct: 294 LAPLAQFELFPSSMAEEPPRDG-GAMTMPPGDTDRNRIIDALGPTPVEIDDIIRHTGLSA 352

Query: 62  PVVYLVLLELDLAGRLCHHPEGKVSLT 88
             VYL+LLELD+AGRL  H  G +SL+
Sbjct: 353 SAVYLILLELDIAGRLHRHQGGLISLS 379


>gi|190891322|ref|YP_001977864.1| DNA processing chain A protein [Rhizobium etli CIAT 652]
 gi|190696601|gb|ACE90686.1| DNA processing chain A protein [Rhizobium etli CIAT 652]
          Length = 380

 Score = 93.4 bits (231), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 34/87 (39%), Positives = 45/87 (51%), Gaps = 1/87 (1%)

Query: 2   VHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEA 61
           + P  +   F S      T+             +R RI  +L   P+ IDDII HTG+ A
Sbjct: 294 LAPLAQFELFPSSMAEEPTRGG-GAMTMPPGDTDRNRIIDALGPTPVEIDDIIRHTGLSA 352

Query: 62  PVVYLVLLELDLAGRLCHHPEGKVSLT 88
             VYL+LLELD++GRL  H  G VSL+
Sbjct: 353 SAVYLILLELDISGRLHRHQGGLVSLS 379


>gi|218674768|ref|ZP_03524437.1| DNA processing chain A protein [Rhizobium etli GR56]
          Length = 380

 Score = 92.2 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 32/87 (36%), Positives = 44/87 (50%), Gaps = 1/87 (1%)

Query: 2   VHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEA 61
           + P  +   F S               P     +R+ I  +L   P+ IDD+I HTG+ A
Sbjct: 294 LAPLAQLELFPSSGAEEPAGESRPITMP-PGDSDRMHIIDALGPTPVEIDDVIRHTGLPA 352

Query: 62  PVVYLVLLELDLAGRLCHHPEGKVSLT 88
             VYL+LLELD++GRL  H  G VSL+
Sbjct: 353 SAVYLILLELDISGRLHRHQGGLVSLS 379


>gi|150396156|ref|YP_001326623.1| DNA protecting protein DprA [Sinorhizobium medicae WSM419]
 gi|150027671|gb|ABR59788.1| DNA protecting protein DprA [Sinorhizobium medicae WSM419]
          Length = 383

 Score = 90.3 bits (223), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 30/88 (34%), Positives = 44/88 (50%)

Query: 2   VHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEA 61
           + P    + FS                      +R R+ ++L   P+ IDD+I HTG+ A
Sbjct: 294 LAPLSRDDLFSRLHVNEPALEELRPVPRAPDDSDRSRVVEALGPTPVEIDDLIRHTGLAA 353

Query: 62  PVVYLVLLELDLAGRLCHHPEGKVSLTM 89
           P ++LVL+ELDLAG+LC H    VS+  
Sbjct: 354 PQIHLVLVELDLAGQLCRHGGNLVSIAT 381


>gi|218663674|ref|ZP_03519604.1| DNA processing chain A protein [Rhizobium etli IE4771]
          Length = 147

 Score = 88.7 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 33/88 (37%), Positives = 46/88 (52%), Gaps = 1/88 (1%)

Query: 2   VHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEA 61
           + P  +   F S               P     +R+RI  +L   P+ IDD+I HTG+ A
Sbjct: 61  LAPLAQFELFPSSRAEEPAGESRPITMP-PGDSDRMRIIDALGPTPLEIDDVIRHTGLSA 119

Query: 62  PVVYLVLLELDLAGRLCHHPEGKVSLTM 89
             VYL+LLELD++GRL  H  G VSL++
Sbjct: 120 SAVYLILLELDISGRLHRHQGGLVSLSV 147


>gi|15888630|ref|NP_354311.1| DNA processing chain A [Agrobacterium tumefaciens str. C58]
 gi|15156358|gb|AAK87096.1| DNA processing chain A [Agrobacterium tumefaciens str. C58]
          Length = 380

 Score = 86.4 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 33/86 (38%), Positives = 43/86 (50%), Gaps = 3/86 (3%)

Query: 2   VHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEA 61
           + P +E              +  ++        ER  I  +L   P+ IDDII HTG  A
Sbjct: 294 LRPLMEPQLPYDCKIEEPRSDEEMS---PPGDDERSVIASALGPSPVEIDDIIRHTGFSA 350

Query: 62  PVVYLVLLELDLAGRLCHHPEGKVSL 87
             V+LVLLELD+AGRL  H  G+VSL
Sbjct: 351 AAVHLVLLELDIAGRLNRHAGGRVSL 376


>gi|307301126|ref|ZP_07580895.1| DNA protecting protein DprA [Sinorhizobium meliloti BL225C]
 gi|306904081|gb|EFN34667.1| DNA protecting protein DprA [Sinorhizobium meliloti BL225C]
          Length = 383

 Score = 86.0 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 29/88 (32%), Positives = 45/88 (51%)

Query: 2   VHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEA 61
           + P    + FS       +              +R R+ ++L   P+ IDD+I +TG+ A
Sbjct: 294 LAPLSRDDLFSRLEANEPSAEEPRPMPMPPDDTDRSRVVEALGPTPVAIDDLIRYTGLAA 353

Query: 62  PVVYLVLLELDLAGRLCHHPEGKVSLTM 89
           P +++VL+ELDLAG+LC H    VSL  
Sbjct: 354 PQIHMVLVELDLAGQLCRHGGNLVSLAT 381


>gi|163759336|ref|ZP_02166422.1| putative smf protein [Hoeflea phototrophica DFL-43]
 gi|162283740|gb|EDQ34025.1| putative smf protein [Hoeflea phototrophica DFL-43]
          Length = 383

 Score = 85.3 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 34/91 (37%), Positives = 44/91 (48%), Gaps = 1/91 (1%)

Query: 2   VHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEA 61
           + P                 +     + E    +R R+ ++L   P  +DDII HTG+ A
Sbjct: 294 LAPSSRLFSDDEPVMEEPGDD-ETDRFAEPGDDDRARVIEALGPSPSEVDDIIRHTGVAA 352

Query: 62  PVVYLVLLELDLAGRLCHHPEGKVSLTMHLP 92
             VYLVL+ELDLAGRL  HP G VSL    P
Sbjct: 353 ATVYLVLIELDLAGRLHRHPGGMVSLAFDDP 383


>gi|325292667|ref|YP_004278531.1| DNA processing chain A [Agrobacterium sp. H13-3]
 gi|325060520|gb|ADY64211.1| DNA processing chain A [Agrobacterium sp. H13-3]
          Length = 379

 Score = 84.1 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 29/86 (33%), Positives = 44/86 (51%), Gaps = 3/86 (3%)

Query: 2   VHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEA 61
           + P +E      +       +  ++        ER  +  +L + P+  DDII HTG  +
Sbjct: 294 LRPLMEPQLPYDRKVEEPRSDEEMS---PPGDDERSIVAAALGHSPVETDDIIRHTGFSS 350

Query: 62  PVVYLVLLELDLAGRLCHHPEGKVSL 87
             V++VLLELD+AGRL  H  G+VSL
Sbjct: 351 ATVHMVLLELDIAGRLNRHAGGRVSL 376


>gi|13470875|ref|NP_102444.1| DNA processing chain A [Mesorhizobium loti MAFF303099]
 gi|14021618|dbj|BAB48230.1| DNA processing chain A [Mesorhizobium loti MAFF303099]
          Length = 377

 Score = 83.7 bits (206), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 27/76 (35%), Positives = 43/76 (56%)

Query: 12  SSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLEL 71
            + +        + +  P   + +R ++ ++L   P+ +D+II HTG+    V++VLLEL
Sbjct: 297 RAPAVPPFEDPPDFSATPPPGESDRAKVIEALGPTPVPVDEIIRHTGLHPAQVFMVLLEL 356

Query: 72  DLAGRLCHHPEGKVSL 87
           DLAGRL  H  G VSL
Sbjct: 357 DLAGRLERHAGGNVSL 372


>gi|260459178|ref|ZP_05807433.1| DNA protecting protein DprA [Mesorhizobium opportunistum WSM2075]
 gi|259034732|gb|EEW35988.1| DNA protecting protein DprA [Mesorhizobium opportunistum WSM2075]
          Length = 383

 Score = 83.7 bits (206), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 29/90 (32%), Positives = 44/90 (48%), Gaps = 3/90 (3%)

Query: 2   VHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEA 61
           + P             +     + +  P   + +R ++ Q+L   P+ +D+II HTG+  
Sbjct: 297 IAPLTGMRAPEMPPFEDPP---DFSATPPPGESDRAKVIQALGPTPVPVDEIIRHTGLHP 353

Query: 62  PVVYLVLLELDLAGRLCHHPEGKVSLTMHL 91
             V++VLLELDLAGRL  H  G VSL    
Sbjct: 354 AQVFMVLLELDLAGRLERHAGGNVSLLFEN 383


>gi|146341416|ref|YP_001206464.1| DNA processing chain A (DprA/Smf) [Bradyrhizobium sp. ORS278]
 gi|146194222|emb|CAL78244.1| DNA processing chain A (DprA/Smf) [Bradyrhizobium sp. ORS278]
          Length = 371

 Score = 83.3 bits (205), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 29/84 (34%), Positives = 42/84 (50%), Gaps = 5/84 (5%)

Query: 4   PQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPV 63
           P +E+    S       +       P+    +R +I   L   P+ IDD+I  +G+   V
Sbjct: 292 PIMERPLPLSL-----REPDEELFAPDPESHDRTQILGLLGPTPVSIDDLIRMSGLSPAV 346

Query: 64  VYLVLLELDLAGRLCHHPEGKVSL 87
           + +VLLEL+LAGRL  H  G VSL
Sbjct: 347 LRMVLLELELAGRLERHGGGMVSL 370


>gi|46200754|ref|ZP_00056433.2| COG0758: Predicted Rossmann fold nucleotide-binding protein
           involved in DNA uptake [Magnetospirillum magnetotacticum
           MS-1]
          Length = 383

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 23/85 (27%), Positives = 40/85 (47%), Gaps = 4/85 (4%)

Query: 9   NFFSSQSDTNHTKNINITHYPEYTQCE----RVRIKQSLNNVPIHIDDIIHHTGIEAPVV 64
           +            +   +   E  + E    R ++ ++L   P+ +D+II    +   +V
Sbjct: 298 DLLRRPLAEGKRADFRASGPVEPDESELDRARSQVAEALGPAPVMVDEIIRQCQLSPSMV 357

Query: 65  YLVLLELDLAGRLCHHPEGKVSLTM 89
             VLLE++LAGRL  HP  +VSL +
Sbjct: 358 SWVLLEIELAGRLERHPGNRVSLLV 382


>gi|83309780|ref|YP_420044.1| Rossmann fold nucleotide-binding protein [Magnetospirillum
           magneticum AMB-1]
 gi|82944621|dbj|BAE49485.1| Predicted Rossmann fold nucleotide-binding protein
           [Magnetospirillum magneticum AMB-1]
          Length = 383

 Score = 82.2 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 24/85 (28%), Positives = 38/85 (44%), Gaps = 4/85 (4%)

Query: 9   NFFSSQSDTNHTKNINITHYPEYTQCE----RVRIKQSLNNVPIHIDDIIHHTGIEAPVV 64
           +            +       E    E    R R+ ++L   P+ +D+II    +   +V
Sbjct: 298 DLLRRPLAEGKRADFRAPQPVEPDTSEMDQARARVAEALGPAPVMVDEIIRQCQLSPSMV 357

Query: 65  YLVLLELDLAGRLCHHPEGKVSLTM 89
             VLLE++LAGRL  HP  +VSL +
Sbjct: 358 SWVLLEIELAGRLERHPGNRVSLLV 382


>gi|158424472|ref|YP_001525764.1| SMF protein [Azorhizobium caulinodans ORS 571]
 gi|158331361|dbj|BAF88846.1| SMF protein [Azorhizobium caulinodans ORS 571]
          Length = 374

 Score = 81.4 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 27/86 (31%), Positives = 41/86 (47%)

Query: 2   VHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEA 61
           + P +E+       +T               +  R RI + L+ VP  +DD++  +G  A
Sbjct: 288 LKPLLERPLPGGGDETFEAPRPPRAPEGGPDEGVRARILELLSPVPTALDDLVRLSGASA 347

Query: 62  PVVYLVLLELDLAGRLCHHPEGKVSL 87
             V +VLLEL+LAGRL     G V+L
Sbjct: 348 AEVQVVLLELELAGRLERQRGGLVAL 373


>gi|90417726|ref|ZP_01225638.1| DNA processing protein DprA, putative [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90337398|gb|EAS51049.1| DNA processing protein DprA, putative [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 376

 Score = 81.4 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 35/88 (39%), Positives = 45/88 (51%), Gaps = 3/88 (3%)

Query: 2   VHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEA 61
           + P  ++  +   +              E  + ER RI ++L   PI +DDII HTG   
Sbjct: 292 LRPMDDRMGWMPPAIEEPPSGQET---DEPAEGERERIVETLGPTPIDVDDIILHTGARP 348

Query: 62  PVVYLVLLELDLAGRLCHHPEGKVSLTM 89
             V LVLLELDLAGRL  HP G VSL +
Sbjct: 349 GAVQLVLLELDLAGRLERHPGGLVSLLL 376


>gi|328543466|ref|YP_004303575.1| DNA protecting protein DprA [polymorphum gilvum SL003B-26A1]
 gi|326413210|gb|ADZ70273.1| DNA protecting protein DprA, putative [Polymorphum gilvum
           SL003B-26A1]
          Length = 380

 Score = 81.0 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 30/86 (34%), Positives = 44/86 (51%), Gaps = 1/86 (1%)

Query: 2   VHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEA 61
           +  +IE         +   ++       E T   R RI  +L   P+ ID++I  TG+ A
Sbjct: 294 LAGRIEPVLPFEGEISEPDQSAPPEP-IEPTDSLRDRIVSALGPTPVEIDELIRFTGLPA 352

Query: 62  PVVYLVLLELDLAGRLCHHPEGKVSL 87
             V++VLLEL+LAGRL  H   +VSL
Sbjct: 353 RTVHVVLLELELAGRLERHRGQQVSL 378


>gi|227821656|ref|YP_002825626.1| DNA processing chain A [Sinorhizobium fredii NGR234]
 gi|227340655|gb|ACP24873.1| DNA processing chain A [Sinorhizobium fredii NGR234]
          Length = 386

 Score = 81.0 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 33/90 (36%), Positives = 45/90 (50%), Gaps = 3/90 (3%)

Query: 2   VHPQIEQNFFSSQSDTNHTKNINITHYPEYT---QCERVRIKQSLNNVPIHIDDIIHHTG 58
           + P    + FS  +          +  P      +  R  + ++L   P+ IDDII HTG
Sbjct: 294 LAPLSRDDLFSRLNAREPAVEPAPSGPPATATLGEGGRALVVEALGPTPVEIDDIIRHTG 353

Query: 59  IEAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
           + A  V+LVLLELDLAG+LC H    VSL 
Sbjct: 354 LAASEVHLVLLELDLAGQLCRHGANLVSLA 383


>gi|319783706|ref|YP_004143182.1| DNA protecting protein DprA [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317169594|gb|ADV13132.1| DNA protecting protein DprA [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 379

 Score = 81.0 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 27/78 (34%), Positives = 42/78 (53%)

Query: 12  SSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLEL 71
            +       +  +    P   + +R R+ ++L   P+ +D+II HT +    V++VLLEL
Sbjct: 297 RAPDVPPFEEPPDFLAAPPPGESDRARVIEALGPTPVPVDEIIRHTRLHPAQVFMVLLEL 356

Query: 72  DLAGRLCHHPEGKVSLTM 89
           DLAGRL  H  G VSL +
Sbjct: 357 DLAGRLERHAGGNVSLVL 374


>gi|91977499|ref|YP_570158.1| DNA processing protein DprA, putative [Rhodopseudomonas palustris
           BisB5]
 gi|91683955|gb|ABE40257.1| DNA processing protein DprA, putative [Rhodopseudomonas palustris
           BisB5]
          Length = 422

 Score = 79.9 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 33/86 (38%), Positives = 40/86 (46%), Gaps = 5/86 (5%)

Query: 2   VHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEA 61
           V P +++       +  H          E     R RI   L   PI IDD+I  +GI  
Sbjct: 341 VAPIMDRPVELPGREPEH-----PAPASEPDASHRGRIVNLLGPSPIGIDDLIRLSGIPP 395

Query: 62  PVVYLVLLELDLAGRLCHHPEGKVSL 87
            VV  VLLEL+LAGRL  H  G VSL
Sbjct: 396 AVVRTVLLELELAGRLDRHGGGLVSL 421


>gi|295982522|pdb|3MAJ|A Chain A, Crystal Structure Of Putative Dna Processing Protein Dpra
           Fr Rhodopseudomonas Palustris Cga009
          Length = 382

 Score = 79.5 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 27/79 (34%), Positives = 37/79 (46%)

Query: 10  FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLL 69
                 +    +  +     E    +R RI   L   P+ IDD+I  +GI   VV  +LL
Sbjct: 304 ILERPIELPGREPEHAPPEGEPDTGDRTRILALLGPSPVGIDDLIRLSGISPAVVRTILL 363

Query: 70  ELDLAGRLCHHPEGKVSLT 88
           EL+LAGRL  H    VSL+
Sbjct: 364 ELELAGRLERHGGSLVSLS 382


>gi|39936183|ref|NP_948459.1| DNA processing protein DprA [Rhodopseudomonas palustris CGA009]
 gi|39650038|emb|CAE28561.1| DNA processing chain A [Rhodopseudomonas palustris CGA009]
          Length = 380

 Score = 79.5 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 27/79 (34%), Positives = 37/79 (46%)

Query: 10  FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLL 69
                 +    +  +     E    +R RI   L   P+ IDD+I  +GI   VV  +LL
Sbjct: 302 ILERPIELPGREPEHAPPEGEPDTGDRTRILALLGPSPVGIDDLIRLSGISPAVVRTILL 361

Query: 70  ELDLAGRLCHHPEGKVSLT 88
           EL+LAGRL  H    VSL+
Sbjct: 362 ELELAGRLERHGGSLVSLS 380


>gi|192291901|ref|YP_001992506.1| DNA protecting protein DprA [Rhodopseudomonas palustris TIE-1]
 gi|192285650|gb|ACF02031.1| DNA protecting protein DprA [Rhodopseudomonas palustris TIE-1]
          Length = 378

 Score = 79.1 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 27/79 (34%), Positives = 37/79 (46%)

Query: 10  FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLL 69
                 +    +  +     E    +R RI   L   P+ IDD+I  +GI   VV  +LL
Sbjct: 300 ILERPIELPGREPEHAPPEGEPDTGDRTRILALLGPSPVGIDDLIRLSGISPAVVRTILL 359

Query: 70  ELDLAGRLCHHPEGKVSLT 88
           EL+LAGRL  H    VSL+
Sbjct: 360 ELELAGRLERHGGSLVSLS 378


>gi|163792865|ref|ZP_02186841.1| Predicted Rossmann fold nucleotide-binding protein [alpha
           proteobacterium BAL199]
 gi|159181511|gb|EDP66023.1| Predicted Rossmann fold nucleotide-binding protein [alpha
           proteobacterium BAL199]
          Length = 379

 Score = 78.7 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 20/73 (27%), Positives = 34/73 (46%)

Query: 21  KNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHH 80
               + H  E     R  +   L   P+ +D++I    + AP+V   LLE +LAG +  +
Sbjct: 307 DPEPVAHPLESDDTTRRTVLDVLGPEPVPVDELIRGCQLSAPIVATALLEAELAGLVDRY 366

Query: 81  PEGKVSLTMHLPS 93
           P  +V+  M  P+
Sbjct: 367 PGNQVARRMSTPA 379


>gi|316933647|ref|YP_004108629.1| DNA protecting protein DprA [Rhodopseudomonas palustris DX-1]
 gi|315601361|gb|ADU43896.1| DNA protecting protein DprA [Rhodopseudomonas palustris DX-1]
          Length = 378

 Score = 78.7 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 29/79 (36%), Positives = 39/79 (49%)

Query: 10  FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLL 69
                 +T + +  +     E    +R RI   L   P+ IDD+I  +GI   VV  VLL
Sbjct: 300 ILERPVETPNREPEHAPPTGEPEPSDRSRILGLLGPSPVGIDDLIRLSGISPAVVRTVLL 359

Query: 70  ELDLAGRLCHHPEGKVSLT 88
           EL+LAGRL  H    VSL+
Sbjct: 360 ELELAGRLERHGGSLVSLS 378


>gi|146329048|ref|YP_001209084.1| DNA processing protein DprA [Dichelobacter nodosus VCS1703A]
 gi|146232518|gb|ABQ13496.1| DNA processing protein DprA [Dichelobacter nodosus VCS1703A]
          Length = 382

 Score = 78.7 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 19/89 (21%), Positives = 34/89 (38%), Gaps = 2/89 (2%)

Query: 2   VHPQIEQNFFSSQSDTNH--TKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGI 59
           + P  + N    Q    H   +N   TH          R+   +   P  +DD++  T +
Sbjct: 291 LLPLAKANVELQQQFQPHHLPQNEPQTHQEYPANSLENRLLNIMGYDPWRVDDLVEKTHL 350

Query: 60  EAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
            A  +  +LL L+L G +     G+   +
Sbjct: 351 TAAEISAMLLMLELDGAVASLSGGRYQRS 379


>gi|307946437|ref|ZP_07661772.1| DNA protecting protein DprA [Roseibium sp. TrichSKD4]
 gi|307770101|gb|EFO29327.1| DNA protecting protein DprA [Roseibium sp. TrichSKD4]
          Length = 378

 Score = 78.3 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 24/86 (27%), Positives = 40/86 (46%), Gaps = 1/86 (1%)

Query: 2   VHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEA 61
           +  ++E +   +Q+  N         Y E     R  +  +L   P  +D++I    + A
Sbjct: 292 LAGRLEPDLPFAQTI-NEDPTSTDAPYQEPDDSSRSAVLSALGPTPTDVDELIRFLCVPA 350

Query: 62  PVVYLVLLELDLAGRLCHHPEGKVSL 87
             V ++LLEL+LAGRL  H    +SL
Sbjct: 351 RSVNVILLELELAGRLERHRGNTISL 376


>gi|332185639|ref|ZP_08387387.1| DNA protecting protein DprA [Sphingomonas sp. S17]
 gi|332014617|gb|EGI56674.1| DNA protecting protein DprA [Sphingomonas sp. S17]
          Length = 359

 Score = 78.3 bits (192), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 23/84 (27%), Positives = 36/84 (42%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVV 64
             +      +               E    +R R+   L  V + +D++I  +G    +V
Sbjct: 276 LEQIRPIDPRMVRAPGSAYTPPPPDEANDADRRRVTDLLGPVAVTVDELIRQSGRPPAIV 335

Query: 65  YLVLLELDLAGRLCHHPEGKVSLT 88
             VLLEL+LAGRL  H  G+V+L 
Sbjct: 336 QTVLLELELAGRLERHAGGRVALA 359


>gi|115525378|ref|YP_782289.1| DNA processing protein DprA, putative [Rhodopseudomonas palustris
           BisA53]
 gi|115519325|gb|ABJ07309.1| DNA protecting protein DprA [Rhodopseudomonas palustris BisA53]
          Length = 372

 Score = 78.0 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 27/79 (34%), Positives = 35/79 (44%)

Query: 9   NFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVL 68
                  +    +        E  + ER RI   L   PI +DD++   G    +V  VL
Sbjct: 293 PVLQRPIELPSREPDQPAALDEPGEGERARIIALLGPSPIGLDDLVRLAGAPPAIVRTVL 352

Query: 69  LELDLAGRLCHHPEGKVSL 87
           LEL+LAGRL  H  G VSL
Sbjct: 353 LELELAGRLERHGGGLVSL 371


>gi|218779037|ref|YP_002430355.1| DNA protecting protein DprA [Desulfatibacillum alkenivorans AK-01]
 gi|218760421|gb|ACL02887.1| DNA protecting protein DprA [Desulfatibacillum alkenivorans AK-01]
          Length = 375

 Score = 78.0 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 20/83 (24%), Positives = 34/83 (40%), Gaps = 1/83 (1%)

Query: 10  FFSSQSDTNHTKNINITHYPEYTQCE-RVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVL 68
             +++S T   + +N    P     E    + ++L   PIHID ++   G+    +   L
Sbjct: 292 EPAARSATAMEEPLNPAPAPAMGLAEDEQTVLEALGPYPIHIDVLVQRLGMPVGALSASL 351

Query: 69  LELDLAGRLCHHPEGKVSLTMHL 91
           L+L+L G     P    S    L
Sbjct: 352 LQLELKGLARQEPGKLFSRGTSL 374


>gi|92117808|ref|YP_577537.1| DNA processing protein DprA, putative [Nitrobacter hamburgensis
           X14]
 gi|91800702|gb|ABE63077.1| DNA processing protein DprA, putative [Nitrobacter hamburgensis
           X14]
          Length = 372

 Score = 77.6 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 29/86 (33%), Positives = 38/86 (44%), Gaps = 4/86 (4%)

Query: 2   VHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEA 61
           V P + +       +  H          E    +R RI   L  VPI +DD+I       
Sbjct: 290 VRPIMRRPIELPAEEPGHAGPE----TEEPDASDRSRIVGLLGPVPIGLDDLIRMADASP 345

Query: 62  PVVYLVLLELDLAGRLCHHPEGKVSL 87
            +V  VLLEL+LAGRL  H  G VS+
Sbjct: 346 AIVRTVLLELELAGRLERHGGGLVSM 371


>gi|260431072|ref|ZP_05785043.1| DNA protecting protein DprA [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260414900|gb|EEX08159.1| DNA protecting protein DprA [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 378

 Score = 77.2 bits (189), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 22/86 (25%), Positives = 35/86 (40%), Gaps = 3/86 (3%)

Query: 4   PQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPV 63
           P    + F++Q              P+     +  I   L   P+  D +I    + A  
Sbjct: 296 PPQAPDLFNAQVSPPPAPGD---MRPQPAVDLQATILSRLGPSPVAEDQLIRDVQVPASA 352

Query: 64  VYLVLLELDLAGRLCHHPEGKVSLTM 89
           V  VL+EL+L GR+   P G +SL +
Sbjct: 353 VGPVLVELELQGRIQRQPGGLLSLAV 378


>gi|254501021|ref|ZP_05113172.1| DNA protecting protein DprA, putative [Labrenzia alexandrii DFL-11]
 gi|222437092|gb|EEE43771.1| DNA protecting protein DprA, putative [Labrenzia alexandrii DFL-11]
          Length = 378

 Score = 77.2 bits (189), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 27/84 (32%), Positives = 43/84 (51%), Gaps = 1/84 (1%)

Query: 6   IEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVY 65
           IE      Q D N  +    +   E  +  R RI  +L   P+ +D++I    +   +V+
Sbjct: 296 IEPVLPFDQ-DLNEPEKDLFSAAQEPDESLRARIISALGPTPVDLDELIRFAAVPPRMVH 354

Query: 66  LVLLELDLAGRLCHHPEGKVSLTM 89
           ++LLEL+LAGRL  H   K+SL +
Sbjct: 355 IILLELELAGRLERHRGNKISLLL 378


>gi|144898216|emb|CAM75080.1| DNA processing chain A [Magnetospirillum gryphiswaldense MSR-1]
          Length = 377

 Score = 77.2 bits (189), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 23/83 (27%), Positives = 37/83 (44%), Gaps = 4/83 (4%)

Query: 9   NFFSSQSDTNHTKNINITHYPEYTQCE----RVRIKQSLNNVPIHIDDIIHHTGIEAPVV 64
           +        +              +      R  + +SL  +P+ +D +I    + A VV
Sbjct: 290 DLLRRPLAEDRRGPFEAAITAPPDESALAHARALVLESLGPMPVAVDLLIRECQLSASVV 349

Query: 65  YLVLLELDLAGRLCHHPEGKVSL 87
            +VLLEL+LAGRL  HP  +V+L
Sbjct: 350 SMVLLELELAGRLERHPGQQVAL 372


>gi|114707187|ref|ZP_01440085.1| DNA processing chain A [Fulvimarina pelagi HTCC2506]
 gi|114537383|gb|EAU40509.1| DNA processing chain A [Fulvimarina pelagi HTCC2506]
          Length = 377

 Score = 76.8 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 30/88 (34%), Positives = 47/88 (53%), Gaps = 2/88 (2%)

Query: 2   VHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEA 61
           + P  E     S+ + +  +   +  + E    ER RI ++L   P+ +DDI+ HTG   
Sbjct: 292 LRPLDEG--RRSRGNDSLDEPEVLETFEEPAGDERDRIYEALGPTPVSVDDIVEHTGASP 349

Query: 62  PVVYLVLLELDLAGRLCHHPEGKVSLTM 89
             V LV+LEL+LAGRL    +G VS+ +
Sbjct: 350 GAVQLVVLELELAGRLERQRDGTVSILL 377


>gi|299135144|ref|ZP_07028335.1| DNA protecting protein DprA [Afipia sp. 1NLS2]
 gi|298590121|gb|EFI50325.1| DNA protecting protein DprA [Afipia sp. 1NLS2]
          Length = 373

 Score = 76.4 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 26/82 (31%), Positives = 35/82 (42%), Gaps = 6/82 (7%)

Query: 7   EQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYL 66
                  + D    ++       E    +R RI   L   PI IDD++        +V  
Sbjct: 298 RPIELPMEEDEAPHESR------EPQDTDRARIVGLLGPSPIGIDDLVRMAETSPAIVRT 351

Query: 67  VLLELDLAGRLCHHPEGKVSLT 88
           VLLEL++AGRL  H  G VSL 
Sbjct: 352 VLLELEMAGRLERHGGGMVSLN 373


>gi|85716403|ref|ZP_01047375.1| SMF protein [Nitrobacter sp. Nb-311A]
 gi|85696760|gb|EAQ34646.1| SMF protein [Nitrobacter sp. Nb-311A]
          Length = 372

 Score = 75.3 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 27/84 (32%), Positives = 32/84 (38%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVV 64
            +                   T   E     R RI   L   PI  DD+I    +   VV
Sbjct: 289 AVRPIMRRPVDLPAEEPERGGTWTDEPAASARARIVALLGPAPIGPDDLIRMADVPPAVV 348

Query: 65  YLVLLELDLAGRLCHHPEGKVSLT 88
             VLLEL+LAGRL  H  G VS+ 
Sbjct: 349 RTVLLELELAGRLERHGGGLVSMA 372


>gi|90423747|ref|YP_532117.1| DNA processing protein DprA, putative [Rhodopseudomonas palustris
           BisB18]
 gi|90105761|gb|ABD87798.1| DNA processing protein DprA, putative [Rhodopseudomonas palustris
           BisB18]
          Length = 372

 Score = 74.9 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 25/79 (31%), Positives = 34/79 (43%)

Query: 9   NFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVL 68
                  +    +        E    +R R+   L   PI +DD++   G+   V   VL
Sbjct: 293 PILERPIELPSREPDEAAPIDEPGSGDRARVTSLLGPSPIGLDDLVRLAGVSPAVARTVL 352

Query: 69  LELDLAGRLCHHPEGKVSL 87
           LEL+LAGRL  H  G VSL
Sbjct: 353 LELELAGRLERHGGGLVSL 371


>gi|218531570|ref|YP_002422386.1| DNA protecting protein DprA [Methylobacterium chloromethanicum CM4]
 gi|218523873|gb|ACK84458.1| DNA protecting protein DprA [Methylobacterium chloromethanicum CM4]
          Length = 397

 Score = 74.9 bits (183), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 22/69 (31%), Positives = 33/69 (47%), Gaps = 1/69 (1%)

Query: 19  HTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLC 78
                 +   PE    +R R+   L+  P+  D++   TG+   +V   LLEL+L GR+ 
Sbjct: 326 PAAAEPVEAPPEPRD-DRARLIACLSPTPVGTDELARSTGLSVRIVQTTLLELELDGRIE 384

Query: 79  HHPEGKVSL 87
            H  G VSL
Sbjct: 385 RHGSGTVSL 393


>gi|254562490|ref|YP_003069585.1| DNA protecting protein DprA [Methylobacterium extorquens DM4]
 gi|254269768|emb|CAX25740.1| DNA protecting protein DprA [Methylobacterium extorquens DM4]
          Length = 397

 Score = 74.9 bits (183), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 22/69 (31%), Positives = 33/69 (47%), Gaps = 1/69 (1%)

Query: 19  HTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLC 78
                 +   PE    +R R+   L+  P+  D++   TG+   +V   LLEL+L GR+ 
Sbjct: 326 PAAAEPVEAPPEPRD-DRARLIACLSPTPVGTDELARSTGLSVRIVQTTLLELELDGRIE 384

Query: 79  HHPEGKVSL 87
            H  G VSL
Sbjct: 385 RHGSGTVSL 393


>gi|153010990|ref|YP_001372204.1| DNA protecting protein DprA [Ochrobactrum anthropi ATCC 49188]
 gi|151562878|gb|ABS16375.1| DNA protecting protein DprA [Ochrobactrum anthropi ATCC 49188]
          Length = 388

 Score = 74.5 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 27/91 (29%), Positives = 44/91 (48%), Gaps = 5/91 (5%)

Query: 2   VHPQI-----EQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHH 56
           + P       + N  +     +       +  P  T+ +R  +  +L  VP  ID ++ H
Sbjct: 294 LRPLAGPNAYQANIPAQPDLLSPALEEPESLQPFATEEQRDIVIDALGPVPTDIDTLVRH 353

Query: 57  TGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           TG++   V L+LLELDLAGRL  +   +V+L
Sbjct: 354 TGMDTGAVQLILLELDLAGRLHRYAGNQVAL 384


>gi|294084185|ref|YP_003550943.1| DNA protecting protein DprA [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292663758|gb|ADE38859.1| DNA protecting protein DprA [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 367

 Score = 74.5 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 23/77 (29%), Positives = 35/77 (45%), Gaps = 4/77 (5%)

Query: 14  QSDTNHTKNINITHYPEYTQCE----RVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLL 69
            +       +   + PE         R  I + +   P+ IDDIIH   + A +V+  LL
Sbjct: 284 TASQPPPPPVQDANAPEPNSNAVNKCRNIITEGVGPDPVAIDDIIHLCDMPASIVWAALL 343

Query: 70  ELDLAGRLCHHPEGKVS 86
           EL+LAG +  H   +VS
Sbjct: 344 ELELAGVILRHHGNRVS 360


>gi|27380215|ref|NP_771744.1| DNA processing protein [Bradyrhizobium japonicum USDA 110]
 gi|27353369|dbj|BAC50369.1| DNA processing protein [Bradyrhizobium japonicum USDA 110]
          Length = 380

 Score = 74.5 bits (182), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 28/86 (32%), Positives = 41/86 (47%), Gaps = 5/86 (5%)

Query: 2   VHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEA 61
           V P +E+            +  +     +    +R +I   L  VPI +DD++  +G   
Sbjct: 299 VAPIMERPLVIPA-----REPDSGPFESDPQTHDRDQITGLLGPVPIGLDDLVRMSGASP 353

Query: 62  PVVYLVLLELDLAGRLCHHPEGKVSL 87
            +V  VLLEL+LAGRL  H  G VSL
Sbjct: 354 AIVRTVLLELELAGRLERHGGGLVSL 379


>gi|218513189|ref|ZP_03510029.1| DNA processing chain A protein [Rhizobium etli 8C-3]
          Length = 352

 Score = 74.5 bits (182), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 26/73 (35%), Positives = 36/73 (49%), Gaps = 1/73 (1%)

Query: 2   VHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEA 61
           + P  +   F S      T+             +R RI  +L   P+ IDDII HTG+ A
Sbjct: 281 LAPLAQFELFPSSMAEEPTRGG-GAMTMPPGDTDRNRIIDALGPTPVEIDDIIRHTGLSA 339

Query: 62  PVVYLVLLELDLA 74
             VYL+LLELD++
Sbjct: 340 SAVYLILLELDIS 352


>gi|163852730|ref|YP_001640773.1| DNA protecting protein DprA [Methylobacterium extorquens PA1]
 gi|163664335|gb|ABY31702.1| DNA protecting protein DprA [Methylobacterium extorquens PA1]
          Length = 397

 Score = 74.5 bits (182), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 23/69 (33%), Positives = 33/69 (47%), Gaps = 1/69 (1%)

Query: 19  HTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLC 78
                 I   PE    +R R+   L+  P+  D++   TG+   +V   LLEL+L GR+ 
Sbjct: 326 PAAAEPIEAPPEPRD-DRARLIACLSPTPVGTDELARSTGLSVRIVQTTLLELELDGRIE 384

Query: 79  HHPEGKVSL 87
            H  G VSL
Sbjct: 385 RHGSGTVSL 393


>gi|114327469|ref|YP_744626.1| DNA processing protein [Granulibacter bethesdensis CGDNIH1]
 gi|114315643|gb|ABI61703.1| DNA processing protein [Granulibacter bethesdensis CGDNIH1]
          Length = 378

 Score = 74.5 bits (182), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 17/82 (20%), Positives = 31/82 (37%), Gaps = 2/82 (2%)

Query: 8   QNFFSSQSDTNHTKNINI--THYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVY 65
            + F S S    +             T   + +I   L   P+ +DD+I    +    V 
Sbjct: 292 PDLFLSPSGPAPSAKQKPGGAFTVSETNGLKEKILLLLGPDPVAVDDLIRRCQLSPSEVV 351

Query: 66  LVLLELDLAGRLCHHPEGKVSL 87
             LLE++L+  +   P  +V+ 
Sbjct: 352 AALLEMELSAHVVSLPGNRVAR 373


>gi|114321777|ref|YP_743460.1| DNA protecting protein DprA [Alkalilimnicola ehrlichii MLHE-1]
 gi|114228171|gb|ABI57970.1| DNA protecting protein DprA [Alkalilimnicola ehrlichii MLHE-1]
          Length = 379

 Score = 74.1 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 17/83 (20%), Positives = 35/83 (42%)

Query: 6   IEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVY 65
           ++Q    +  D       +          E   + +++ + P+ +D ++   G+ A  V 
Sbjct: 292 VQQALPLAIPDRTAGVTADNGGSDAGPDPEYAALLEAMGHDPVALDTLVGRCGLTADAVS 351

Query: 66  LVLLELDLAGRLCHHPEGKVSLT 88
            +LL L+L GR+   P G+   T
Sbjct: 352 SMLLLLELQGRVQALPGGRYQRT 374


>gi|238021547|ref|ZP_04601973.1| hypothetical protein GCWU000324_01447 [Kingella oralis ATCC 51147]
 gi|237866161|gb|EEP67203.1| hypothetical protein GCWU000324_01447 [Kingella oralis ATCC 51147]
          Length = 389

 Score = 74.1 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 16/87 (18%), Positives = 27/87 (31%), Gaps = 1/87 (1%)

Query: 2   VHPQIEQNFFSSQSDTNHTKNINIT-HYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIE 60
           + P+              +  +  T   PE        +   +   PIH D +   T   
Sbjct: 301 LKPKTHAAKPKPTLSQPLSTELPTTTPSPEPESTNEHPLLTKMGYDPIHPDTLAEQTEQP 360

Query: 61  APVVYLVLLELDLAGRLCHHPEGKVSL 87
           A  +Y  L E +L G +     G+   
Sbjct: 361 AADIYAQLTEWELDGIVASMAGGRYQR 387


>gi|254491244|ref|ZP_05104425.1| DNA protecting protein DprA, putative [Methylophaga thiooxidans
           DMS010]
 gi|224463757|gb|EEF80025.1| DNA protecting protein DprA, putative [Methylophaga thiooxydans
           DMS010]
          Length = 345

 Score = 73.3 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 16/69 (23%), Positives = 29/69 (42%)

Query: 20  TKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCH 79
               +          +   + + L   PI +D +I ++G+ A  V  +LL L+L G +  
Sbjct: 275 PAAQDSVSEKPERDGDYQILFEHLGFDPISVDSLIENSGLTADAVSSMLLLLELQGEVES 334

Query: 80  HPEGKVSLT 88
            P G+   T
Sbjct: 335 LPGGRYVRT 343


>gi|209884919|ref|YP_002288776.1| SMF protein [Oligotropha carboxidovorans OM5]
 gi|209873115|gb|ACI92911.1| SMF protein [Oligotropha carboxidovorans OM5]
          Length = 377

 Score = 72.9 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 33/81 (40%)

Query: 8   QNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLV 67
                         +       E    +R RI   L   PI IDD++  +     VV  V
Sbjct: 294 PIMARPIELPFEEDDSGRDESREPEDSDRARIVGLLGPSPIGIDDLVRLSDSSPAVVRTV 353

Query: 68  LLELDLAGRLCHHPEGKVSLT 88
           LLEL+LAGRL  H  G VSL 
Sbjct: 354 LLELELAGRLDRHGAGLVSLN 374


>gi|330827123|ref|YP_004390426.1| DNA protecting protein DprA [Alicycliphilus denitrificans K601]
 gi|329312495|gb|AEB86910.1| DNA protecting protein DprA [Alicycliphilus denitrificans K601]
          Length = 379

 Score = 72.9 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 15/70 (21%), Positives = 28/70 (40%)

Query: 18  NHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRL 77
                   +  P         +  +L   P+ +D ++  TG+ A  + + LLEL+L G++
Sbjct: 306 PAAGQAPESDAPPPVAPTHQEVLDALGFDPLGLDALVARTGLPAATLQVRLLELELEGQV 365

Query: 78  CHHPEGKVSL 87
              P G    
Sbjct: 366 ARLPGGMFQR 375


>gi|240140065|ref|YP_002964542.1| DNA protecting protein DprA [Methylobacterium extorquens AM1]
 gi|240010039|gb|ACS41265.1| DNA protecting protein DprA [Methylobacterium extorquens AM1]
          Length = 397

 Score = 72.9 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 21/69 (30%), Positives = 33/69 (47%), Gaps = 1/69 (1%)

Query: 19  HTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLC 78
                 +   PE    +R R+   L+  P+  D++   TG+   +V   LLEL+L G++ 
Sbjct: 326 PAAAEPVEAPPEPRD-DRERLIACLSPAPVGTDELARSTGLSVRIVQTTLLELELDGQIE 384

Query: 79  HHPEGKVSL 87
            H  G VSL
Sbjct: 385 RHGSGTVSL 393


>gi|261856670|ref|YP_003263953.1| DNA protecting protein DprA [Halothiobacillus neapolitanus c2]
 gi|261837139|gb|ACX96906.1| DNA protecting protein DprA [Halothiobacillus neapolitanus c2]
          Length = 384

 Score = 72.6 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 19/78 (24%), Positives = 31/78 (39%)

Query: 11  FSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLE 70
                DT+  +  +      +   E+ +I   L   P   D +I  +G+    V  +LL 
Sbjct: 306 LRQTDDTSLFEPESSPALAAHLDPEQQKILDCLGFDPQSADTLIASSGLTPAEVSSILLM 365

Query: 71  LDLAGRLCHHPEGKVSLT 88
           L+LAG +   P G    T
Sbjct: 366 LELAGHVTTLPGGLYVRT 383


>gi|121999102|ref|YP_001003889.1| DNA protecting protein DprA [Halorhodospira halophila SL1]
 gi|121590507|gb|ABM63087.1| DNA protecting protein DprA [Halorhodospira halophila SL1]
          Length = 388

 Score = 72.6 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 15/78 (19%), Positives = 31/78 (39%), Gaps = 1/78 (1%)

Query: 10  FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLL 69
            F            + +  P     +  RI ++L + P+ +D +   +G+    +  +LL
Sbjct: 307 EFPGTVCEAPVNAPSESTSPA-ADPDEARILEALGHDPLTLDTLQQRSGLTLDRLSSILL 365

Query: 70  ELDLAGRLCHHPEGKVSL 87
            ++L G L   P G+   
Sbjct: 366 TMELKGLLTAVPGGRYQR 383


>gi|254447541|ref|ZP_05061007.1| DNA protecting protein DprA [gamma proteobacterium HTCC5015]
 gi|198262884|gb|EDY87163.1| DNA protecting protein DprA [gamma proteobacterium HTCC5015]
          Length = 373

 Score = 72.2 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 15/86 (17%), Positives = 33/86 (38%), Gaps = 2/86 (2%)

Query: 2   VHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEA 61
           + PQ+      ++                    +   + Q++   P+ +D ++  T  +A
Sbjct: 288 LAPQLRARL--AEGVETSVSASEALSADPPLDSDHEALLQAMGFDPVTLDALVQQTDFDA 345

Query: 62  PVVYLVLLELDLAGRLCHHPEGKVSL 87
             +  +LL L+L GR+   P G+   
Sbjct: 346 SELASMLLILELEGRVSAEPGGRYQR 371


>gi|188582755|ref|YP_001926200.1| DNA protecting protein DprA [Methylobacterium populi BJ001]
 gi|179346253|gb|ACB81665.1| DNA protecting protein DprA [Methylobacterium populi BJ001]
          Length = 397

 Score = 72.2 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 22/69 (31%), Positives = 33/69 (47%), Gaps = 1/69 (1%)

Query: 19  HTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLC 78
              +  +    E    +R R+   L+  P+  D++   TG+   VV   LLEL+L GR+ 
Sbjct: 326 PGADEPVETGSEPED-DRTRLIARLSPTPVATDELARSTGLPVRVVQTTLLELELDGRIE 384

Query: 79  HHPEGKVSL 87
            H  G VSL
Sbjct: 385 RHGSGTVSL 393


>gi|88811386|ref|ZP_01126641.1| SMF protein [Nitrococcus mobilis Nb-231]
 gi|88791275|gb|EAR22387.1| SMF protein [Nitrococcus mobilis Nb-231]
          Length = 371

 Score = 72.2 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 14/75 (18%), Positives = 29/75 (38%)

Query: 13  SQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELD 72
                  T+    +           R+  +L   P+  D ++  TG+    +  +LL+L+
Sbjct: 292 PPFAGAMTERPADSGKTPSLDWGYRRVLAALGYDPVPADVLLQRTGLTPDTLSAMLLQLE 351

Query: 73  LAGRLCHHPEGKVSL 87
           L G +   P G+ + 
Sbjct: 352 LMGYVATCPGGRYAR 366


>gi|292493777|ref|YP_003529216.1| DNA protecting protein DprA [Nitrosococcus halophilus Nc4]
 gi|291582372|gb|ADE16829.1| DNA protecting protein DprA [Nitrosococcus halophilus Nc4]
          Length = 368

 Score = 72.2 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 16/53 (30%), Positives = 25/53 (47%)

Query: 33  QCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
             E   +   L   P+ ID ++   G+ A  V  +LL L+L GR+   P G+ 
Sbjct: 307 DPEYQILLDCLGYDPLPIDTLVERCGLTAEAVSSMLLMLELQGRITALPGGRY 359


>gi|77166459|ref|YP_344984.1| SMF protein [Nitrosococcus oceani ATCC 19707]
 gi|254435425|ref|ZP_05048932.1| DNA protecting protein DprA, putative [Nitrosococcus oceani AFC27]
 gi|76884773|gb|ABA59454.1| DNA protecting protein DprA [Nitrosococcus oceani ATCC 19707]
 gi|207088536|gb|EDZ65808.1| DNA protecting protein DprA, putative [Nitrosococcus oceani AFC27]
          Length = 368

 Score = 72.2 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 16/66 (24%), Positives = 26/66 (39%)

Query: 20  TKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCH 79
            +             E   +   L   P+ ID ++   G+ A  V  +LL L+L GR+  
Sbjct: 294 CQEAPQKIEASTDDLEYQLLLDCLGYDPLPIDLLVERCGLTAEAVSSMLLILELQGRITA 353

Query: 80  HPEGKV 85
            P G+ 
Sbjct: 354 LPGGRY 359


>gi|223937270|ref|ZP_03629176.1| SMF family protein [bacterium Ellin514]
 gi|223894055|gb|EEF60510.1| SMF family protein [bacterium Ellin514]
          Length = 252

 Score = 72.2 bits (176), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 14/81 (17%), Positives = 31/81 (38%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVV 64
             E  +    ++     +               ++  +L+N   +ID+II H+G+ +  V
Sbjct: 168 LSEFEYLFPSTNRPPGASETGVLPALNLSENEQKVYDALSNEESNIDEIIRHSGLPSSAV 227

Query: 65  YLVLLELDLAGRLCHHPEGKV 85
            + LL L++   +   P    
Sbjct: 228 SVALLGLEMKRLIRQLPGKMF 248


>gi|288958693|ref|YP_003449034.1| DNA processing protein [Azospirillum sp. B510]
 gi|288911001|dbj|BAI72490.1| DNA processing protein [Azospirillum sp. B510]
          Length = 378

 Score = 71.8 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 23/88 (26%), Positives = 39/88 (44%), Gaps = 4/88 (4%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYPEYTQCE----RVRIKQSLNNVPIHIDDIIHHTGIE 60
                    + D             E  + +    R  + ++L + P+ ID+++    + 
Sbjct: 291 LRAPTLAERRRDLFSAAIHPPGKAAEPDESDLARARALVLENLGHSPVTIDELVRGCQLS 350

Query: 61  APVVYLVLLELDLAGRLCHHPEGKVSLT 88
           APVV  V+LEL+LAGR+   P  +VSL 
Sbjct: 351 APVVLTVVLELELAGRVQRLPGHQVSLA 378


>gi|83594524|ref|YP_428276.1| SMF protein [Rhodospirillum rubrum ATCC 11170]
 gi|83577438|gb|ABC23989.1| SMF protein [Rhodospirillum rubrum ATCC 11170]
          Length = 374

 Score = 71.4 bits (174), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 23/87 (26%), Positives = 39/87 (44%), Gaps = 1/87 (1%)

Query: 1   MVHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIE 60
           ++ P I +   +     N+                R R+ ++L   P+ +D++I    + 
Sbjct: 287 ILSPLIARPM-AEDKPQNYASAPPSPIADSTIDAARPRVIEALGMSPVGVDEVIRLCTLP 345

Query: 61  APVVYLVLLELDLAGRLCHHPEGKVSL 87
             VV +VLLEL+LAGRL      +V L
Sbjct: 346 PAVVAVVLLELELAGRLDRLVGNRVCL 372


>gi|189499391|ref|YP_001958861.1| DNA protecting protein DprA [Chlorobium phaeobacteroides BS1]
 gi|189494832|gb|ACE03380.1| DNA protecting protein DprA [Chlorobium phaeobacteroides BS1]
          Length = 382

 Score = 71.4 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 17/71 (23%), Positives = 25/71 (35%)

Query: 16  DTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAG 75
                K I  T        E   I    +  P+HID +   TGIE   + + L E++L  
Sbjct: 309 PATPEKTIPDTPVRVPLTPEETIILDHFSEEPLHIDMLAEKTGIEPSELLVHLFEMELKN 368

Query: 76  RLCHHPEGKVS 86
            +   P     
Sbjct: 369 LIEQQPGQMFC 379


>gi|225075474|ref|ZP_03718673.1| hypothetical protein NEIFLAOT_00479 [Neisseria flavescens
           NRL30031/H210]
 gi|224953193|gb|EEG34402.1| hypothetical protein NEIFLAOT_00479 [Neisseria flavescens
           NRL30031/H210]
          Length = 396

 Score = 71.0 bits (173), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 19/86 (22%), Positives = 29/86 (33%), Gaps = 2/86 (2%)

Query: 2   VHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEA 61
           V P+  Q                  + P         + +++   PIH D +   T   A
Sbjct: 310 VKPKNNQTERLQPKTRADEPQRPSENLPAAPST--SALLEAMGYDPIHPDILAQQTNTAA 367

Query: 62  PVVYLVLLELDLAGRLCHHPEGKVSL 87
             VY  LLE +L G +   P G+   
Sbjct: 368 ADVYAQLLEYELDGIVAALPGGRYQR 393


>gi|217968559|ref|YP_002353793.1| DNA protecting protein DprA [Thauera sp. MZ1T]
 gi|217505886|gb|ACK52897.1| DNA protecting protein DprA [Thauera sp. MZ1T]
          Length = 387

 Score = 70.6 bits (172), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 17/56 (30%), Positives = 29/56 (51%)

Query: 32  TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
              ER R+ +++ + P+ +D I    G+    +Y +LL L+L GRL   P G+   
Sbjct: 330 LDGERTRVLEAIGHDPVDLDTIAARCGLTVDALYAILLPLELEGRLAKLPGGRFQR 385


>gi|254695655|ref|ZP_05157483.1| SMF protein [Brucella abortus bv. 3 str. Tulya]
 gi|261216055|ref|ZP_05930336.1| DNA protecting protein DprA [Brucella abortus bv. 3 str. Tulya]
 gi|260917662|gb|EEX84523.1| DNA protecting protein DprA [Brucella abortus bv. 3 str. Tulya]
          Length = 393

 Score = 70.6 bits (172), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 28/91 (30%), Positives = 42/91 (46%), Gaps = 5/91 (5%)

Query: 2   VHPQIEQNFFSSQSDTNHTKNINITHYPEYT-----QCERVRIKQSLNNVPIHIDDIIHH 56
           + P I     +            I   PE         ER  +  +L   P+ +D ++ H
Sbjct: 294 LLPLIRPADPAGDEPEQPDLLTQIDEEPEQLQAITTDRERDLVIDALGPAPVDVDTLVRH 353

Query: 57  TGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           TGIE   + L+LLELDLAGRL  +P  +V++
Sbjct: 354 TGIETDAIQLILLELDLAGRLLRYPGNRVAI 384


>gi|294507187|ref|YP_003571245.1| SMF protein [Salinibacter ruber M8]
 gi|294343515|emb|CBH24293.1| SMF protein [Salinibacter ruber M8]
          Length = 331

 Score = 70.6 bits (172), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 15/61 (24%), Positives = 25/61 (40%)

Query: 28  YPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
             E    E  R+  +L+  P+HID +   TG+        LLEL+  G +      +   
Sbjct: 271 PTEELSGEAERLYDALSETPVHIDALCEETGLSPSEALPTLLELEFQGWVRQLAGKQFRR 330

Query: 88  T 88
           +
Sbjct: 331 S 331


>gi|256828287|ref|YP_003157015.1| DNA protecting protein DprA [Desulfomicrobium baculatum DSM 4028]
 gi|256577463|gb|ACU88599.1| DNA protecting protein DprA [Desulfomicrobium baculatum DSM 4028]
          Length = 367

 Score = 70.6 bits (172), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 15/72 (20%), Positives = 25/72 (34%), Gaps = 1/72 (1%)

Query: 19  HTKNINITHYPEYTQCERVRIKQSLNN-VPIHIDDIIHHTGIEAPVVYLVLLELDLAGRL 77
               +      E    E+  + + L     +H+D +   TG  A  V   LL ++L G +
Sbjct: 296 PEAPVPEFLPREPDDPEQRVVHRLLAAGEALHVDTLTRRTGWAANKVSSTLLFMELQGLV 355

Query: 78  CHHPEGKVSLTM 89
              P     L  
Sbjct: 356 RQLPGMYYVLAT 367


>gi|170746908|ref|YP_001753168.1| DNA protecting protein DprA [Methylobacterium radiotolerans JCM
           2831]
 gi|170653430|gb|ACB22485.1| DNA protecting protein DprA [Methylobacterium radiotolerans JCM
           2831]
          Length = 403

 Score = 70.6 bits (172), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 25/82 (30%), Positives = 34/82 (41%)

Query: 6   IEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVY 65
              N    +              P   Q +R RI   L   P+  D++    G+ A +V 
Sbjct: 319 APLNPLPQRRAGASAPCPARDDRPPEPQDDRARIVALLGPSPVGTDELARSAGVGARIVQ 378

Query: 66  LVLLELDLAGRLCHHPEGKVSL 87
            VLLEL+L GR+  H  G VSL
Sbjct: 379 SVLLELELDGRIERHGSGTVSL 400


>gi|254720411|ref|ZP_05182222.1| SMF protein [Brucella sp. 83/13]
 gi|265985430|ref|ZP_06098165.1| DNA protecting protein DprA [Brucella sp. 83/13]
 gi|306839012|ref|ZP_07471833.1| DNA protecting protein DprA [Brucella sp. NF 2653]
 gi|264664022|gb|EEZ34283.1| DNA protecting protein DprA [Brucella sp. 83/13]
 gi|306405918|gb|EFM62176.1| DNA protecting protein DprA [Brucella sp. NF 2653]
          Length = 393

 Score = 70.3 bits (171), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 29/91 (31%), Positives = 43/91 (47%), Gaps = 5/91 (5%)

Query: 2   VHPQIEQNFFSSQSDTNHTKNINITHYPEYT-----QCERVRIKQSLNNVPIHIDDIIHH 56
           + P I     +            I   PE         ER  +  +L  VP+ +D ++ H
Sbjct: 294 LLPLIRPGDPTDDEPEQPDLLTQIDEEPEQLQAITTDRERDLVIDALGPVPVDVDTLVRH 353

Query: 57  TGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           TGIE   + L+LLELDLAGRL  +P  +V++
Sbjct: 354 TGIETDAIQLILLELDLAGRLLRYPGNRVAI 384


>gi|86749541|ref|YP_486037.1| DNA processing protein DprA, putative [Rhodopseudomonas palustris
           HaA2]
 gi|86572569|gb|ABD07126.1| DNA processing protein DprA, putative [Rhodopseudomonas palustris
           HaA2]
          Length = 378

 Score = 70.3 bits (171), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 28/52 (53%), Positives = 32/52 (61%)

Query: 36  RVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           R RI   L   P+ IDD+I  +GI   VV  VLLEL+LAGRL  H  G VSL
Sbjct: 326 RSRIVNLLGPSPVGIDDLIRLSGIAPAVVRTVLLELELAGRLERHGGGLVSL 377


>gi|297717816|gb|ADI50051.1| putative DNA processing protein DprA [Candidatus Odyssella
           thessalonicensis L13]
          Length = 361

 Score = 70.3 bits (171), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 18/89 (20%), Positives = 37/89 (41%), Gaps = 3/89 (3%)

Query: 1   MVHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIE 60
           ++ P+      S      +  ++     P   + E   I + L+  PI I+ I     + 
Sbjct: 274 ILKPEFNLTMLSEPEAEAYVASVEDFSVPASLKEE---ILRGLSETPIEINFIAQDFKLN 330

Query: 61  APVVYLVLLELDLAGRLCHHPEGKVSLTM 89
           +  +  ++LEL+L G +     G VS++ 
Sbjct: 331 SQEIMAIILELELEGLIVRQANGTVSIST 359


>gi|118590183|ref|ZP_01547586.1| hypothetical protein SIAM614_11733 [Stappia aggregata IAM 12614]
 gi|118437155|gb|EAV43793.1| hypothetical protein SIAM614_11733 [Stappia aggregata IAM 12614]
          Length = 378

 Score = 70.3 bits (171), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 26/89 (29%), Positives = 42/89 (47%), Gaps = 7/89 (7%)

Query: 2   VHPQIEQN-FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIE 60
           + P +     F   S+T      +        +  R R+  +L   P+ +D++I     +
Sbjct: 296 LAPTLPFGRQFREDSETTPLSPSD------PDEKLRERVLAALGPTPVDMDELIRFADGD 349

Query: 61  APVVYLVLLELDLAGRLCHHPEGKVSLTM 89
           A  V++VLLEL+LAGRL  H   K+S  M
Sbjct: 350 ARSVHVVLLELELAGRLERHRGNKISALM 378


>gi|163844754|ref|YP_001622409.1| DNA protecting protein DprA [Brucella suis ATCC 23445]
 gi|163675477|gb|ABY39587.1| DNA protecting protein DprA [Brucella suis ATCC 23445]
          Length = 393

 Score = 70.3 bits (171), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 29/91 (31%), Positives = 43/91 (47%), Gaps = 5/91 (5%)

Query: 2   VHPQIEQNFFSSQSDTNHTKNINITHYPEYT-----QCERVRIKQSLNNVPIHIDDIIHH 56
           + P I     +            I   PE         ER  +  +L  VP+ +D ++ H
Sbjct: 294 LLPLIRPADPAGDEPEQPDLLTQIDEEPEQLQAITTDRERDLVIDALGPVPVDVDTLVRH 353

Query: 57  TGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           TGIE   + L+LLELDLAGRL  +P  +V++
Sbjct: 354 TGIETDAIQLILLELDLAGRLLRYPGNRVAI 384


>gi|326410760|gb|ADZ67824.1| DNA protecting protein DprA [Brucella melitensis M28]
 gi|326554052|gb|ADZ88691.1| DNA protecting protein DprA [Brucella melitensis M5-90]
          Length = 393

 Score = 70.3 bits (171), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 29/91 (31%), Positives = 43/91 (47%), Gaps = 5/91 (5%)

Query: 2   VHPQIEQNFFSSQSDTNHTKNINITHYPEYT-----QCERVRIKQSLNNVPIHIDDIIHH 56
           + P I     +            I   PE         ER  +  +L  VP+ +D ++ H
Sbjct: 294 LLPLIRPADPAGDEPEQPDLLTQIDEEPEQLQAITTDRERDLVIDALGPVPVDVDTLVRH 353

Query: 57  TGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           TGIE   + L+LLELDLAGRL  +P  +V++
Sbjct: 354 TGIETDAIQLILLELDLAGRLLRYPGNRVAI 384


>gi|23500346|ref|NP_699786.1| DNA processing protein DprA [Brucella suis 1330]
 gi|161620664|ref|YP_001594550.1| DNA protecting protein DprA [Brucella canis ATCC 23365]
 gi|254702977|ref|ZP_05164805.1| DNA protecting protein DprA [Brucella suis bv. 3 str. 686]
 gi|260568110|ref|ZP_05838579.1| SMF protein [Brucella suis bv. 4 str. 40]
 gi|261753586|ref|ZP_05997295.1| DNA protecting protein DprA [Brucella suis bv. 3 str. 686]
 gi|23463962|gb|AAN33791.1| DNA processing protein DprA, putative [Brucella suis 1330]
 gi|161337475|gb|ABX63779.1| DNA protecting protein DprA [Brucella canis ATCC 23365]
 gi|260154775|gb|EEW89856.1| SMF protein [Brucella suis bv. 4 str. 40]
 gi|261743339|gb|EEY31265.1| DNA protecting protein DprA [Brucella suis bv. 3 str. 686]
          Length = 393

 Score = 70.3 bits (171), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 29/91 (31%), Positives = 43/91 (47%), Gaps = 5/91 (5%)

Query: 2   VHPQIEQNFFSSQSDTNHTKNINITHYPEYT-----QCERVRIKQSLNNVPIHIDDIIHH 56
           + P I     +            I   PE         ER  +  +L  VP+ +D ++ H
Sbjct: 294 LLPLIRPADPAGDEPEQPDLLTQIDEEPEQLQAITTDRERDLVIDALGPVPVDVDTLVRH 353

Query: 57  TGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           TGIE   + L+LLELDLAGRL  +P  +V++
Sbjct: 354 TGIETDAIQLILLELDLAGRLLRYPGNRVAI 384


>gi|78067948|ref|YP_370717.1| SMF protein [Burkholderia sp. 383]
 gi|77968693|gb|ABB10073.1| DNA protecting protein DprA [Burkholderia sp. 383]
          Length = 448

 Score = 70.3 bits (171), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 17/83 (20%), Positives = 35/83 (42%), Gaps = 1/83 (1%)

Query: 13  SQSDTNHTKNINITHYPE-YTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLEL 71
           +   T   ++   +  P          +  +L   P+  + +  H+G+   V++  LL L
Sbjct: 356 AAPATAPARDEAPSPAPPLPGTPSEQAVLAALGYGPVTYEWLAEHSGLSDDVLHRALLAL 415

Query: 72  DLAGRLCHHPEGKVSLTMHLPSP 94
           +LAGR+   P G+ +      +P
Sbjct: 416 ELAGRVASLPGGRFARLDAARTP 438


>gi|294853600|ref|ZP_06794272.1| DNA processing protein [Brucella sp. NVSL 07-0026]
 gi|294819255|gb|EFG36255.1| DNA processing protein [Brucella sp. NVSL 07-0026]
          Length = 393

 Score = 70.3 bits (171), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 29/91 (31%), Positives = 43/91 (47%), Gaps = 5/91 (5%)

Query: 2   VHPQIEQNFFSSQSDTNHTKNINITHYPEYT-----QCERVRIKQSLNNVPIHIDDIIHH 56
           + P I     +            I   PE         ER  +  +L  VP+ +D ++ H
Sbjct: 294 LLPLIRPADPAGDEPEQPDLLTQIDEEPEQLQAITTDRERDLVIDALGPVPVDVDTLVRH 353

Query: 57  TGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           TGIE   + L+LLELDLAGRL  +P  +V++
Sbjct: 354 TGIETDAIQLILLELDLAGRLLRYPGNRVAI 384


>gi|256111481|ref|ZP_05452495.1| SMF protein [Brucella melitensis bv. 3 str. Ether]
 gi|265992978|ref|ZP_06105535.1| DNA protecting protein DprA [Brucella melitensis bv. 3 str. Ether]
 gi|262763848|gb|EEZ09880.1| DNA protecting protein DprA [Brucella melitensis bv. 3 str. Ether]
          Length = 388

 Score = 70.3 bits (171), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 27/91 (29%), Positives = 41/91 (45%), Gaps = 5/91 (5%)

Query: 2   VHPQIEQ-----NFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHH 56
           + P I       +                      T  ER  +  +L  VP+ +D ++ H
Sbjct: 294 LLPLIRPADPAGDEPEQPDLLAQIDEEPEQLQAITTDRERDLVIDALGPVPVDVDTLVRH 353

Query: 57  TGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           TGIE   + L+LLELDLAGRL  +P  +V++
Sbjct: 354 TGIETDAIQLILLELDLAGRLLRYPGNRVAI 384


>gi|306845936|ref|ZP_07478503.1| DNA protecting protein DprA [Brucella sp. BO1]
 gi|306273571|gb|EFM55416.1| DNA protecting protein DprA [Brucella sp. BO1]
          Length = 393

 Score = 70.3 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 29/91 (31%), Positives = 43/91 (47%), Gaps = 5/91 (5%)

Query: 2   VHPQIEQNFFSSQSDTNHTKNINITHYPEYT-----QCERVRIKQSLNNVPIHIDDIIHH 56
           + P I     +            I   PE         ER  +  +L  VP+ +D ++ H
Sbjct: 294 LLPLIRPADPAGDEPEQPDLLTQIDEEPEQLQAITTDRERDLVIDALGPVPVDVDTLVRH 353

Query: 57  TGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           TGIE   + L+LLELDLAGRL  +P  +V++
Sbjct: 354 TGIETDAIQLILLELDLAGRLLRYPGNRVAI 384


>gi|225686388|ref|YP_002734360.1| DNA protecting protein DprA [Brucella melitensis ATCC 23457]
 gi|256262471|ref|ZP_05465003.1| SMF protein [Brucella melitensis bv. 2 str. 63/9]
 gi|225642493|gb|ACO02406.1| DNA protecting protein DprA [Brucella melitensis ATCC 23457]
 gi|263092207|gb|EEZ16504.1| SMF protein [Brucella melitensis bv. 2 str. 63/9]
          Length = 393

 Score = 70.3 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 29/91 (31%), Positives = 43/91 (47%), Gaps = 5/91 (5%)

Query: 2   VHPQIEQNFFSSQSDTNHTKNINITHYPEYT-----QCERVRIKQSLNNVPIHIDDIIHH 56
           + P I     +            I   PE         ER  +  +L  VP+ +D ++ H
Sbjct: 294 LLPLIRPADPAGDEPEQPDLLTQIDEEPEQLQAITTDRERDLVIDALGPVPVDVDTLVRH 353

Query: 57  TGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           TGIE   + L+LLELDLAGRL  +P  +V++
Sbjct: 354 TGIETDAIQLILLELDLAGRLLRYPGNRVAI 384


>gi|75676200|ref|YP_318621.1| SMF protein [Nitrobacter winogradskyi Nb-255]
 gi|74421070|gb|ABA05269.1| SMF protein [Nitrobacter winogradskyi Nb-255]
          Length = 372

 Score = 69.9 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 26/83 (31%), Positives = 32/83 (38%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVV 64
            +                       E    +R RI   L   PI +DD+I        VV
Sbjct: 289 AVRPIIRRPVDLPAEEPEPGEPWTEEPAASDRARIIALLGPAPIGLDDLIRMANAPPAVV 348

Query: 65  YLVLLELDLAGRLCHHPEGKVSL 87
             VLLEL+LAGRL  H  G VS+
Sbjct: 349 RTVLLELELAGRLERHGGGLVSM 371


>gi|319639529|ref|ZP_07994276.1| SMF-family protein [Neisseria mucosa C102]
 gi|317399100|gb|EFV79774.1| SMF-family protein [Neisseria mucosa C102]
          Length = 396

 Score = 69.9 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 19/86 (22%), Positives = 31/86 (36%), Gaps = 2/86 (2%)

Query: 2   VHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEA 61
           V P+ +Q                  + P  +      + +++   PIH D +   T   A
Sbjct: 310 VKPKNDQTKRLQPKAIADEPQRPSENPPAASST--STLLEAMGYDPIHSDILAQQTNTAA 367

Query: 62  PVVYLVLLELDLAGRLCHHPEGKVSL 87
             VY  LLE +L G +   P G+   
Sbjct: 368 ADVYAQLLEYELDGIVAALPGGRYQR 393


>gi|17989012|ref|NP_541645.1| SMF protein [Brucella melitensis bv. 1 str. 16M]
 gi|62317541|ref|YP_223394.1| DNA processing protein DprA [Brucella abortus bv. 1 str. 9-941]
 gi|83269522|ref|YP_418813.1| SMF protein [Brucella melitensis biovar Abortus 2308]
 gi|189022796|ref|YP_001932537.1| SMF protein [Brucella abortus S19]
 gi|225629094|ref|ZP_03787127.1| DNA protecting protein DprA [Brucella ceti str. Cudo]
 gi|237817089|ref|ZP_04596081.1| DNA protecting protein DprA [Brucella abortus str. 2308 A]
 gi|254698822|ref|ZP_05160650.1| SMF protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|254705901|ref|ZP_05167729.1| SMF protein [Brucella pinnipedialis M163/99/10]
 gi|254711129|ref|ZP_05172940.1| SMF protein [Brucella pinnipedialis B2/94]
 gi|254712412|ref|ZP_05174223.1| SMF protein [Brucella ceti M644/93/1]
 gi|254715484|ref|ZP_05177295.1| SMF protein [Brucella ceti M13/05/1]
 gi|254732269|ref|ZP_05190847.1| SMF protein [Brucella abortus bv. 4 str. 292]
 gi|256015379|ref|YP_003105388.1| DNA processing protein DprA, putative [Brucella microti CCM 4915]
 gi|256029510|ref|ZP_05443124.1| SMF protein [Brucella pinnipedialis M292/94/1]
 gi|256043499|ref|ZP_05446426.1| SMF protein [Brucella melitensis bv. 1 str. Rev.1]
 gi|256059205|ref|ZP_05449411.1| SMF protein [Brucella neotomae 5K33]
 gi|256157705|ref|ZP_05455623.1| SMF protein [Brucella ceti M490/95/1]
 gi|256253323|ref|ZP_05458859.1| SMF protein [Brucella ceti B1/94]
 gi|256256223|ref|ZP_05461759.1| SMF protein [Brucella abortus bv. 9 str. C68]
 gi|260167399|ref|ZP_05754210.1| DNA processing protein DprA, putative [Brucella sp. F5/99]
 gi|260544777|ref|ZP_05820598.1| SMF protein [Brucella abortus NCTC 8038]
 gi|260564694|ref|ZP_05835179.1| SMF protein [Brucella melitensis bv. 1 str. 16M]
 gi|260760064|ref|ZP_05872412.1| DNA protecting protein DprA [Brucella abortus bv. 4 str. 292]
 gi|260763303|ref|ZP_05875635.1| DNA protecting protein DprA [Brucella abortus bv. 2 str. 86/8/59]
 gi|260882451|ref|ZP_05894065.1| DNA protecting protein DprA [Brucella abortus bv. 9 str. C68]
 gi|261217219|ref|ZP_05931500.1| DNA protecting protein DprA [Brucella ceti M13/05/1]
 gi|261220439|ref|ZP_05934720.1| DNA protecting protein DprA [Brucella ceti B1/94]
 gi|261313331|ref|ZP_05952528.1| DNA protecting protein DprA [Brucella pinnipedialis M163/99/10]
 gi|261318720|ref|ZP_05957917.1| DNA protecting protein DprA [Brucella pinnipedialis B2/94]
 gi|261320090|ref|ZP_05959287.1| DNA protecting protein DprA [Brucella ceti M644/93/1]
 gi|261323154|ref|ZP_05962351.1| DNA protecting protein DprA [Brucella neotomae 5K33]
 gi|261756809|ref|ZP_06000518.1| SMF protein [Brucella sp. F5/99]
 gi|265986518|ref|ZP_06099075.1| DNA protecting protein DprA [Brucella pinnipedialis M292/94/1]
 gi|265989917|ref|ZP_06102474.1| DNA protecting protein DprA [Brucella melitensis bv. 1 str. Rev.1]
 gi|265996210|ref|ZP_06108767.1| DNA protecting protein DprA [Brucella ceti M490/95/1]
 gi|297249580|ref|ZP_06933281.1| DNA processing protein [Brucella abortus bv. 5 str. B3196]
 gi|17984851|gb|AAL53909.1| smf protein [Brucella melitensis bv. 1 str. 16M]
 gi|62197734|gb|AAX76033.1| hypothetical DprA, DNA processing protein [Brucella abortus bv. 1
           str. 9-941]
 gi|82939796|emb|CAJ12804.1| SMF protein [Brucella melitensis biovar Abortus 2308]
 gi|189021370|gb|ACD74091.1| SMF protein [Brucella abortus S19]
 gi|225615590|gb|EEH12639.1| DNA protecting protein DprA [Brucella ceti str. Cudo]
 gi|237787902|gb|EEP62118.1| DNA protecting protein DprA [Brucella abortus str. 2308 A]
 gi|255998039|gb|ACU49726.1| DNA processing protein DprA, putative [Brucella microti CCM 4915]
 gi|260098048|gb|EEW81922.1| SMF protein [Brucella abortus NCTC 8038]
 gi|260152337|gb|EEW87430.1| SMF protein [Brucella melitensis bv. 1 str. 16M]
 gi|260670382|gb|EEX57322.1| DNA protecting protein DprA [Brucella abortus bv. 4 str. 292]
 gi|260673724|gb|EEX60545.1| DNA protecting protein DprA [Brucella abortus bv. 2 str. 86/8/59]
 gi|260871979|gb|EEX79048.1| DNA protecting protein DprA [Brucella abortus bv. 9 str. C68]
 gi|260919023|gb|EEX85676.1| DNA protecting protein DprA [Brucella ceti B1/94]
 gi|260922308|gb|EEX88876.1| DNA protecting protein DprA [Brucella ceti M13/05/1]
 gi|261292780|gb|EEX96276.1| DNA protecting protein DprA [Brucella ceti M644/93/1]
 gi|261297943|gb|EEY01440.1| DNA protecting protein DprA [Brucella pinnipedialis B2/94]
 gi|261299134|gb|EEY02631.1| DNA protecting protein DprA [Brucella neotomae 5K33]
 gi|261302357|gb|EEY05854.1| DNA protecting protein DprA [Brucella pinnipedialis M163/99/10]
 gi|261736793|gb|EEY24789.1| SMF protein [Brucella sp. F5/99]
 gi|262550507|gb|EEZ06668.1| DNA protecting protein DprA [Brucella ceti M490/95/1]
 gi|263000586|gb|EEZ13276.1| DNA protecting protein DprA [Brucella melitensis bv. 1 str. Rev.1]
 gi|264658715|gb|EEZ28976.1| DNA protecting protein DprA [Brucella pinnipedialis M292/94/1]
 gi|297173449|gb|EFH32813.1| DNA processing protein [Brucella abortus bv. 5 str. B3196]
          Length = 393

 Score = 69.9 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 29/91 (31%), Positives = 43/91 (47%), Gaps = 5/91 (5%)

Query: 2   VHPQIEQNFFSSQSDTNHTKNINITHYPEYT-----QCERVRIKQSLNNVPIHIDDIIHH 56
           + P I     +            I   PE         ER  +  +L  VP+ +D ++ H
Sbjct: 294 LLPLIRPADPAGDEPEQPDLLTQIDEEPEQLQAITTDRERDLVIDALGPVPVDVDTLVRH 353

Query: 57  TGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           TGIE   + L+LLELDLAGRL  +P  +V++
Sbjct: 354 TGIETDAIQLILLELDLAGRLLRYPGNRVAI 384


>gi|258545463|ref|ZP_05705697.1| DNA processing protein DprA [Cardiobacterium hominis ATCC 15826]
 gi|258519296|gb|EEV88155.1| DNA processing protein DprA [Cardiobacterium hominis ATCC 15826]
          Length = 369

 Score = 69.9 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 13/86 (15%), Positives = 29/86 (33%), Gaps = 8/86 (9%)

Query: 2   VHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEA 61
           ++P    N                    E T  +   + +++   P  +DD++    +  
Sbjct: 290 LYPLARANLEMQIQSAPPAA--------ETTDNDSHPLLEAMGFDPCRVDDLVARLDLTP 341

Query: 62  PVVYLVLLELDLAGRLCHHPEGKVSL 87
             +  +L+  +L GR+   P G    
Sbjct: 342 AEISAMLIIFELDGRVAALPGGMFQR 367


>gi|126729116|ref|ZP_01744930.1| DNA processing protein DprA, putative [Sagittula stellata E-37]
 gi|126710106|gb|EBA09158.1| DNA processing protein DprA, putative [Sagittula stellata E-37]
          Length = 372

 Score = 69.9 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 21/85 (24%), Positives = 30/85 (35%)

Query: 3   HPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAP 62
            PQ+        +          T     T     RI   L   P+  D +I   G  + 
Sbjct: 285 QPQLGLPDPEGAAVDAVKAPEPETRTLRQTADLHTRILDRLGPSPLAEDQLIRDLGAASS 344

Query: 63  VVYLVLLELDLAGRLCHHPEGKVSL 87
            V   L +L+L GR+   P G +SL
Sbjct: 345 HVSPALTDLELEGRIRRQPGGFLSL 369


>gi|300115534|ref|YP_003762109.1| DNA protecting protein DprA [Nitrosococcus watsonii C-113]
 gi|299541471|gb|ADJ29788.1| DNA protecting protein DprA [Nitrosococcus watsonii C-113]
          Length = 368

 Score = 69.9 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 15/65 (23%), Positives = 25/65 (38%)

Query: 21  KNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHH 80
           +             E   + + L   P+ ID ++   G+ A  V  +LL L+L G +   
Sbjct: 295 QESPKEIEASTDDPEYRLLLECLGYDPLPIDRLVERCGLTAEAVSSMLLVLELQGCITAL 354

Query: 81  PEGKV 85
           P G  
Sbjct: 355 PGGHY 359


>gi|85705143|ref|ZP_01036243.1| DNA processing protein DprA, putative [Roseovarius sp. 217]
 gi|85670465|gb|EAQ25326.1| DNA processing protein DprA, putative [Roseovarius sp. 217]
          Length = 342

 Score = 69.9 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 19/88 (21%), Positives = 30/88 (34%), Gaps = 4/88 (4%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYPE----YTQCERVRIKQSLNNVPIHIDDIIHHTGIE 60
             +               ++    P      T     +I   L   P+  D +I      
Sbjct: 254 LPQIPLLKPAPAPQTEMPLDAAPVPPRSLRETASLHAQILNRLGPSPLAEDQLIRDLSTP 313

Query: 61  APVVYLVLLELDLAGRLCHHPEGKVSLT 88
           A  V   LL+L+L GR+  HP G ++L 
Sbjct: 314 AHKVAPALLDLELDGRITRHPGGLLALA 341


>gi|296134587|ref|YP_003641829.1| DNA protecting protein DprA [Thiomonas intermedia K12]
 gi|295794709|gb|ADG29499.1| DNA protecting protein DprA [Thiomonas intermedia K12]
          Length = 379

 Score = 69.5 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 16/74 (21%), Positives = 28/74 (37%)

Query: 14  QSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDL 73
            +    T++ +              I ++L       DD+   TG  A  +   LLEL+L
Sbjct: 302 PAAKTTTEDASPAAEAPPEGDTECDILRALGYDIRSFDDLSARTGWPADRLGARLLELEL 361

Query: 74  AGRLCHHPEGKVSL 87
            G++   P G+   
Sbjct: 362 QGQVARLPGGRFQR 375


>gi|222112557|ref|YP_002554821.1| DNA protecting protein dpra [Acidovorax ebreus TPSY]
 gi|221732001|gb|ACM34821.1| DNA protecting protein DprA [Acidovorax ebreus TPSY]
          Length = 386

 Score = 69.5 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 17/61 (27%), Positives = 29/61 (47%)

Query: 28  YPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
             E        +  +L   P+ +D ++  TG++A  + + LLEL+L GR+   P G    
Sbjct: 323 SEEPLAPSYQCVLDALGFDPLGLDALVARTGLDAATLQVRLLELELEGRVARLPGGLFQR 382

Query: 88  T 88
           T
Sbjct: 383 T 383


>gi|254691038|ref|ZP_05154292.1| SMF protein [Brucella abortus bv. 6 str. 870]
          Length = 381

 Score = 69.5 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 29/91 (31%), Positives = 43/91 (47%), Gaps = 5/91 (5%)

Query: 2   VHPQIEQNFFSSQSDTNHTKNINITHYPEYT-----QCERVRIKQSLNNVPIHIDDIIHH 56
           + P I     +            I   PE         ER  +  +L  VP+ +D ++ H
Sbjct: 282 LLPLIRPADPAGDEPEQPDLLTQIDEEPEQLQAITTDRERDLVIDALGPVPVDVDTLVRH 341

Query: 57  TGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           TGIE   + L+LLELDLAGRL  +P  +V++
Sbjct: 342 TGIETDAIQLILLELDLAGRLLRYPGNRVAI 372


>gi|313115002|ref|ZP_07800495.1| DNA protecting protein DprA [Faecalibacterium cf. prausnitzii
           KLE1255]
 gi|310622693|gb|EFQ06155.1| DNA protecting protein DprA [Faecalibacterium cf. prausnitzii
           KLE1255]
          Length = 378

 Score = 69.5 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 12/82 (14%), Positives = 31/82 (37%)

Query: 6   IEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVY 65
              +          +        PE       ++   +   P+ I+++   +G+   V+ 
Sbjct: 296 SAADLLGPLGLRLQSAAAVTAKQPEPLSENERKVLSCIGPQPLGIEELCVRSGLPTAVLL 355

Query: 66  LVLLELDLAGRLCHHPEGKVSL 87
             L++L+L+GR+   P  +  +
Sbjct: 356 GTLMKLELSGRVLCMPGKRYVI 377


>gi|197104784|ref|YP_002130161.1| dprA protein [Phenylobacterium zucineum HLK1]
 gi|196478204|gb|ACG77732.1| dprA protein [Phenylobacterium zucineum HLK1]
          Length = 362

 Score = 69.1 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 22/70 (31%), Positives = 30/70 (42%)

Query: 17  TNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGR 76
                        E     R R+   L+  P+  D+++  TG  AP V+  L+EL LAGR
Sbjct: 292 EPERPRFAGAPPVEPDDALRERVAALLSPTPVSRDELVRATGAPAPAVFAALVELSLAGR 351

Query: 77  LCHHPEGKVS 86
               P G VS
Sbjct: 352 ADLLPGGMVS 361


>gi|116747661|ref|YP_844348.1| DNA protecting protein DprA [Syntrophobacter fumaroxidans MPOB]
 gi|116696725|gb|ABK15913.1| DNA protecting protein DprA [Syntrophobacter fumaroxidans MPOB]
          Length = 386

 Score = 69.1 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 17/84 (20%), Positives = 28/84 (33%), Gaps = 6/84 (7%)

Query: 2   VHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEA 61
           + P I       +S     +           + + ++  + L+  P HID+I   T    
Sbjct: 297 LRPLIR------RSAAPPGEPDERETPVSGLEPDELQALRELDGNPRHIDEIARSTQWPV 350

Query: 62  PVVYLVLLELDLAGRLCHHPEGKV 85
             V  VL  L+L G     P    
Sbjct: 351 GKVMAVLSNLELKGVARQLPGKYF 374


>gi|239818073|ref|YP_002946983.1| DNA protecting protein DprA [Variovorax paradoxus S110]
 gi|239804650|gb|ACS21717.1| DNA protecting protein DprA [Variovorax paradoxus S110]
          Length = 382

 Score = 69.1 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 16/84 (19%), Positives = 25/84 (29%), Gaps = 3/84 (3%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVV 64
             E     + S                       +  +L   P+ +D +   TG  A  +
Sbjct: 299 LEELPSLHTGSAAAPASANGNAGGAP---ASEEPLLDALGFDPVSLDALSARTGWSAAAL 355

Query: 65  YLVLLELDLAGRLCHHPEGKVSLT 88
              LLEL+L G +   P G     
Sbjct: 356 QARLLELELDGHVARLPGGLFQRA 379


>gi|193214336|ref|YP_001995535.1| DNA protecting protein DprA [Chloroherpeton thalassium ATCC 35110]
 gi|193087813|gb|ACF13088.1| DNA protecting protein DprA [Chloroherpeton thalassium ATCC 35110]
          Length = 386

 Score = 69.1 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 17/83 (20%), Positives = 29/83 (34%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVV 64
             E    +SQ +             E    E   I   +N  PI ID+++  +G+    +
Sbjct: 302 LNELQPHTSQINLFEENGHRPLPPQESLSQEESDILALINASPIQIDELVEKSGMAVSDL 361

Query: 65  YLVLLELDLAGRLCHHPEGKVSL 87
              L EL+L  ++   P      
Sbjct: 362 QCTLFELELKHQVEQLPGKFFKR 384


>gi|304399255|ref|ZP_07381121.1| DNA protecting protein DprA [Pantoea sp. aB]
 gi|304353181|gb|EFM17562.1| DNA protecting protein DprA [Pantoea sp. aB]
          Length = 374

 Score = 69.1 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 18/78 (23%), Positives = 34/78 (43%), Gaps = 6/78 (7%)

Query: 10  FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLL 69
             ++Q+D  +++  +    P         +  ++ +    +D +    G   PV+   LL
Sbjct: 290 LPATQADEIYSEVSDDAPLPFAD------VLANVGDDVTPVDVVAERAGQSVPVISAQLL 343

Query: 70  ELDLAGRLCHHPEGKVSL 87
           EL+LAG +   P G V L
Sbjct: 344 ELELAGWIAAVPGGYVRL 361


>gi|298370610|ref|ZP_06981925.1| smf protein [Neisseria sp. oral taxon 014 str. F0314]
 gi|298281220|gb|EFI22710.1| smf protein [Neisseria sp. oral taxon 014 str. F0314]
          Length = 393

 Score = 69.1 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 15/86 (17%), Positives = 30/86 (34%), Gaps = 3/86 (3%)

Query: 5   QIEQNFFSSQSDTNHT---KNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEA 61
            I+++   ++         +           Q     +  ++   P+H D +       A
Sbjct: 305 AIKRDTSETRKPEPPATVGRPSENVGTEAGRQAASSPLLDAMGYDPVHPDTLAQQLQFPA 364

Query: 62  PVVYLVLLELDLAGRLCHHPEGKVSL 87
             VY  LLEL+L G++     G+   
Sbjct: 365 ADVYAELLELELDGKVASLAGGRYQR 390


>gi|83814168|ref|YP_445312.1| DNA processing protein DprA [Salinibacter ruber DSM 13855]
 gi|83755562|gb|ABC43675.1| DNA processing protein DprA [Salinibacter ruber DSM 13855]
          Length = 388

 Score = 69.1 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 15/61 (24%), Positives = 25/61 (40%)

Query: 28  YPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
             E    E  R+  +L+  P+HID +   TG+        LLEL+  G +      +   
Sbjct: 328 PTEELSGEAERLYDALSETPVHIDALCEETGLSPSEALPTLLELEFQGWVRQLAGKQFRR 387

Query: 88  T 88
           +
Sbjct: 388 S 388


>gi|297617128|ref|YP_003702287.1| DNA protecting protein DprA [Syntrophothermus lipocalidus DSM
           12680]
 gi|297144965|gb|ADI01722.1| DNA protecting protein DprA [Syntrophothermus lipocalidus DSM
           12680]
          Length = 366

 Score = 69.1 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 12/53 (22%), Positives = 23/53 (43%)

Query: 33  QCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
             E   +   L   P+H+D ++  +G+    +  +LLEL + G +   P    
Sbjct: 308 SSEFDMVLDLLGTEPVHLDQLVRLSGLTPGQLSGMLLELQIRGIIEVLPGNYF 360


>gi|167585075|ref|ZP_02377463.1| DNA protecting protein DprA [Burkholderia ubonensis Bu]
          Length = 327

 Score = 69.1 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 13/89 (14%), Positives = 29/89 (32%)

Query: 7   EQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYL 66
            ++          +                  +  +L   P+  + +   +G+    ++ 
Sbjct: 229 PEDVLDEYGLRAESPGDAPPAAATSGDAAEQAVLAALGYGPVTYEWLAERSGLSDDALHR 288

Query: 67  VLLELDLAGRLCHHPEGKVSLTMHLPSPQ 95
            LL L+LAGR+     G+        +PQ
Sbjct: 289 ALLALELAGRVASVAGGRFVRLGGPAAPQ 317


>gi|308188322|ref|YP_003932453.1| Protein smf [Pantoea vagans C9-1]
 gi|308058832|gb|ADO11004.1| Protein smf [Pantoea vagans C9-1]
          Length = 374

 Score = 68.7 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 18/78 (23%), Positives = 33/78 (42%), Gaps = 6/78 (7%)

Query: 10  FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLL 69
              +Q+D  +++  +    P         +  ++ +    +D +    G   PV+   LL
Sbjct: 290 LPVAQADEIYSEVRDDAPLPFAD------VLANVGDDVTPVDVVAERAGQSVPVISAQLL 343

Query: 70  ELDLAGRLCHHPEGKVSL 87
           EL+LAG +   P G V L
Sbjct: 344 ELELAGWIAAVPGGYVRL 361


>gi|148558431|ref|YP_001257589.1| SMF protein [Brucella ovis ATCC 25840]
 gi|148369716|gb|ABQ62588.1| SMF protein [Brucella ovis ATCC 25840]
          Length = 393

 Score = 68.7 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 26/91 (28%), Positives = 40/91 (43%), Gaps = 5/91 (5%)

Query: 2   VHPQIEQ-----NFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHH 56
           + P I       +                      T  ER  +  +L  VP+ +D ++ H
Sbjct: 294 LLPLIRPADPAGDEPKQPDLLTQIDEEPEQLQAITTDRERDLVIDALGPVPVDVDTLVRH 353

Query: 57  TGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           TGIE   + L+LLELDLAG L  +P  +V++
Sbjct: 354 TGIETDAIQLILLELDLAGHLLRYPGNRVAI 384


>gi|134297377|ref|YP_001121112.1| DNA protecting protein DprA [Burkholderia vietnamiensis G4]
 gi|134140534|gb|ABO56277.1| DNA protecting protein DprA [Burkholderia vietnamiensis G4]
          Length = 449

 Score = 68.7 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 15/90 (16%), Positives = 31/90 (34%), Gaps = 1/90 (1%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVV 64
               +  +                P         +  +L   P+  + +  H+ +   V+
Sbjct: 351 AASPDTDTDTVADAPAVPPRTACAPA-NDPAERAVLAALGYGPVTYEWLAEHSDLPDDVL 409

Query: 65  YLVLLELDLAGRLCHHPEGKVSLTMHLPSP 94
           +  LL L+LAGR+     G+ +     P+P
Sbjct: 410 HRALLALELAGRVASVAGGRFARLDLAPTP 439


>gi|159901058|ref|YP_001547305.1| DNA protecting protein DprA [Herpetosiphon aurantiacus ATCC 23779]
 gi|159894097|gb|ABX07177.1| DNA protecting protein DprA [Herpetosiphon aurantiacus ATCC 23779]
          Length = 369

 Score = 68.7 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 16/91 (17%), Positives = 29/91 (31%)

Query: 4   PQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPV 63
           P         Q + +  +                 +   L+  P HID++    G+ A  
Sbjct: 275 PLRSVEQLLEQLNLHQAQAQQTVSTIVPETPAEALLLPHLSGQPTHIDELGRSCGLAAHD 334

Query: 64  VYLVLLELDLAGRLCHHPEGKVSLTMHLPSP 94
           +   L  ++L G + H       L    P+P
Sbjct: 335 LAATLGLMELKGMVRHVGGMHYVLARETPAP 365


>gi|120613317|ref|YP_972995.1| DNA protecting protein DprA [Acidovorax citrulli AAC00-1]
 gi|120591781|gb|ABM35221.1| DNA protecting protein DprA [Acidovorax citrulli AAC00-1]
          Length = 408

 Score = 68.7 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 18/87 (20%), Positives = 35/87 (40%), Gaps = 4/87 (4%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYPEYTQCE----RVRIKQSLNNVPIHIDDIIHHTGIE 60
             E    ++ S  + +         E            + +SL   P+ +D ++  TG++
Sbjct: 318 LEELRLPAAPSTASPSARPEGADGSEPPDRAASGPHADVLESLGFDPMGLDALVARTGLD 377

Query: 61  APVVYLVLLELDLAGRLCHHPEGKVSL 87
           A  + + LLEL+L G++   P G    
Sbjct: 378 ASRLQVALLELELEGQVARLPGGLFQR 404


>gi|306841750|ref|ZP_07474436.1| DNA protecting protein DprA [Brucella sp. BO2]
 gi|306288155|gb|EFM59542.1| DNA protecting protein DprA [Brucella sp. BO2]
          Length = 345

 Score = 68.7 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 27/91 (29%), Positives = 42/91 (46%), Gaps = 5/91 (5%)

Query: 2   VHPQIEQ-----NFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHH 56
           + P I       +     +                T  ER  +  +L  VP+ +D ++ H
Sbjct: 246 LLPLIRPGDPADDEPEQPNLLAQIDEEPEQLQAITTDRERDLVIDALGPVPVDVDTLVRH 305

Query: 57  TGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           TGIE   + L+LLELDLAGRL  +P  +V++
Sbjct: 306 TGIETDAIQLILLELDLAGRLLRYPGNRVAI 336


>gi|326387674|ref|ZP_08209280.1| DNA processing protein DprA, putative [Novosphingobium
           nitrogenifigens DSM 19370]
 gi|326207720|gb|EGD58531.1| DNA processing protein DprA, putative [Novosphingobium
           nitrogenifigens DSM 19370]
          Length = 383

 Score = 68.7 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 21/70 (30%), Positives = 32/70 (45%), Gaps = 2/70 (2%)

Query: 18  NHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRL 77
                    +  +    E   I   L   P+ +D++I  TG     V + L+EL+LAGRL
Sbjct: 314 AAFDGAPPDYGDDPALTEE--IAAMLGPAPVPVDELIRQTGAPPGSVQMALVELELAGRL 371

Query: 78  CHHPEGKVSL 87
             H  G+VS+
Sbjct: 372 HRHAGGRVSI 381


>gi|115353234|ref|YP_775073.1| DNA protecting protein DprA [Burkholderia ambifaria AMMD]
 gi|115283222|gb|ABI88739.1| DNA protecting protein DprA [Burkholderia ambifaria AMMD]
          Length = 422

 Score = 68.7 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 17/72 (23%), Positives = 32/72 (44%)

Query: 23  INITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPE 82
             ++            +  +L   P+  + +  H+G+   V+Y  LL L+LAGR+   P 
Sbjct: 341 SPVSEGAPPDTPAERSVLAALGYGPVTYEWLAEHSGLSDDVLYSALLALELAGRVASVPG 400

Query: 83  GKVSLTMHLPSP 94
           G+ +     P+P
Sbjct: 401 GRFARLDAAPTP 412


>gi|163733552|ref|ZP_02140995.1| DNA processing protein DprA, putative [Roseobacter litoralis Och
           149]
 gi|161393340|gb|EDQ17666.1| DNA processing protein DprA, putative [Roseobacter litoralis Och
           149]
          Length = 358

 Score = 68.7 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 15/86 (17%), Positives = 32/86 (37%), Gaps = 2/86 (2%)

Query: 3   HPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAP 62
            PQ+     + + D+     +              +I   L+  P+  D +I    + A 
Sbjct: 275 APQLPIPAPTPRRDSPPPAKMKTKLKQAA--ALHRQILSRLSPAPVPEDQLIRDLAVTAS 332

Query: 63  VVYLVLLELDLAGRLCHHPEGKVSLT 88
                LL+L++ G++     G +S +
Sbjct: 333 EAAPALLDLEMDGQITRQSGGMLSRS 358


>gi|91774545|ref|YP_544301.1| DNA processing protein DprA, putative [Methylobacillus flagellatus
           KT]
 gi|91708532|gb|ABE48460.1| DNA protecting protein DprA [Methylobacillus flagellatus KT]
          Length = 336

 Score = 68.7 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 11/69 (15%), Positives = 27/69 (39%)

Query: 19  HTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLC 78
                +     +        + ++L   P+ +D +   +G+    +  +LL L+L G++ 
Sbjct: 266 PKPIPDAIDTVQPAGSVHDPLLEALGYDPVSLDTLAARSGLTTERLSAMLLVLELEGKVT 325

Query: 79  HHPEGKVSL 87
             P G+   
Sbjct: 326 SLPGGRFQR 334


>gi|149200840|ref|ZP_01877815.1| DNA processing protein DprA, putative [Roseovarius sp. TM1035]
 gi|149145173|gb|EDM33199.1| DNA processing protein DprA, putative [Roseovarius sp. TM1035]
          Length = 356

 Score = 68.7 bits (167), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 19/84 (22%), Positives = 31/84 (36%), Gaps = 4/84 (4%)

Query: 9   NFFSSQSDTNHTKNINITHYPEYTQCE----RVRIKQSLNNVPIHIDDIIHHTGIEAPVV 64
           +     +         +   P  T  +      +I   L   P+  D +I      A  V
Sbjct: 272 DALPQAASIATASQTELPLRPTPTLRDIAGLHAQILNRLGPSPLAEDQLIRDLATPAHRV 331

Query: 65  YLVLLELDLAGRLCHHPEGKVSLT 88
              LL+L+L GR+  HP G ++L 
Sbjct: 332 APALLDLELDGRITRHPGGLLALA 355


>gi|121596333|ref|YP_988229.1| Fis family transcriptional regulator [Acidovorax sp. JS42]
 gi|120608413|gb|ABM44153.1| DNA protecting protein DprA [Acidovorax sp. JS42]
          Length = 386

 Score = 68.3 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 16/61 (26%), Positives = 28/61 (45%)

Query: 27  HYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
              E        +  +L   P+ +D ++  TG++A  + + LLEL+L GR+   P G   
Sbjct: 322 ASEEPLAPSYQCVLDALGFDPLGLDALVARTGLDAATLQVRLLELELEGRVARLPGGLFQ 381

Query: 87  L 87
            
Sbjct: 382 R 382


>gi|304391708|ref|ZP_07373650.1| DNA protecting protein DprA [Ahrensia sp. R2A130]
 gi|303295937|gb|EFL90295.1| DNA protecting protein DprA [Ahrensia sp. R2A130]
          Length = 378

 Score = 68.3 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 24/56 (42%), Positives = 39/56 (69%)

Query: 33  QCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
           Q +R ++++SL++ P+ IDD+I HT + A  V ++LLE+DLAG +  H   +VSL 
Sbjct: 323 QSDREKLQRSLSHAPVDIDDLIRHTDLPAGAVQMLLLEMDLAGTIERHSGNRVSLA 378


>gi|75909996|ref|YP_324292.1| SMF protein [Anabaena variabilis ATCC 29413]
 gi|75703721|gb|ABA23397.1| SMF protein [Anabaena variabilis ATCC 29413]
          Length = 372

 Score = 68.3 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 17/73 (23%), Positives = 29/73 (39%)

Query: 13  SQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELD 72
            Q D     ++           E  R+  +++   +  D II  TG+ A  V   LL+L+
Sbjct: 297 PQLDVVDKSSVPEQLSLPTLSPELQRVLDTISFDALPFDLIIQQTGMNAGSVSSALLQLE 356

Query: 73  LAGRLCHHPEGKV 85
           L G +   P  + 
Sbjct: 357 LMGIVSQLPGMRY 369


>gi|294338533|emb|CAZ86862.1| Protein smf (DNA-processing chain A) [Thiomonas sp. 3As]
          Length = 379

 Score = 68.3 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 18/76 (23%), Positives = 27/76 (35%), Gaps = 1/76 (1%)

Query: 12  SSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLEL 71
              + T           P     E   I ++L       DD+   TG  A  +   LLEL
Sbjct: 301 RPAAKTTTADASPAAEAPPECDTE-CDILRTLGYDIRSFDDLSARTGWPADRLGARLLEL 359

Query: 72  DLAGRLCHHPEGKVSL 87
           +L G++   P G+   
Sbjct: 360 ELEGQVARLPGGRFQR 375


>gi|91781429|ref|YP_556635.1| SMF protein [Burkholderia xenovorans LB400]
 gi|91685383|gb|ABE28583.1| DNA protecting protein DprA [Burkholderia xenovorans LB400]
          Length = 421

 Score = 68.3 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 19/89 (21%), Positives = 35/89 (39%)

Query: 2   VHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEA 61
           V P+      +  S  +     N          E  R+  +L + P  ++ +   T +E 
Sbjct: 332 VRPKPATAQTAETSAADSATAPNPAPAHRPVDPEAERLLTALGHSPTTLEILATRTEMED 391

Query: 62  PVVYLVLLELDLAGRLCHHPEGKVSLTMH 90
             +   LL+L+LAG++   P G+     H
Sbjct: 392 ATLQSTLLQLELAGQVTVLPGGRFMRASH 420


>gi|254699839|ref|ZP_05161667.1| SMF protein [Brucella suis bv. 5 str. 513]
 gi|261750312|ref|ZP_05994021.1| DNA protecting protein DprA [Brucella suis bv. 5 str. 513]
 gi|261740065|gb|EEY27991.1| DNA protecting protein DprA [Brucella suis bv. 5 str. 513]
          Length = 393

 Score = 68.3 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 28/91 (30%), Positives = 42/91 (46%), Gaps = 5/91 (5%)

Query: 2   VHPQIEQNFFSSQSDTNHTKNINITHYPEYT-----QCERVRIKQSLNNVPIHIDDIIHH 56
           + P I     +            I   PE         ER  +  +L  VP+ +D ++ H
Sbjct: 294 LLPLIRPADPAGDEPEQPDLLTQIDEEPEQLQAITTDRERDLVIDALGPVPVDVDTLVRH 353

Query: 57  TGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           TGIE   + L+LLELDL GRL  +P  +V++
Sbjct: 354 TGIETDAIQLILLELDLVGRLLRYPGNRVAI 384


>gi|296283690|ref|ZP_06861688.1| DNA processing chain A [Citromicrobium bathyomarinum JL354]
          Length = 363

 Score = 67.9 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 26/76 (34%), Positives = 39/76 (51%)

Query: 13  SQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELD 72
            +S              +  + E V I Q L + P+ +D++I  +G  +  V L LLEL+
Sbjct: 288 PRSTFREPSAAFEAVPEDLAEAEPVEIAQLLTSAPVSVDELIRQSGAGSAAVQLALLELE 347

Query: 73  LAGRLCHHPEGKVSLT 88
           +AGRL  H  GKVSL+
Sbjct: 348 IAGRLERHAGGKVSLS 363


>gi|268608877|ref|ZP_06142604.1| DNA protecting protein DprA [Ruminococcus flavefaciens FD-1]
          Length = 422

 Score = 67.9 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 19/85 (22%), Positives = 34/85 (40%), Gaps = 1/85 (1%)

Query: 3   HPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAP 62
            P+  +    S  + N   + + T   E T   + RI   L +  +H D+I     I++ 
Sbjct: 337 RPKKAKEEIPSVPEENRVADADDTDNDELTD-IQQRIVTELRDGSLHADEICRRLDIDSA 395

Query: 63  VVYLVLLELDLAGRLCHHPEGKVSL 87
            +   L EL++ G +   P     L
Sbjct: 396 ELMTELTELEIVGAVRSLPGKMYEL 420


>gi|296117478|ref|ZP_06836065.1| putative DNA processing chain A [Gluconacetobacter hansenii ATCC
           23769]
 gi|295975999|gb|EFG82790.1| putative DNA processing chain A [Gluconacetobacter hansenii ATCC
           23769]
          Length = 375

 Score = 67.9 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 16/92 (17%), Positives = 34/92 (36%), Gaps = 4/92 (4%)

Query: 6   IEQNFFSSQSDTNHTKNINITHYPEYTQCER----VRIKQSLNNVPIHIDDIIHHTGIEA 61
           +    F+   D          + P   + +R      + + L+  P  +DD++       
Sbjct: 284 VPPPLFTPAPDPVPRGVEMAENMPSSPRMDRHGAHAAVLELLSFAPSSVDDLVRRCQFST 343

Query: 62  PVVYLVLLELDLAGRLCHHPEGKVSLTMHLPS 93
             V  VL E++++G +       V L+   P+
Sbjct: 344 ATVLTVLSEMEMSGLIDILAGDMVVLSSAPPA 375


>gi|260756634|ref|ZP_05868982.1| DNA protecting protein DprA [Brucella abortus bv. 6 str. 870]
 gi|260676742|gb|EEX63563.1| DNA protecting protein DprA [Brucella abortus bv. 6 str. 870]
          Length = 343

 Score = 67.9 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 29/91 (31%), Positives = 43/91 (47%), Gaps = 5/91 (5%)

Query: 2   VHPQIEQNFFSSQSDTNHTKNINITHYPEYT-----QCERVRIKQSLNNVPIHIDDIIHH 56
           + P I     +            I   PE         ER  +  +L  VP+ +D ++ H
Sbjct: 244 LLPLIRPADPAGDEPEQPDLLTQIDEEPEQLQAITTDRERDLVIDALGPVPVDVDTLVRH 303

Query: 57  TGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           TGIE   + L+LLELDLAGRL  +P  +V++
Sbjct: 304 TGIETDAIQLILLELDLAGRLLRYPGNRVAI 334


>gi|307292856|ref|ZP_07572702.1| DNA protecting protein DprA [Sphingobium chlorophenolicum L-1]
 gi|306880922|gb|EFN12138.1| DNA protecting protein DprA [Sphingobium chlorophenolicum L-1]
          Length = 360

 Score = 67.9 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 20/64 (31%), Positives = 34/64 (53%)

Query: 25  ITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGK 84
                +  + +R  +   L    + +D++I  +G+   +V  VLLEL+LA RL  H  GK
Sbjct: 297 EPPSSDVAERDRAAVIGLLGMAAVPVDEVIRLSGLAPAIVQTVLLELELADRLERHAGGK 356

Query: 85  VSLT 88
           VS++
Sbjct: 357 VSIS 360


>gi|254488483|ref|ZP_05101688.1| DNA processing protein [Roseobacter sp. GAI101]
 gi|214045352|gb|EEB85990.1| DNA processing protein [Roseobacter sp. GAI101]
          Length = 347

 Score = 67.9 bits (165), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 20/83 (24%), Positives = 29/83 (34%)

Query: 6   IEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVY 65
            +                  T     T    ++I   L   PI  D +I      A  V 
Sbjct: 264 ADAVQPRQAELGLPESAPAPTRSLRETAALHLQILSRLGPSPIAEDQLIRDLQASAAKVA 323

Query: 66  LVLLELDLAGRLCHHPEGKVSLT 88
            VL++L+L G++   P G VS T
Sbjct: 324 PVLIDLELEGQILRQPGGLVSRT 346


>gi|317049805|ref|YP_004117453.1| DNA protecting protein DprA [Pantoea sp. At-9b]
 gi|316951422|gb|ADU70897.1| DNA protecting protein DprA [Pantoea sp. At-9b]
          Length = 374

 Score = 67.9 bits (165), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 18/87 (20%), Positives = 31/87 (35%), Gaps = 2/87 (2%)

Query: 3   HPQIEQNFFSSQSDTNHTKNINITHYPEYTQCER--VRIKQSLNNVPIHIDDIIHHTGIE 60
           HP    +   S  +          +  +          +  ++ +    +D +    G  
Sbjct: 275 HPDHILDDLHSTLNWLPATQPETIYSQDSDDVPLPFADVLANVGDEVTPVDVVAERAGQP 334

Query: 61  APVVYLVLLELDLAGRLCHHPEGKVSL 87
            PV+   LLEL+LAG +   P G V L
Sbjct: 335 VPVISAQLLELELAGWIAAVPGGYVRL 361


>gi|160945997|ref|ZP_02093223.1| hypothetical protein FAEPRAM212_03530 [Faecalibacterium prausnitzii
           M21/2]
 gi|158443728|gb|EDP20733.1| hypothetical protein FAEPRAM212_03530 [Faecalibacterium prausnitzii
           M21/2]
          Length = 375

 Score = 67.9 bits (165), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 13/70 (18%), Positives = 27/70 (38%)

Query: 18  NHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRL 77
               +      P        R+   +   P+ I+++   TG+    +   L++L+L GR+
Sbjct: 305 TRQASPAAAKQPAPLSDTERRVLACIGPKPVGIEELCVSTGLPMSALLGTLMKLELTGRV 364

Query: 78  CHHPEGKVSL 87
              P  +  L
Sbjct: 365 YKQPGQRYVL 374


>gi|148265710|ref|YP_001232416.1| DNA protecting protein DprA [Geobacter uraniireducens Rf4]
 gi|146399210|gb|ABQ27843.1| DNA protecting protein DprA [Geobacter uraniireducens Rf4]
          Length = 359

 Score = 67.9 bits (165), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 17/81 (20%), Positives = 29/81 (35%)

Query: 8   QNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLV 67
           ++        +                +   I   L   P+HIDDII  + +    V  +
Sbjct: 279 EDILEELPQRSKVVAHADPLPSFSLTPQEAGIYTLLAESPLHIDDIIVKSELTVGDVSAI 338

Query: 68  LLELDLAGRLCHHPEGKVSLT 88
           LL L+L G +   P    ++T
Sbjct: 339 LLRLELKGAVMQLPGKHFAIT 359


>gi|220933380|ref|YP_002512279.1| smf protein [Thioalkalivibrio sp. HL-EbGR7]
 gi|219994690|gb|ACL71292.1| smf protein [Thioalkalivibrio sp. HL-EbGR7]
          Length = 375

 Score = 67.6 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 14/65 (21%), Positives = 28/65 (43%), Gaps = 2/65 (3%)

Query: 30  EYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTM 89
                E   +  ++   P+ +D ++  TG+    V  +LL ++L G++     G+     
Sbjct: 313 SEMDSEHQALLDAMGYDPVTVDRLVSRTGLTVAAVSSMLLIMELRGQVVSLSGGRYVR-- 370

Query: 90  HLPSP 94
           H P P
Sbjct: 371 HQPEP 375


>gi|302342564|ref|YP_003807093.1| DNA protecting protein DprA [Desulfarculus baarsii DSM 2075]
 gi|301639177|gb|ADK84499.1| DNA protecting protein DprA [Desulfarculus baarsii DSM 2075]
          Length = 376

 Score = 67.6 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 15/73 (20%), Positives = 29/73 (39%)

Query: 16  DTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAG 75
             +  +   +    +    E   +   +   P H+D +I  +G++A  V   LL L+LA 
Sbjct: 304 APSPARPRALLSQDDGLLPEERALLALVGPEPTHVDQLIRRSGLDAQSVAHHLLNLELAE 363

Query: 76  RLCHHPEGKVSLT 88
           R+      +  L 
Sbjct: 364 RVRQLAGKRYELA 376


>gi|222832550|gb|EEE71027.1| predicted protein [Populus trichocarpa]
          Length = 166

 Score = 67.6 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 18/79 (22%), Positives = 31/79 (39%)

Query: 13  SQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELD 72
             S                   E     ++L + P+ +D+++  TG++A  +   LLEL+
Sbjct: 88  PLSKPVPAAAAAAAAVQSAQDHENDATLRALAHDPLSLDELMDRTGMDAAALQAHLLELE 147

Query: 73  LAGRLCHHPEGKVSLTMHL 91
           L GR+   P G      H 
Sbjct: 148 LEGRVERLPGGLFQRLAHA 166


>gi|224369818|ref|YP_002603982.1| DprA [Desulfobacterium autotrophicum HRM2]
 gi|223692535|gb|ACN15818.1| DprA [Desulfobacterium autotrophicum HRM2]
          Length = 372

 Score = 67.6 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 18/93 (19%), Positives = 35/93 (37%), Gaps = 7/93 (7%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYP-------EYTQCERVRIKQSLNNVPIHIDDIIHHT 57
           +  ++         HT+ ++    P       +      + I   L   P+HID I+  T
Sbjct: 280 ETHRDVIQELHHMVHTEPLDPLTKPRGKNENKKELTRVELAIVTILEPYPLHIDKIVEKT 339

Query: 58  GIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMH 90
            ++   +   LL+L+L G +   P    S+   
Sbjct: 340 DLDIASISAALLDLELKGMVRQLPGKLFSIKEE 372


>gi|158522455|ref|YP_001530325.1| DNA protecting protein DprA [Desulfococcus oleovorans Hxd3]
 gi|158511281|gb|ABW68248.1| DNA protecting protein DprA [Desulfococcus oleovorans Hxd3]
          Length = 389

 Score = 67.6 bits (164), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 17/85 (20%), Positives = 36/85 (42%), Gaps = 1/85 (1%)

Query: 2   VHPQIEQNFFSSQSDTNHTKNINITHYPEY-TQCERVRIKQSLNNVPIHIDDIIHHTGIE 60
           + P++     ++ + ++          P      + VR+ Q+L   P+HID+I     + 
Sbjct: 286 ISPRLAAGPATAPAASDRADENKHAGKPTPGLDTDEVRVLQTLEPYPVHIDEIAQKAAMA 345

Query: 61  APVVYLVLLELDLAGRLCHHPEGKV 85
                 +LL+L+L G +   P  + 
Sbjct: 346 PGKTAGILLQLELKGFVTQEPGKRF 370


>gi|84685604|ref|ZP_01013501.1| DNA processing protein DprA, putative [Maritimibacter alkaliphilus
           HTCC2654]
 gi|84666270|gb|EAQ12743.1| DNA processing protein DprA, putative [Rhodobacterales bacterium
           HTCC2654]
          Length = 375

 Score = 67.6 bits (164), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 16/69 (23%), Positives = 24/69 (34%)

Query: 20  TKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCH 79
                 T     T      I   L   P+  D ++    + A  V   L +L+L G +  
Sbjct: 306 PSAPAETRTLAETAALHQLILDRLGPSPVSEDQLVRDLAMPAGDVASELTDLELEGHVSR 365

Query: 80  HPEGKVSLT 88
            P G +S T
Sbjct: 366 APGGLISRT 374


>gi|114763467|ref|ZP_01442874.1| DNA processing protein DprA, putative [Pelagibaca bermudensis
           HTCC2601]
 gi|114544005|gb|EAU47016.1| DNA processing protein DprA, putative [Roseovarius sp. HTCC2601]
          Length = 375

 Score = 67.2 bits (163), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 19/92 (20%), Positives = 31/92 (33%), Gaps = 8/92 (8%)

Query: 4   PQIEQNFFSSQSD-TNHTKNINITHYPEYTQCE-------RVRIKQSLNNVPIHIDDIIH 55
           P  +    +SQ      T    +   P               +I   L   P+  D +I 
Sbjct: 283 PLEQPTASTSQQAARRRTDRAPVIPAPPPESRSLAETAQLHRQILDRLGPAPLAEDQLIR 342

Query: 56  HTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
                +  V   L +L++ GR+   P G +SL
Sbjct: 343 DLAAPSDAVAPALTDLEIDGRIRRQPGGLLSL 374


>gi|114776898|ref|ZP_01451941.1| DNA processing protein DprA [Mariprofundus ferrooxydans PV-1]
 gi|114552984|gb|EAU55415.1| DNA processing protein DprA [Mariprofundus ferrooxydans PV-1]
          Length = 369

 Score = 67.2 bits (163), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 14/61 (22%), Positives = 25/61 (40%)

Query: 31  YTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMH 90
               E   I  ++    +H+D +    G+  P +  +LL L+L G +   P  +  L   
Sbjct: 306 PADAEEAGILMAMRGEAVHLDLLAETCGLTLPELSPILLRLELQGVIERLPGSRYLLATE 365

Query: 91  L 91
           L
Sbjct: 366 L 366


>gi|307151412|ref|YP_003886796.1| DNA protecting protein DprA [Cyanothece sp. PCC 7822]
 gi|306981640|gb|ADN13521.1| DNA protecting protein DprA [Cyanothece sp. PCC 7822]
          Length = 402

 Score = 67.2 bits (163), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 15/81 (18%), Positives = 27/81 (33%)

Query: 8   QNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLV 67
            N  + +                    +   + Q++   P   D I+  TG+    V   
Sbjct: 322 PNLDTEKQKQLSIFEQTPIKAMPDLSIQLTEVLQAVGVEPTAFDLIVQKTGLCTGEVSAA 381

Query: 68  LLELDLAGRLCHHPEGKVSLT 88
           LL+L+L G +   P  +   T
Sbjct: 382 LLQLELFGVIAQLPGMRYQRT 402


>gi|221638586|ref|YP_002524848.1| DNA protecting protein DprA [Rhodobacter sphaeroides KD131]
 gi|221159367|gb|ACM00347.1| DNA protecting protein DprA [Rhodobacter sphaeroides KD131]
          Length = 372

 Score = 67.2 bits (163), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 18/75 (24%), Positives = 27/75 (36%)

Query: 13  SQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELD 72
             + +   +                RI   L  VP+  D +I    + A  V   L+ L+
Sbjct: 296 PAARSPEPQPDPPRRPLYEISAVHSRILDRLGPVPVPEDQLIRDLSLPAGRVAQELVALE 355

Query: 73  LAGRLCHHPEGKVSL 87
           L GR+   P G VS 
Sbjct: 356 LEGRIQRDPGGLVSR 370


>gi|270308041|ref|YP_003330099.1| Rossmann fold DNA uptake nucleotide-binding protein
           [Dehalococcoides sp. VS]
 gi|270153933|gb|ACZ61771.1| Rossmann fold DNA uptake nucleotide-binding protein
           [Dehalococcoides sp. VS]
          Length = 373

 Score = 67.2 bits (163), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 15/64 (23%), Positives = 22/64 (34%), Gaps = 1/64 (1%)

Query: 21  KNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHH 80
              + T            I   L   PIHID I    G+   +V   L  ++L G++   
Sbjct: 294 SAQDNTLASAPENQTESLILDKLGYEPIHIDQICRECGLGIALVSSTLAIMELRGQV-RS 352

Query: 81  PEGK 84
             G 
Sbjct: 353 AGGM 356


>gi|241766762|ref|ZP_04764592.1| DNA protecting protein DprA [Acidovorax delafieldii 2AN]
 gi|241362868|gb|EER58607.1| DNA protecting protein DprA [Acidovorax delafieldii 2AN]
          Length = 390

 Score = 67.2 bits (163), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 15/83 (18%), Positives = 30/83 (36%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVV 64
             E         +                     + Q++   P+ +D ++  TG++   +
Sbjct: 304 LEELRLPGPVQASAAAPTNMAPPNAAPPPPAESPLLQAMGFDPVGLDTLMARTGMDTATM 363

Query: 65  YLVLLELDLAGRLCHHPEGKVSL 87
            + LLEL+LAG +   P G+   
Sbjct: 364 QVQLLELELAGAVARLPGGRFQR 386


>gi|291619141|ref|YP_003521883.1| Smf [Pantoea ananatis LMG 20103]
 gi|291154171|gb|ADD78755.1| Smf [Pantoea ananatis LMG 20103]
          Length = 376

 Score = 67.2 bits (163), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 17/87 (19%), Positives = 30/87 (34%), Gaps = 2/87 (2%)

Query: 3   HPQIEQNFFSSQSDTNHTKNINITHYPEYTQCER--VRIKQSLNNVPIHIDDIIHHTGIE 60
           HP        +  +       +  +             +  ++ +    +D +    G  
Sbjct: 277 HPNNIIEDLRAMLNWLPVTQSDEIYSDASDDAPLPFAELLANVGDEVTPVDVVAERAGQP 336

Query: 61  APVVYLVLLELDLAGRLCHHPEGKVSL 87
            PV+   LLEL+LAG +   P G V L
Sbjct: 337 VPVITAQLLELELAGWIAAVPGGYVRL 363


>gi|326319400|ref|YP_004237072.1| DNA protecting protein DprA [Acidovorax avenae subsp. avenae ATCC
           19860]
 gi|323376236|gb|ADX48505.1| DNA protecting protein DprA [Acidovorax avenae subsp. avenae ATCC
           19860]
          Length = 403

 Score = 67.2 bits (163), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 16/76 (21%), Positives = 31/76 (40%)

Query: 12  SSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLEL 71
           S+          N              + ++L   P+ +D ++  TG++A  + + LLEL
Sbjct: 324 SALLPAGPPGAGNDEPPGRAASGPHADVLEALGFDPMGLDALVARTGLDASRLQVALLEL 383

Query: 72  DLAGRLCHHPEGKVSL 87
           +L G++   P G    
Sbjct: 384 ELEGQVARLPGGLFQR 399


>gi|301632279|ref|XP_002945218.1| PREDICTED: hypothetical protein LOC100495052 [Xenopus (Silurana)
           tropicalis]
          Length = 729

 Score = 67.2 bits (163), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 16/80 (20%), Positives = 31/80 (38%), Gaps = 1/80 (1%)

Query: 8   QNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLV 67
           Q+             +      E  +     +  ++   P+ +D +I  TG++   + + 
Sbjct: 647 QDVLEELRLPAPAVAVQPAVSAEAQESVE-PLLSAMGWDPVGLDALIARTGMDTATLQVA 705

Query: 68  LLELDLAGRLCHHPEGKVSL 87
           LLE +LAGR+   P G    
Sbjct: 706 LLEHELAGRVARLPGGSFQR 725


>gi|288941785|ref|YP_003444025.1| DNA protecting protein DprA [Allochromatium vinosum DSM 180]
 gi|288897157|gb|ADC62993.1| DNA protecting protein DprA [Allochromatium vinosum DSM 180]
          Length = 377

 Score = 67.2 bits (163), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 18/87 (20%), Positives = 40/87 (45%), Gaps = 2/87 (2%)

Query: 2   VHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEA 61
           + PQ+      + +D +          P     E+ R+ +SL + P+++D++   TG+  
Sbjct: 292 LAPQLRAEL--AAADRSTPGARRAAAPPPDLPPEQARLLESLGHDPVNLDELTERTGLAV 349

Query: 62  PVVYLVLLELDLAGRLCHHPEGKVSLT 88
             +  +LL ++L G +   P G+ +  
Sbjct: 350 EQISSMLLLMELEGHVSCLPGGRYTRA 376


>gi|149915652|ref|ZP_01904178.1| DNA processing protein DprA, putative [Roseobacter sp. AzwK-3b]
 gi|149810544|gb|EDM70387.1| DNA processing protein DprA, putative [Roseobacter sp. AzwK-3b]
          Length = 357

 Score = 67.2 bits (163), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 21/86 (24%), Positives = 31/86 (36%), Gaps = 2/86 (2%)

Query: 4   PQIEQN--FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEA 61
           P ++        Q +T            +       RI   L   P+  D +I   G  A
Sbjct: 271 PAVQPPDKPLQHQGETRPAPPPPDRRSLQDIAALHSRILSRLGPSPLAEDQLIRDLGAPA 330

Query: 62  PVVYLVLLELDLAGRLCHHPEGKVSL 87
             V   L +L+L GR+   P G +SL
Sbjct: 331 GQVTPALTDLELDGRIRRQPGGLLSL 356


>gi|77462726|ref|YP_352230.1| hypothetical protein RSP_2177 [Rhodobacter sphaeroides 2.4.1]
 gi|77387144|gb|ABA78329.1| hypothetical protein RSP_2177 [Rhodobacter sphaeroides 2.4.1]
          Length = 372

 Score = 67.2 bits (163), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 18/75 (24%), Positives = 27/75 (36%)

Query: 13  SQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELD 72
             + +   +                RI   L  VP+  D +I    + A  V   L+ L+
Sbjct: 296 PAARSPEPQPDPPRRPLYEISAVHSRILDRLGPVPVPEDQLIRDLSLPAGRVAQELVALE 355

Query: 73  LAGRLCHHPEGKVSL 87
           L GR+   P G VS 
Sbjct: 356 LEGRIQRDPGGLVSR 370


>gi|186474805|ref|YP_001856275.1| DNA protecting protein DprA [Burkholderia phymatum STM815]
 gi|184191264|gb|ACC69229.1| DNA protecting protein DprA [Burkholderia phymatum STM815]
          Length = 389

 Score = 67.2 bits (163), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 21/88 (23%), Positives = 38/88 (43%), Gaps = 1/88 (1%)

Query: 4   PQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVR-IKQSLNNVPIHIDDIIHHTGIEAP 62
           PQ E       S   H+ +I+          +  R +  +L + P  ++ +   T ++  
Sbjct: 300 PQTESVPRRCASPQTHSGDIDSRRENGPDLPDDARRLLDALGHSPTTLEILAERTDMDDT 359

Query: 63  VVYLVLLELDLAGRLCHHPEGKVSLTMH 90
           ++   LL L+LAG LC  P G+    +H
Sbjct: 360 LLQSTLLRLELAGELCALPGGRYVRAVH 387


>gi|327395470|dbj|BAK12892.1| protein Smf [Pantoea ananatis AJ13355]
          Length = 374

 Score = 67.2 bits (163), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 17/87 (19%), Positives = 30/87 (34%), Gaps = 2/87 (2%)

Query: 3   HPQIEQNFFSSQSDTNHTKNINITHYPEYTQCER--VRIKQSLNNVPIHIDDIIHHTGIE 60
           HP        +  +       +  +             +  ++ +    +D +    G  
Sbjct: 275 HPNNIIEDLRAMLNWLPVTQSDEIYSDASDDAPLPFAELLANVGDEVTPVDVVAERAGQP 334

Query: 61  APVVYLVLLELDLAGRLCHHPEGKVSL 87
            PV+   LLEL+LAG +   P G V L
Sbjct: 335 VPVITAQLLELELAGWIAAVPGGYVRL 361


>gi|253997895|ref|YP_003049958.1| DNA protecting protein DprA [Methylovorus sp. SIP3-4]
 gi|253984574|gb|ACT49431.1| DNA protecting protein DprA [Methylovorus sp. SIP3-4]
          Length = 371

 Score = 67.2 bits (163), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 17/81 (20%), Positives = 33/81 (40%), Gaps = 2/81 (2%)

Query: 7   EQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYL 66
           E     SQ      ++    H PE  +    ++   +   PI ID +   +G+ +  +  
Sbjct: 291 EMAPLHSQQQQASQEDAFEGHDPE--ETPHTQLLACMGYDPISIDALQQSSGLTSDSLSA 348

Query: 67  VLLELDLAGRLCHHPEGKVSL 87
           +LL L+L  ++   P G+   
Sbjct: 349 MLLVLELENKVVALPGGRYQR 369


>gi|221214667|ref|ZP_03587637.1| DNA protecting protein DprA [Burkholderia multivorans CGD1]
 gi|221165557|gb|EED98033.1| DNA protecting protein DprA [Burkholderia multivorans CGD1]
          Length = 510

 Score = 67.2 bits (163), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 14/64 (21%), Positives = 26/64 (40%)

Query: 31  YTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMH 90
                   +  +L   P+  + +    G+    ++  LL L+LAGR+   P G+      
Sbjct: 437 PACPAEQAVLTALGYGPVTYEWLAERCGLPDDTLHRALLALELAGRVAPLPGGRYGRLDG 496

Query: 91  LPSP 94
            P+P
Sbjct: 497 PPNP 500


>gi|148658666|ref|YP_001278871.1| DNA protecting protein DprA [Roseiflexus sp. RS-1]
 gi|148570776|gb|ABQ92921.1| DNA protecting protein DprA [Roseiflexus sp. RS-1]
          Length = 360

 Score = 66.8 bits (162), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 13/78 (16%), Positives = 22/78 (28%)

Query: 11  FSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLE 70
                D +   +                +   +   P+HIDD+   T +    V   L  
Sbjct: 282 ILEALDMSTAASQQEVRAALPDDPVEAAVLALVGYEPLHIDDLQRRTSMPVHEVSATLTV 341

Query: 71  LDLAGRLCHHPEGKVSLT 88
           L+L G +         L 
Sbjct: 342 LELKGFVRQCAPMCYVLA 359


>gi|329114375|ref|ZP_08243137.1| Protein Smf [Acetobacter pomorum DM001]
 gi|326696451|gb|EGE48130.1| Protein Smf [Acetobacter pomorum DM001]
          Length = 412

 Score = 66.8 bits (162), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 24/85 (28%), Positives = 37/85 (43%), Gaps = 3/85 (3%)

Query: 7   EQNFFSSQSDTNHTKNI---NITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPV 63
           E  FF+S  + +  + I        P   Q  R  +   L+  PI +DD+I      A  
Sbjct: 320 EPAFFTSPQNVDEKEPIALKPHFSAPSTAQDVRENLLSLLSFTPIAVDDLIRRCQFSASA 379

Query: 64  VYLVLLELDLAGRLCHHPEGKVSLT 88
           V + L EL+L+G +  +  G V L 
Sbjct: 380 VLVALTELELSGCVSTYSGGMVGLA 404


>gi|332557608|ref|ZP_08411930.1| hypothetical protein RSWS8N_01115 [Rhodobacter sphaeroides WS8N]
 gi|332275320|gb|EGJ20635.1| hypothetical protein RSWS8N_01115 [Rhodobacter sphaeroides WS8N]
          Length = 372

 Score = 66.8 bits (162), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 18/75 (24%), Positives = 27/75 (36%)

Query: 13  SQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELD 72
             + +   +                RI   L  VP+  D +I    + A  V   L+ L+
Sbjct: 296 PAARSPEPQPDPPRRPLYEISAVHSRILDRLGPVPVPEDQLIRDLSLPAGRVAQELVALE 355

Query: 73  LAGRLCHHPEGKVSL 87
           L GR+   P G VS 
Sbjct: 356 LEGRIQRDPGGLVSR 370


>gi|261823199|ref|YP_003261305.1| DNA protecting protein DprA [Pectobacterium wasabiae WPP163]
 gi|261607212|gb|ACX89698.1| DNA protecting protein DprA [Pectobacterium wasabiae WPP163]
          Length = 373

 Score = 66.8 bits (162), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 18/80 (22%), Positives = 30/80 (37%)

Query: 8   QNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLV 67
           +   S            I++  E  +     +  ++ +    +D +    G   P V   
Sbjct: 281 EQLVSELQWLPMESGQTISNEEENGELPFADVLANVGDEVTPVDVVAERAGQPVPEVVTK 340

Query: 68  LLELDLAGRLCHHPEGKVSL 87
           LLEL+LAG +   P G V L
Sbjct: 341 LLELELAGWIAAVPGGYVRL 360


>gi|126461618|ref|YP_001042732.1| DNA protecting protein DprA [Rhodobacter sphaeroides ATCC 17029]
 gi|126103282|gb|ABN75960.1| DNA protecting protein DprA [Rhodobacter sphaeroides ATCC 17029]
          Length = 372

 Score = 66.8 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 18/75 (24%), Positives = 27/75 (36%)

Query: 13  SQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELD 72
             + +   +                RI   L  VP+  D +I    + A  V   L+ L+
Sbjct: 296 PAARSPEPQPDPPRRPLYEISAVHSRILDRLGPVPVPEDQLIRDLSLPAGRVAQELVALE 355

Query: 73  LAGRLCHHPEGKVSL 87
           L GR+   P G VS 
Sbjct: 356 LEGRIQRDPGGLVSR 370


>gi|217979954|ref|YP_002364101.1| DNA protecting protein DprA [Methylocella silvestris BL2]
 gi|217505330|gb|ACK52739.1| DNA protecting protein DprA [Methylocella silvestris BL2]
          Length = 422

 Score = 66.8 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 17/71 (23%), Positives = 28/71 (39%), Gaps = 1/71 (1%)

Query: 17  TNHTKNINITHYPEYT-QCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAG 75
                       P  + +    R+   L   P+ +D+++  +   A  V  +L EL+L G
Sbjct: 350 PPPADEPPREDAPAPSREAAFARVIALLGPSPVSVDELVRASEAPAREVRAILFELELQG 409

Query: 76  RLCHHPEGKVS 86
           RL  H    VS
Sbjct: 410 RLERHGADLVS 420


>gi|222054654|ref|YP_002537016.1| DNA protecting protein DprA [Geobacter sp. FRC-32]
 gi|221563943|gb|ACM19915.1| DNA protecting protein DprA [Geobacter sp. FRC-32]
          Length = 359

 Score = 66.8 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 27/58 (46%)

Query: 31  YTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
               +   I   L   P+HIDDII  + +  P +  +LL L+L G +   P    S+T
Sbjct: 301 SLTPQEAGIFTLLAESPLHIDDIIVRSELTVPDLSAILLRLELKGAVVQLPGKHFSIT 358


>gi|206558866|ref|YP_002229626.1| SMF family protein [Burkholderia cenocepacia J2315]
 gi|198034903|emb|CAR50775.1| SMF family protein [Burkholderia cenocepacia J2315]
          Length = 437

 Score = 66.8 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 17/84 (20%), Positives = 33/84 (39%)

Query: 11  FSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLE 70
            +  + T  T                  +  +L   P+  + +  H+G+   V++  LL 
Sbjct: 344 IAQANRTAATTAPASIEAAPPGNPSERAVLAALGYGPVTYEWLAEHSGLSDDVLHGALLA 403

Query: 71  LDLAGRLCHHPEGKVSLTMHLPSP 94
           L+LAGR+     G+ +     P+P
Sbjct: 404 LELAGRVASVAGGRFARLDAAPTP 427


>gi|254415891|ref|ZP_05029648.1| DNA protecting protein DprA, putative [Microcoleus chthonoplastes
           PCC 7420]
 gi|196177318|gb|EDX72325.1| DNA protecting protein DprA, putative [Microcoleus chthonoplastes
           PCC 7420]
          Length = 374

 Score = 66.8 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 16/67 (23%), Positives = 24/67 (35%)

Query: 22  NINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHP 81
                        E  ++ Q L   P  +D I+  TG+    V  VLL+L+L G +   P
Sbjct: 308 EPEPVKATPKLAPELAKVFQVLGIEPTPLDVIVQETGMTVAEVSGVLLQLELEGLVSQLP 367

Query: 82  EGKVSLT 88
                  
Sbjct: 368 GMLYRRN 374


>gi|153869947|ref|ZP_01999450.1| DNA processing chain A [Beggiatoa sp. PS]
 gi|152073589|gb|EDN70552.1| DNA processing chain A [Beggiatoa sp. PS]
          Length = 420

 Score = 66.8 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 15/76 (19%), Positives = 30/76 (39%)

Query: 13  SQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELD 72
                     I   +     + + +R+   L   P  ID+++  +G+ A  +  +LL L+
Sbjct: 341 PNEKMAPGNLIKTKNDLSDLEPDYIRLLGYLEAGPTSIDNLVEQSGLTAGDISSMLLILE 400

Query: 73  LAGRLCHHPEGKVSLT 88
           L G +     G  + T
Sbjct: 401 LRGLVATQSGGLYTRT 416


>gi|241760431|ref|ZP_04758525.1| DNA protecting protein DprA [Neisseria flavescens SK114]
 gi|241319100|gb|EER55593.1| DNA protecting protein DprA [Neisseria flavescens SK114]
          Length = 396

 Score = 66.4 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 19/86 (22%), Positives = 30/86 (34%), Gaps = 2/86 (2%)

Query: 2   VHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEA 61
           V P+ +Q                  + P         + +++   PIH D +   T   A
Sbjct: 310 VKPKNDQTKRLQPKTIVDEPQRPSENLPAAPLT--SALLEAMGYDPIHPDILAQQTNTAA 367

Query: 62  PVVYLVLLELDLAGRLCHHPEGKVSL 87
             VY  LLE +L G +   P G+   
Sbjct: 368 ADVYAQLLEYELDGIVAALPGGRYQR 393


>gi|89092293|ref|ZP_01165247.1| SMF protein [Oceanospirillum sp. MED92]
 gi|89083381|gb|EAR62599.1| SMF protein [Oceanospirillum sp. MED92]
          Length = 373

 Score = 66.4 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 15/72 (20%), Positives = 27/72 (37%), Gaps = 1/72 (1%)

Query: 16  DTNHTKNINITHYPE-YTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLA 74
                K+ +    PE     E   + Q +      +D I   +G+    +  +L+EL+L 
Sbjct: 301 AIAPAKDEDSASEPEYQVDSELGSLLQCMGFEICSVDQISQRSGLSVAKLSSMLVELELK 360

Query: 75  GRLCHHPEGKVS 86
           G +     G V 
Sbjct: 361 GMISQTSSGYVR 372


>gi|227115517|ref|ZP_03829173.1| hypothetical protein PcarbP_21290 [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
          Length = 364

 Score = 66.4 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 17/80 (21%), Positives = 30/80 (37%)

Query: 8   QNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLV 67
           +   S            I++  E  +     +  ++ +    +D +    G   P +   
Sbjct: 272 EQLVSELQWLPMESGQTISNEEEDGELPFADVLANVGDEVTPVDVVAERAGQPVPEIVTK 331

Query: 68  LLELDLAGRLCHHPEGKVSL 87
           LLEL+LAG +   P G V L
Sbjct: 332 LLELELAGWIAAVPGGYVRL 351


>gi|319796459|ref|YP_004158099.1| DNA protecting protein dpra [Variovorax paradoxus EPS]
 gi|315598922|gb|ADU39988.1| DNA protecting protein DprA [Variovorax paradoxus EPS]
          Length = 383

 Score = 66.4 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 15/81 (18%), Positives = 29/81 (35%)

Query: 8   QNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLV 67
           +     ++    +   +  H           +  +L   P+ +D +   TG  A  +   
Sbjct: 300 EELPPLRTGNAASAQSSNGHAGNEAAVSEDPLLDALGFEPVSLDALSARTGWSAAALQAR 359

Query: 68  LLELDLAGRLCHHPEGKVSLT 88
           +LEL+L G +   P G    T
Sbjct: 360 MLELELDGHISRLPGGLFQRT 380


>gi|220931596|ref|YP_002508504.1| DNA protecting protein DprA [Halothermothrix orenii H 168]
 gi|219992906|gb|ACL69509.1| DNA protecting protein DprA [Halothermothrix orenii H 168]
          Length = 409

 Score = 66.4 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 21/82 (25%), Positives = 32/82 (39%)

Query: 4   PQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPV 63
           P  E+    S +  N      +T        E  ++   L    +HI+ II  TG +A  
Sbjct: 316 PTAEKPLIKSYNRKNTGDKSTVTEDYSSLSPEEKKVVSILQGEDLHINQIITLTGFDASQ 375

Query: 64  VYLVLLELDLAGRLCHHPEGKV 85
           V  +LL L+L G +      K 
Sbjct: 376 VNKILLNLELKGLISPKQGKKY 397


>gi|312797603|ref|YP_004030525.1| DNA processing protein [Burkholderia rhizoxinica HKI 454]
 gi|312169378|emb|CBW76381.1| DNA processing protein [Burkholderia rhizoxinica HKI 454]
          Length = 629

 Score = 66.4 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 15/77 (19%), Positives = 33/77 (42%)

Query: 12  SSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLEL 71
           S++    +      T         R    +++ + P+ ++ ++  T ++   +  VLLEL
Sbjct: 553 SARRRPAYLAAARSTQANHAADAARRATLEAIGHDPVTLETLVQRTHLDCATLQAVLLEL 612

Query: 72  DLAGRLCHHPEGKVSLT 88
           +LAG +   P G+    
Sbjct: 613 ELAGTIVALPGGRFQRA 629


>gi|302877265|ref|YP_003845829.1| DNA protecting protein DprA [Gallionella capsiferriformans ES-2]
 gi|302580054|gb|ADL54065.1| DNA protecting protein DprA [Gallionella capsiferriformans ES-2]
          Length = 360

 Score = 66.4 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 13/79 (16%), Positives = 26/79 (32%), Gaps = 6/79 (7%)

Query: 9   NFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVL 68
              +        +    T  P         + + +   P+ ID +   +G+    +  +L
Sbjct: 286 EELTGLLTPPPVQAAKPTPAP------HAVLLEQMGFDPVGIDALCLRSGLTVSQLSAML 339

Query: 69  LELDLAGRLCHHPEGKVSL 87
           L L+L G +   P G    
Sbjct: 340 LTLELEGCIATLPGGLFQR 358


>gi|134093406|ref|YP_001098481.1| putative nucleotide-binding protein involved in DNA uptake (Smf
           protein) [Herminiimonas arsenicoxydans]
 gi|133737309|emb|CAL60352.1| putative DNA protecting protein DprA [Herminiimonas arsenicoxydans]
          Length = 372

 Score = 66.4 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 13/83 (15%), Positives = 27/83 (32%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVV 64
           +  Q+            N            +  +I Q+L   P+  D +     ++   +
Sbjct: 288 ETAQDILEELQYALPAANAASKSVAPALDAQAQQILQALGFDPVDADTLAARCQLDMATL 347

Query: 65  YLVLLELDLAGRLCHHPEGKVSL 87
           +  LL L+L+ +L   P      
Sbjct: 348 HAQLLMLELSNQLEILPGALYRR 370


>gi|170734477|ref|YP_001766424.1| DNA protecting protein DprA [Burkholderia cenocepacia MC0-3]
 gi|169817719|gb|ACA92302.1| DNA protecting protein DprA [Burkholderia cenocepacia MC0-3]
          Length = 422

 Score = 66.4 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 16/84 (19%), Positives = 31/84 (36%)

Query: 11  FSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLE 70
            +       T                  +  +L   P+  + +  H+G+   V++  LL 
Sbjct: 329 IAQAGGPAATTAPASIEAAPPGTPSEQAVLAALGYGPVTYEWLAEHSGLSDDVLHGALLA 388

Query: 71  LDLAGRLCHHPEGKVSLTMHLPSP 94
           L+LAGR+     G+ +     P+P
Sbjct: 389 LELAGRVASVAGGRFARLDAAPTP 412


>gi|163745856|ref|ZP_02153215.1| DNA processing protein DprA, putative [Oceanibulbus indolifex
           HEL-45]
 gi|161380601|gb|EDQ05011.1| DNA processing protein DprA, putative [Oceanibulbus indolifex
           HEL-45]
          Length = 349

 Score = 66.4 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 17/77 (22%), Positives = 29/77 (37%)

Query: 12  SSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLEL 71
           S  +    ++                RI   L   PI  D +I    + +  V   LL+L
Sbjct: 272 SGPTSAPPSRATQPRENTGSIAKLHARILSRLGPAPIAEDQLIRDLQVPSTAVAPALLDL 331

Query: 72  DLAGRLCHHPEGKVSLT 88
           ++ G++   P G +S T
Sbjct: 332 EMDGQIERQPGGLLSRT 348


>gi|121611000|ref|YP_998807.1| DNA protecting protein DprA [Verminephrobacter eiseniae EF01-2]
 gi|121555640|gb|ABM59789.1| DNA protecting protein DprA [Verminephrobacter eiseniae EF01-2]
          Length = 399

 Score = 66.4 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 18/68 (26%), Positives = 27/68 (39%)

Query: 20  TKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCH 79
           T        P         +  +L   PI ID ++  TG+    + + LLEL+LAG +  
Sbjct: 328 TPPTAGADAPAAGSAMDTPLLAALGFDPIGIDALLARTGMATAALQVALLELELAGSVAR 387

Query: 80  HPEGKVSL 87
            P G    
Sbjct: 388 LPGGLFQR 395


>gi|154253273|ref|YP_001414097.1| DNA protecting protein DprA [Parvibaculum lavamentivorans DS-1]
 gi|154157223|gb|ABS64440.1| DNA protecting protein DprA [Parvibaculum lavamentivorans DS-1]
          Length = 372

 Score = 66.4 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 24/87 (27%), Positives = 34/87 (39%)

Query: 1   MVHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIE 60
           ++    E            +               R RI  +L   P  +D+I+      
Sbjct: 281 VIAALAEPLGRRFGEPDPPSYAPRDASAIAADSDARTRILSALGPTPTPLDEIVRQASAS 340

Query: 61  APVVYLVLLELDLAGRLCHHPEGKVSL 87
            P+V  VLLEL+LAGRL   P  +VSL
Sbjct: 341 VPLVRAVLLELELAGRLHRDPGDRVSL 367


>gi|17228820|ref|NP_485368.1| DNA processing protein [Nostoc sp. PCC 7120]
 gi|17130672|dbj|BAB73282.1| DNA processing protein [Nostoc sp. PCC 7120]
          Length = 372

 Score = 66.0 bits (160), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 15/65 (23%), Positives = 27/65 (41%)

Query: 21  KNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHH 80
            ++           E  R+  +++   +  D II  TG+ A  V   LL+L+L G +   
Sbjct: 305 SSVPEQLSLPTLSPELQRVLDTISFDALPFDLIIQQTGMNAGSVSSALLQLELMGIVSQL 364

Query: 81  PEGKV 85
           P  + 
Sbjct: 365 PGMRY 369


>gi|325983535|ref|YP_004295937.1| DNA protecting protein DprA [Nitrosomonas sp. AL212]
 gi|325533054|gb|ADZ27775.1| DNA protecting protein DprA [Nitrosomonas sp. AL212]
          Length = 365

 Score = 66.0 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 16/68 (23%), Positives = 27/68 (39%)

Query: 20  TKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCH 79
           T +            E   +   L    ++ID +   +G+ A VV  +LL L+L G++  
Sbjct: 296 TPSDRKKESSPGQSTENSLLLSHLGYDTVNIDTLCARSGLTAEVVSAMLLTLELDGQISS 355

Query: 80  HPEGKVSL 87
            P G    
Sbjct: 356 LPGGWYQR 363


>gi|171319439|ref|ZP_02908544.1| DNA protecting protein DprA [Burkholderia ambifaria MEX-5]
 gi|171095331|gb|EDT40312.1| DNA protecting protein DprA [Burkholderia ambifaria MEX-5]
          Length = 425

 Score = 66.0 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 15/76 (19%), Positives = 30/76 (39%)

Query: 19  HTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLC 78
                   +           +  +L   P+  + +  H+G+   V++  LL L+LAGR+ 
Sbjct: 340 PASASAEINDTPSDTPADRSVLAALGYGPVTYEWLAEHSGLSDDVLHRALLALELAGRVA 399

Query: 79  HHPEGKVSLTMHLPSP 94
               G+ +     P+P
Sbjct: 400 SVAGGRFARLDAAPTP 415


>gi|332996762|gb|EGK16387.1| DNA protecting protein DprA [Shigella flexneri K-272]
 gi|333014513|gb|EGK33861.1| DNA protecting protein DprA [Shigella flexneri K-227]
          Length = 374

 Score = 66.0 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 18/71 (25%), Positives = 28/71 (39%), Gaps = 2/71 (2%)

Query: 19  HTKNINITHYPEYTQCERV--RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGR 76
                N  + P+          +  ++ +    +D +    G  AP V   LLEL+LAG 
Sbjct: 291 PDAPENSFYSPDQQDVALPFPELLANVGDEVTPVDVVAERAGQPAPEVVTQLLELELAGW 350

Query: 77  LCHHPEGKVSL 87
           +   P G V L
Sbjct: 351 IAAVPGGYVRL 361


>gi|325498854|gb|EGC96713.1| DNA protecting protein DprA [Escherichia fergusonii ECD227]
          Length = 374

 Score = 66.0 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 16/78 (20%), Positives = 30/78 (38%), Gaps = 6/78 (7%)

Query: 10  FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLL 69
              +  ++ ++ +      P         +  ++ +    +D +    G   P V   LL
Sbjct: 290 LPDAPENSFYSPDQEDVALPFP------ELLANVGDEVTPVDVVAERAGQPVPEVVTQLL 343

Query: 70  ELDLAGRLCHHPEGKVSL 87
           EL+LAG +   P G V L
Sbjct: 344 ELELAGWIAAVPGGYVRL 361


>gi|91790470|ref|YP_551422.1| DNA processing protein DprA [Polaromonas sp. JS666]
 gi|91699695|gb|ABE46524.1| DNA protecting protein DprA [Polaromonas sp. JS666]
          Length = 374

 Score = 66.0 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 13/83 (15%), Positives = 31/83 (37%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVV 64
           ++ Q+     +        +     +        +  +L    + +D +   TG++   +
Sbjct: 288 EVAQDILEELNLPLPGAATSRHTSGQTVDDAEDPLMTALGFDAVSLDALQARTGLDTARL 347

Query: 65  YLVLLELDLAGRLCHHPEGKVSL 87
              LLEL+L+G++   P G    
Sbjct: 348 QADLLELELSGQVTRLPGGLFQR 370


>gi|78222110|ref|YP_383857.1| SMF protein [Geobacter metallireducens GS-15]
 gi|78193365|gb|ABB31132.1| DNA protecting protein DprA [Geobacter metallireducens GS-15]
          Length = 358

 Score = 66.0 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 13/48 (27%), Positives = 22/48 (45%)

Query: 39  IKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
           +   L   P+HID+II  + +    +  +LL L+L G +   P     
Sbjct: 309 VFALLAPEPLHIDEIIAKSALTVGELSAMLLRLELKGAVTQLPGKYFC 356


>gi|225181360|ref|ZP_03734804.1| DNA protecting protein DprA [Dethiobacter alkaliphilus AHT 1]
 gi|225167941|gb|EEG76748.1| DNA protecting protein DprA [Dethiobacter alkaliphilus AHT 1]
          Length = 357

 Score = 66.0 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 16/66 (24%), Positives = 27/66 (40%)

Query: 20  TKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCH 79
           ++              +  + ++L   P H D+I    G+ AP +   L+EL+LAG L  
Sbjct: 289 SEQETAATKAVQLSDTQASVLETLQYEPAHFDEIADRCGLPAPQLAATLVELELAGLLRK 348

Query: 80  HPEGKV 85
            P    
Sbjct: 349 LPGNFF 354


>gi|15803813|ref|NP_289847.1| DNA protecting protein DprA [Escherichia coli O157:H7 EDL933]
 gi|12517912|gb|AAG58407.1|AE005555_7 hypothetical protein Z4656 [Escherichia coli O157:H7 str. EDL933]
          Length = 374

 Score = 65.6 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 16/78 (20%), Positives = 30/78 (38%), Gaps = 6/78 (7%)

Query: 10  FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLL 69
              +  ++ ++ +      P         +  ++ +    +D +    G   P V   LL
Sbjct: 290 LPBAPENSFYSPDQEDVALPFP------ELLANVGDEVTPVDVVAERAGQPVPEVVTQLL 343

Query: 70  ELDLAGRLCHHPEGKVSL 87
           EL+LAG +   P G V L
Sbjct: 344 ELELAGWIAAVPGGYVRL 361


>gi|56477102|ref|YP_158691.1| SMF protein, Rossmann fold nucleotide-binding protein involved in
           DNA uptake [Aromatoleum aromaticum EbN1]
 gi|56313145|emb|CAI07790.1| SMF protein, Rossmann fold nucleotide-binding protein involved in
           DNA uptake [Aromatoleum aromaticum EbN1]
          Length = 390

 Score = 65.6 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 16/85 (18%), Positives = 31/85 (36%)

Query: 3   HPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAP 62
            P        ++              P     E +R+  +L +  + ID +   +G+   
Sbjct: 305 APGRPARPARTRETRPADPPFEPRTPPPAASAEEIRVLDTLGHEALDIDTLTARSGLTLD 364

Query: 63  VVYLVLLELDLAGRLCHHPEGKVSL 87
            +Y +LL L+L G +   P G+   
Sbjct: 365 ALYAILLALELEGHVTRLPGGRFQR 389


>gi|67458923|ref|YP_246547.1| putative DNA processing protein DprA [Rickettsia felis URRWXCal2]
 gi|67004456|gb|AAY61382.1| Putatie DNA processing protein DprA [Rickettsia felis URRWXCal2]
          Length = 382

 Score = 65.6 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 24/65 (36%), Positives = 39/65 (60%)

Query: 23  INITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPE 82
           +N  +  E +Q ER  I + L++VPI  + +   T +  P++Y V+LEL+LAG+   H  
Sbjct: 315 VNTRYVKEPSQKERTAILELLSSVPIDFEFLQKETELSLPIIYTVILELELAGKAIRHAG 374

Query: 83  GKVSL 87
            K+SL
Sbjct: 375 NKISL 379


>gi|83748635|ref|ZP_00945653.1| Smf protein [Ralstonia solanacearum UW551]
 gi|207741947|ref|YP_002258339.1| smf protein (predicted rossmann fold nucleotide-binding protein
           involved in dna uptake) [Ralstonia solanacearum IPO1609]
 gi|83724679|gb|EAP71839.1| Smf protein [Ralstonia solanacearum UW551]
 gi|206593333|emb|CAQ60260.1| smf protein (predicted rossmann fold nucleotide-binding protein
           involved in dna uptake) [Ralstonia solanacearum IPO1609]
          Length = 403

 Score = 65.6 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 15/51 (29%), Positives = 24/51 (47%)

Query: 35  ERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
           E   +  +L   P+ +D +   TG  A  +   LL L+L GR+   P G+ 
Sbjct: 349 EETALLDALGFDPVDLDTLCQRTGQTAAPLSAQLLTLELEGRIERQPGGRF 399


>gi|218550561|ref|YP_002384352.1| DNA protecting protein DprA [Escherichia fergusonii ATCC 35469]
 gi|218358102|emb|CAQ90749.1| conserved hypothetical protein [Escherichia fergusonii ATCC 35469]
 gi|323966247|gb|EGB61682.1| DNA protecting protein DprA [Escherichia coli M863]
 gi|323974762|gb|EGB69875.1| DNA protecting protein DprA [Escherichia coli TW10509]
 gi|324111964|gb|EGC05943.1| DNA protecting protein DprA [Escherichia fergusonii B253]
 gi|327250934|gb|EGE62627.1| DNA protecting protein DprA [Escherichia coli STEC_7v]
          Length = 374

 Score = 65.6 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 16/78 (20%), Positives = 30/78 (38%), Gaps = 6/78 (7%)

Query: 10  FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLL 69
              +  ++ ++ +      P         +  ++ +    +D +    G   P V   LL
Sbjct: 290 LPDAPENSFYSPDQEDVALPFP------ELLANVGDEVTPVDVVAERAGQPVPEVVTQLL 343

Query: 70  ELDLAGRLCHHPEGKVSL 87
           EL+LAG +   P G V L
Sbjct: 344 ELELAGWIAAVPGGYVRL 361


>gi|157148860|ref|YP_001456179.1| DNA protecting protein DprA [Citrobacter koseri ATCC BAA-895]
 gi|157086065|gb|ABV15743.1| hypothetical protein CKO_04698 [Citrobacter koseri ATCC BAA-895]
          Length = 364

 Score = 65.6 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 16/78 (20%), Positives = 30/78 (38%), Gaps = 6/78 (7%)

Query: 10  FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLL 69
                 ++ ++ +  +   P         +  ++ +    +D +    G   P V   LL
Sbjct: 280 LPDEAENSLYSPDQEVAALPFPM------LLANVGDEVTPVDVVAERAGQPVPEVVAQLL 333

Query: 70  ELDLAGRLCHHPEGKVSL 87
           EL+LAG +   P G V L
Sbjct: 334 ELELAGWIAAVPGGYVRL 351


>gi|326625150|gb|EGE31495.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
          Length = 391

 Score = 65.6 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 17/78 (21%), Positives = 32/78 (41%), Gaps = 6/78 (7%)

Query: 10  FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLL 69
             ++  ++ ++ N +    P         +  ++ +    +D +    G   P V   LL
Sbjct: 307 LPTTAENSLYSLNQDEAALPFP------ELLANVGDEVTPVDVVAERAGQPVPAVVAQLL 360

Query: 70  ELDLAGRLCHHPEGKVSL 87
           EL+LAG +   P G V L
Sbjct: 361 ELELAGWIAAVPGGYVRL 378


>gi|313199960|ref|YP_004038618.1| DNA protecting protein dpra [Methylovorus sp. MP688]
 gi|312439276|gb|ADQ83382.1| DNA protecting protein DprA [Methylovorus sp. MP688]
          Length = 371

 Score = 65.6 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 17/81 (20%), Positives = 33/81 (40%), Gaps = 2/81 (2%)

Query: 7   EQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYL 66
           E     SQ      ++    H PE  +    ++   +   PI ID +   +G+ +  +  
Sbjct: 291 EMAPLHSQQQQASQEDAFAGHDPE--ETPHTQLLTCMGYDPISIDALQQSSGLTSDSLSA 348

Query: 67  VLLELDLAGRLCHHPEGKVSL 87
           +LL L+L  ++   P G+   
Sbjct: 349 MLLVLELENKVAALPGGRYQR 369


>gi|331674793|ref|ZP_08375550.1| protein smf [Escherichia coli TA280]
 gi|331067702|gb|EGI39100.1| protein smf [Escherichia coli TA280]
          Length = 374

 Score = 65.6 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 16/78 (20%), Positives = 30/78 (38%), Gaps = 6/78 (7%)

Query: 10  FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLL 69
              +  ++ ++ +      P         +  ++ +    +D +    G   P V   LL
Sbjct: 290 LPDAPENSFYSPDQEDVALPFP------ELLANVGDEVTPVDVVAERAGQPVPEVVTQLL 343

Query: 70  ELDLAGRLCHHPEGKVSL 87
           EL+LAG +   P G V L
Sbjct: 344 ELELAGWIAAVPGGYVRL 361


>gi|261380552|ref|ZP_05985125.1| DNA processing protein DprA [Neisseria subflava NJ9703]
 gi|284796520|gb|EFC51867.1| DNA processing protein DprA [Neisseria subflava NJ9703]
          Length = 396

 Score = 65.6 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 16/72 (22%), Positives = 25/72 (34%), Gaps = 4/72 (5%)

Query: 16  DTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAG 75
                +          T      + +++   PIH D +   T   A  VY  LLE +L G
Sbjct: 326 ADEPQRPSENLSAAPSTSA----LLEAMGYDPIHPDILAQQTNTAAADVYAQLLEYELDG 381

Query: 76  RLCHHPEGKVSL 87
            +   P G+   
Sbjct: 382 IVAALPGGRYQR 393


>gi|261368262|ref|ZP_05981145.1| DNA protecting protein DprA [Subdoligranulum variabile DSM 15176]
 gi|282569777|gb|EFB75312.1| DNA protecting protein DprA [Subdoligranulum variabile DSM 15176]
          Length = 366

 Score = 65.6 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 13/71 (18%), Positives = 20/71 (28%)

Query: 15  SDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLA 74
                 +       P     +   +   L      ID +   TG+ A  V     EL+L 
Sbjct: 293 LAAGAEEKEPAEFSPASVSADARAVYAKLGPTAQGIDALCAATGLPANRVLAACTELELF 352

Query: 75  GRLCHHPEGKV 85
           G     P  + 
Sbjct: 353 GGAQAQPGRRY 363


>gi|162145885|ref|YP_001600343.1| DNA processing chain A [Gluconacetobacter diazotrophicus PAl 5]
 gi|161784459|emb|CAP53989.1| putative DNA processing chain A [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 395

 Score = 65.6 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 20/98 (20%), Positives = 28/98 (28%), Gaps = 7/98 (7%)

Query: 3   HPQIEQNFFSSQSDTNHTKNINITHYPEYTQC-------ERVRIKQSLNNVPIHIDDIIH 55
            P+  Q                    P             R  I   L+  P  +DD++ 
Sbjct: 292 QPESRQPENGVAQTQAAWPEPPAFPAPTPLSEGPGGQAEIRDAILTLLSFTPTPVDDLVR 351

Query: 56  HTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHLPS 93
                   +  VL EL+LAG +   P G V L      
Sbjct: 352 RCQFSTSAILTVLSELELAGNIETLPGGSVVLPSQPDE 389


>gi|323131763|gb|ADX19193.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
          Length = 391

 Score = 65.6 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 17/78 (21%), Positives = 32/78 (41%), Gaps = 6/78 (7%)

Query: 10  FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLL 69
             ++  ++ ++ N +    P         +  ++ +    +D +    G   P V   LL
Sbjct: 307 LPTTAENSLYSLNQDEAALPFP------ELLANVGDEVTPVDVVAERAGQPVPAVVAQLL 360

Query: 70  ELDLAGRLCHHPEGKVSL 87
           EL+LAG +   P G V L
Sbjct: 361 ELELAGWIAAVPGGYVRL 378


>gi|125972980|ref|YP_001036890.1| DNA protecting protein DprA [Clostridium thermocellum ATCC 27405]
 gi|256004777|ref|ZP_05429752.1| DNA protecting protein DprA [Clostridium thermocellum DSM 2360]
 gi|281417191|ref|ZP_06248211.1| DNA protecting protein DprA [Clostridium thermocellum JW20]
 gi|125713205|gb|ABN51697.1| DNA protecting protein DprA [Clostridium thermocellum ATCC 27405]
 gi|255991227|gb|EEU01334.1| DNA protecting protein DprA [Clostridium thermocellum DSM 2360]
 gi|281408593|gb|EFB38851.1| DNA protecting protein DprA [Clostridium thermocellum JW20]
 gi|316940784|gb|ADU74818.1| DNA protecting protein DprA [Clostridium thermocellum DSM 1313]
          Length = 370

 Score = 65.6 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 14/58 (24%), Positives = 26/58 (44%)

Query: 32  TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTM 89
              +  ++ + L    +HID+I   TG    +V  +L+ L+L G +   P     L +
Sbjct: 313 LDNDEKKVVECLKLESMHIDNIARKTGFGIQLVNSILVMLELKGVVEQLPGKIFKLKL 370


>gi|207727556|ref|YP_002255950.1| smf protein (predicted rossmann fold nucleotide-binding protein
           involved in dna uptake) [Ralstonia solanacearum MolK2]
 gi|206590793|emb|CAQ56405.1| smf protein (predicted rossmann fold nucleotide-binding protein
           involved in dna uptake) [Ralstonia solanacearum MolK2]
          Length = 403

 Score = 65.6 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 15/51 (29%), Positives = 24/51 (47%)

Query: 35  ERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
           E   +  +L   P+ +D +   TG  A  +   LL L+L GR+   P G+ 
Sbjct: 349 EETALLDALGFDPVDLDTLCQRTGQTAAPLSAQLLTLELEGRIERQPGGRF 399


>gi|50122918|ref|YP_052085.1| DNA protecting protein DprA [Pectobacterium atrosepticum SCRI1043]
 gi|49613444|emb|CAG76895.1| conserved hypothetical protein [Pectobacterium atrosepticum
           SCRI1043]
          Length = 373

 Score = 65.6 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 17/80 (21%), Positives = 31/80 (38%)

Query: 8   QNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLV 67
           +   S            I++  E  +     +  ++ +    +D +    G   P + + 
Sbjct: 281 EQLVSELQWLPTESGQTISNEEEDGELPFADVLANVGDEVTPVDVVAERAGQPVPEIVIK 340

Query: 68  LLELDLAGRLCHHPEGKVSL 87
           LLEL+LAG +   P G V L
Sbjct: 341 LLELELAGWIAAVPGGYVRL 360


>gi|323154123|gb|EFZ40326.1| DNA protecting protein DprA [Escherichia coli EPECa14]
          Length = 374

 Score = 65.6 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 17/71 (23%), Positives = 26/71 (36%), Gaps = 2/71 (2%)

Query: 19  HTKNINITHYPEYTQCERV--RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGR 76
                N  + P+          +  ++      +D +    G   P V   LLEL+LAG 
Sbjct: 291 PDAPENSFYSPDQQDVALPFPELLANVGYEVTPVDVVAERAGQPVPEVVTQLLELELAGW 350

Query: 77  LCHHPEGKVSL 87
           +   P G V L
Sbjct: 351 IAAVPGGYVRL 361


>gi|82545648|ref|YP_409595.1| DNA protecting protein DprA [Shigella boydii Sb227]
 gi|81247059|gb|ABB67767.1| Predicted Rossmann-fold nucleotide-binding protein involved in DNA
           uptake [Shigella boydii Sb227]
 gi|320187007|gb|EFW61719.1| Rossmann fold nucleotide-binding protein Smf possibly involved in
           DNA uptake [Shigella flexneri CDC 796-83]
 gi|332090239|gb|EGI95337.1| DNA protecting protein DprA [Shigella boydii 3594-74]
          Length = 374

 Score = 65.6 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 17/71 (23%), Positives = 27/71 (38%), Gaps = 2/71 (2%)

Query: 19  HTKNINITHYPEYTQCERV--RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGR 76
                N  + P+          +  ++ +    +D +    G   P V   LLEL+LAG 
Sbjct: 291 PDAPENSFYSPDQQDVALPFPELLANVGDEVTPVDVVAERAGQPVPEVVTQLLELELAGW 350

Query: 77  LCHHPEGKVSL 87
           +   P G V L
Sbjct: 351 IAAVPGGYVRL 361


>gi|209543807|ref|YP_002276036.1| DNA protecting protein DprA [Gluconacetobacter diazotrophicus PAl
           5]
 gi|209531484|gb|ACI51421.1| DNA protecting protein DprA [Gluconacetobacter diazotrophicus PAl
           5]
          Length = 395

 Score = 65.6 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 20/98 (20%), Positives = 28/98 (28%), Gaps = 7/98 (7%)

Query: 3   HPQIEQNFFSSQSDTNHTKNINITHYPEYTQC-------ERVRIKQSLNNVPIHIDDIIH 55
            P+  Q                    P             R  I   L+  P  +DD++ 
Sbjct: 292 QPESRQPENGVAQTQAAWPEPPAFPAPTPLSEGPGGQAEIRDAILTLLSFTPTPVDDLVR 351

Query: 56  HTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHLPS 93
                   +  VL EL+LAG +   P G V L      
Sbjct: 352 RCQFSTSAILTVLSELELAGNIETLPGGSVVLPSQPDE 389


>gi|253690149|ref|YP_003019339.1| DNA protecting protein DprA [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|251756727|gb|ACT14803.1| DNA protecting protein DprA [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 373

 Score = 65.6 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 17/80 (21%), Positives = 30/80 (37%)

Query: 8   QNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLV 67
           +   S            I++  E  +     +  ++ +    +D +    G   P +   
Sbjct: 281 EQLVSELQWLPMESGQTISNEEEDGELPFADVLANVGDEVTPVDVVAERAGQPVPEIVTK 340

Query: 68  LLELDLAGRLCHHPEGKVSL 87
           LLEL+LAG +   P G V L
Sbjct: 341 LLELELAGWIAAVPGGYVRL 360


>gi|161616431|ref|YP_001590396.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Paratyphi B str. SPB7]
 gi|161365795|gb|ABX69563.1| hypothetical protein SPAB_04246 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
          Length = 374

 Score = 65.6 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 17/78 (21%), Positives = 32/78 (41%), Gaps = 6/78 (7%)

Query: 10  FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLL 69
             ++  ++ ++ N +    P         +  ++ +    +D +    G   P V   LL
Sbjct: 290 LPTTAENSLYSLNQDEAALPFP------ELLANVGDEVTPVDVVAERAGQPVPEVVAQLL 343

Query: 70  ELDLAGRLCHHPEGKVSL 87
           EL+LAG +   P G V L
Sbjct: 344 ELELAGWIAAVPGGYVRL 361


>gi|300022164|ref|YP_003754775.1| DNA protecting protein DprA [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299523985|gb|ADJ22454.1| DNA protecting protein DprA [Hyphomicrobium denitrificans ATCC
           51888]
          Length = 399

 Score = 65.6 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 21/76 (27%), Positives = 33/76 (43%)

Query: 12  SSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLEL 71
           + ++  +                +   +  +L+  PI +D I   TG+    V + LLEL
Sbjct: 321 TPRTSPHPISPTVAVRRKPDGLADISAVLAALSPAPIAVDAIARGTGLAIQSVQIALLEL 380

Query: 72  DLAGRLCHHPEGKVSL 87
           DLAGR+  H    VSL
Sbjct: 381 DLAGRIERHGLSLVSL 396


>gi|168468038|ref|ZP_02701875.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|195628896|gb|EDX48306.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
          Length = 374

 Score = 65.6 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 17/78 (21%), Positives = 32/78 (41%), Gaps = 6/78 (7%)

Query: 10  FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLL 69
             ++  ++ ++ N +    P         +  ++ +    +D +    G   P V   LL
Sbjct: 290 LPTTAENSLYSLNQDEAALPFP------ELLANVGDEVTPVDVVAERAGQPVPEVVAQLL 343

Query: 70  ELDLAGRLCHHPEGKVSL 87
           EL+LAG +   P G V L
Sbjct: 344 ELELAGWIAAVPGGYVRL 361


>gi|332998315|gb|EGK17915.1| DNA protecting protein DprA [Shigella flexneri K-218]
          Length = 374

 Score = 65.6 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 17/71 (23%), Positives = 27/71 (38%), Gaps = 2/71 (2%)

Query: 19  HTKNINITHYPEYTQCERV--RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGR 76
                N  + P+          +  ++ +    +D +    G   P V   LLEL+LAG 
Sbjct: 291 PDAPENSFYSPDQQDVALPFPELLANVGDEVTPVDVVAERAGQPVPEVVTQLLELELAGW 350

Query: 77  LCHHPEGKVSL 87
           +   P G V L
Sbjct: 351 IAAVPGGYVRL 361


>gi|332998299|gb|EGK17900.1| DNA protecting protein DprA [Shigella flexneri VA-6]
          Length = 374

 Score = 65.6 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 17/71 (23%), Positives = 27/71 (38%), Gaps = 2/71 (2%)

Query: 19  HTKNINITHYPEYTQCERV--RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGR 76
                N  + P+          +  ++ +    +D +    G   P V   LLEL+LAG 
Sbjct: 291 PDAPENSFYSPDQQDVALPFPELLANVGDEVTPVDVVAERAGQPVPEVVTQLLELELAGW 350

Query: 77  LCHHPEGKVSL 87
           +   P G V L
Sbjct: 351 IAAVPGGYVRL 361


>gi|30064607|ref|NP_838778.1| DNA protecting protein DprA [Shigella flexneri 2a str. 2457T]
 gi|56480309|ref|NP_709073.2| DNA protecting protein DprA [Shigella flexneri 2a str. 301]
 gi|110807133|ref|YP_690653.1| DNA protecting protein DprA [Shigella flexneri 5 str. 8401]
 gi|30042866|gb|AAP18589.1| hypothetical protein S3542 [Shigella flexneri 2a str. 2457T]
 gi|56383860|gb|AAN44780.2| orf, conserved hypothetical protein [Shigella flexneri 2a str. 301]
 gi|110616681|gb|ABF05348.1| hypothetical protein SFV_3305 [Shigella flexneri 5 str. 8401]
 gi|281602654|gb|ADA75638.1| putative Rossmann fold nucleotide-binding protein involved in DNA
           uptake [Shigella flexneri 2002017]
 gi|313648792|gb|EFS13232.1| DNA protecting protein DprA [Shigella flexneri 2a str. 2457T]
 gi|332749606|gb|EGJ80023.1| DNA protecting protein DprA [Shigella flexneri K-671]
 gi|332754008|gb|EGJ84381.1| DNA protecting protein DprA [Shigella flexneri 2747-71]
 gi|332766531|gb|EGJ96738.1| DNA protecting protein DprA [Shigella flexneri 2930-71]
 gi|333012292|gb|EGK31673.1| DNA protecting protein DprA [Shigella flexneri K-304]
          Length = 374

 Score = 65.6 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 17/71 (23%), Positives = 27/71 (38%), Gaps = 2/71 (2%)

Query: 19  HTKNINITHYPEYTQCERV--RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGR 76
                N  + P+          +  ++ +    +D +    G   P V   LLEL+LAG 
Sbjct: 291 PDAPENSFYSPDQQDVALPFPELLANVGDEVTPVDVVAERAGQPVPEVVTQLLELELAGW 350

Query: 77  LCHHPEGKVSL 87
           +   P G V L
Sbjct: 351 IAAVPGGYVRL 361


>gi|121602381|ref|YP_989130.1| DNA protecting protein DprA [Bartonella bacilliformis KC583]
 gi|120614558|gb|ABM45159.1| DNA protecting protein DprA [Bartonella bacilliformis KC583]
          Length = 396

 Score = 65.6 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 32/89 (35%), Positives = 47/89 (52%), Gaps = 1/89 (1%)

Query: 7   EQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYL 66
           E+++       NH+     T  P     ER  I  +L+  PI +D +  H+G+    +YL
Sbjct: 304 EESYPIQLQQENHSLPKPSTKAPFADDTERAAILSALSTTPIDLDTLSSHSGVPLQNLYL 363

Query: 67  VLLELDLAGRLCHHPEGKVSLTMHLPSPQ 95
           +L+ELDLAG+L  H  G VSL+   P PQ
Sbjct: 364 LLIELDLAGKLTRHSGGYVSLSTENP-PQ 391


>gi|163859049|ref|YP_001633347.1| hypothetical protein Bpet4728 [Bordetella petrii DSM 12804]
 gi|163262777|emb|CAP45080.1| conserved hypothetical protein [Bordetella petrii]
          Length = 371

 Score = 65.2 bits (158), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 17/83 (20%), Positives = 34/83 (40%), Gaps = 1/83 (1%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVV 64
           +  Q+            +          Q +   + ++L + P+H+D +   TG++   +
Sbjct: 288 ETAQDITDELGGGAPVASRETPSARAAAQPD-TPLLRALGHDPLHLDALQARTGLDVATL 346

Query: 65  YLVLLELDLAGRLCHHPEGKVSL 87
              LLEL+LAGR+     G+   
Sbjct: 347 NAQLLELELAGRVARLDGGRFQR 369


>gi|213855561|ref|ZP_03383801.1| hypothetical protein SentesT_16550 [Salmonella enterica subsp.
           enterica serovar Typhi str. M223]
          Length = 375

 Score = 65.2 bits (158), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 17/78 (21%), Positives = 32/78 (41%), Gaps = 6/78 (7%)

Query: 10  FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLL 69
             ++  ++ ++ N +    P         +  ++ +    +D +    G   P V   LL
Sbjct: 291 LPTTAENSLYSLNQDEAALPFP------ELLANVGDEVTPVDVVAERAGQPVPAVVAQLL 344

Query: 70  ELDLAGRLCHHPEGKVSL 87
           EL+LAG +   P G V L
Sbjct: 345 ELELAGWIAAVPGGYVRL 362


>gi|320655924|gb|EFX23844.1| hypothetical protein ECO7815_20646 [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
          Length = 374

 Score = 65.2 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 16/78 (20%), Positives = 30/78 (38%), Gaps = 6/78 (7%)

Query: 10  FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLL 69
              +  ++ ++ +      P         +  ++ +    +D +    G   P V   LL
Sbjct: 290 LPDAPENSFYSPDQEDVALPFP------ELLANVGDEVTPVDVVAERAGQPVPEVVTQLL 343

Query: 70  ELDLAGRLCHHPEGKVSL 87
           EL+LAG +   P G V L
Sbjct: 344 ELELAGWIAAVPGGYVRL 361


>gi|320182717|gb|EFW57603.1| Rossmann fold nucleotide-binding protein Smf possibly involved in
           DNA uptake [Shigella boydii ATCC 9905]
          Length = 374

 Score = 65.2 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 16/78 (20%), Positives = 30/78 (38%), Gaps = 6/78 (7%)

Query: 10  FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLL 69
              +  ++ ++ +      P         +  ++ +    +D +    G   P V   LL
Sbjct: 290 LPDAPENSFYSPDQEDVALPFP------ELLANVGDEVTPVDVVAERAGQPVPEVVTQLL 343

Query: 70  ELDLAGRLCHHPEGKVSL 87
           EL+LAG +   P G V L
Sbjct: 344 ELELAGWIAAVPGGYVRL 361


>gi|116691146|ref|YP_836769.1| DNA protecting protein DprA [Burkholderia cenocepacia HI2424]
 gi|116649235|gb|ABK09876.1| DNA protecting protein DprA [Burkholderia cenocepacia HI2424]
          Length = 475

 Score = 65.2 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 17/84 (20%), Positives = 33/84 (39%)

Query: 11  FSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLE 70
            +  + T  T                  +  +L   P+  + +  H+G+   V++  LL 
Sbjct: 382 IAQTNRTAATTAPASIEAAPPGTPSEQAVLTALGYGPVTYEWLAEHSGLSNDVLHGALLA 441

Query: 71  LDLAGRLCHHPEGKVSLTMHLPSP 94
           L+LAGR+     G+ +     P+P
Sbjct: 442 LELAGRVASVAGGRFARLDAAPTP 465


>gi|331654878|ref|ZP_08355877.1| protein smf [Escherichia coli M718]
 gi|331046893|gb|EGI18971.1| protein smf [Escherichia coli M718]
          Length = 374

 Score = 65.2 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 16/78 (20%), Positives = 30/78 (38%), Gaps = 6/78 (7%)

Query: 10  FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLL 69
              +  ++ ++ +      P         +  ++ +    +D +    G   P V   LL
Sbjct: 290 LPDAPENSFYSPDQEDVALPFP------ELLANVGDEVTPVDVVAERAGQPVPEVVTQLL 343

Query: 70  ELDLAGRLCHHPEGKVSL 87
           EL+LAG +   P G V L
Sbjct: 344 ELELAGWIAAVPGGYVRL 361


>gi|254880958|ref|ZP_05253668.1| conserved hypothetical protein [Bacteroides sp. 4_3_47FAA]
 gi|319639966|ref|ZP_07994693.1| DNA processing Smf-like protein [Bacteroides sp. 3_1_40A]
 gi|254833751|gb|EET14060.1| conserved hypothetical protein [Bacteroides sp. 4_3_47FAA]
 gi|317388244|gb|EFV69096.1| DNA processing Smf-like protein [Bacteroides sp. 3_1_40A]
          Length = 371

 Score = 65.2 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 15/89 (16%), Positives = 29/89 (32%), Gaps = 4/89 (4%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYP--EYTQCERVRIKQSLN--NVPIHIDDIIHHTGIE 60
              ++   +    +  K               E  RI + L      + I+ ++  T I 
Sbjct: 283 TSAEDLVKAMGWESSPKTEKTVQRELFPDLSEEEERIVKRLGKMPEGLQINTLVIDTNIP 342

Query: 61  APVVYLVLLELDLAGRLCHHPEGKVSLTM 89
              +  +L EL++ G +     G   L M
Sbjct: 343 VNRMSALLFELEMKGVIRALAGGVYRLIM 371


>gi|256025987|ref|ZP_05439852.1| DNA protecting protein DprA [Escherichia sp. 4_1_40B]
 gi|301643895|ref|ZP_07243925.1| DNA protecting protein DprA [Escherichia coli MS 146-1]
 gi|307139968|ref|ZP_07499324.1| DNA protecting protein DprA [Escherichia coli H736]
 gi|331643981|ref|ZP_08345110.1| protein smf [Escherichia coli H736]
 gi|301077738|gb|EFK92544.1| DNA protecting protein DprA [Escherichia coli MS 146-1]
 gi|315617088|gb|EFU97698.1| DNA protecting protein DprA [Escherichia coli 3431]
 gi|331036275|gb|EGI08501.1| protein smf [Escherichia coli H736]
          Length = 374

 Score = 65.2 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 17/71 (23%), Positives = 27/71 (38%), Gaps = 2/71 (2%)

Query: 19  HTKNINITHYPEYTQCERV--RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGR 76
                N  + P+          +  ++ +    +D +    G   P V   LLEL+LAG 
Sbjct: 291 PDAPENSFYSPDQQDVALPFPELLANVGDEVTPVDVVAERAGQPVPEVVTQLLELELAGW 350

Query: 77  LCHHPEGKVSL 87
           +   P G V L
Sbjct: 351 IAAVPGGYVRL 361


>gi|168234462|ref|ZP_02659520.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|194468594|ref|ZP_03074578.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194454958|gb|EDX43797.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|205331618|gb|EDZ18382.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
          Length = 374

 Score = 65.2 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 17/78 (21%), Positives = 32/78 (41%), Gaps = 6/78 (7%)

Query: 10  FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLL 69
             ++  ++ ++ N +    P         +  ++ +    +D +    G   P V   LL
Sbjct: 290 LPTTAENSLYSLNQDEAALPFP------ELLANVGDEVTPVDVVAERAGQPVPEVVAQLL 343

Query: 70  ELDLAGRLCHHPEGKVSL 87
           EL+LAG +   P G V L
Sbjct: 344 ELELAGWIAAVPGGYVRL 361


>gi|160896284|ref|YP_001561866.1| DNA protecting protein DprA [Delftia acidovorans SPH-1]
 gi|160361868|gb|ABX33481.1| DNA protecting protein DprA [Delftia acidovorans SPH-1]
          Length = 405

 Score = 65.2 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 16/75 (21%), Positives = 30/75 (40%)

Query: 13  SQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELD 72
             +                   E     ++L + P+ +D+++  TG++A  +   LLEL+
Sbjct: 327 PIAKPVPAAAAAAAAVQSAQDHENDATLRALAHDPLSLDELMDRTGMDAAALQAHLLELE 386

Query: 73  LAGRLCHHPEGKVSL 87
           L GR+   P G    
Sbjct: 387 LEGRVERLPGGLFQR 401


>gi|57234466|ref|YP_181459.1| DNA processing protein DprA, putative [Dehalococcoides ethenogenes
           195]
 gi|57224914|gb|AAW39971.1| DNA processing protein DprA, putative [Dehalococcoides ethenogenes
           195]
          Length = 406

 Score = 65.2 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 14/62 (22%), Positives = 22/62 (35%), Gaps = 1/62 (1%)

Query: 23  INITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPE 82
            + T            I   L   PIHID +    G+   +V   L  ++L G++     
Sbjct: 329 PDNTTKAVPENQTESLILDKLGYEPIHIDQLCRECGLGIALVSSTLAIMELRGQV-RSAG 387

Query: 83  GK 84
           G 
Sbjct: 388 GM 389


>gi|291284644|ref|YP_003501462.1| hypothetical protein G2583_4004 [Escherichia coli O55:H7 str.
           CB9615]
 gi|209757374|gb|ACI76999.1| hypothetical protein ECs4151 [Escherichia coli]
 gi|290764517|gb|ADD58478.1| hypothetical protein G2583_4004 [Escherichia coli O55:H7 str.
           CB9615]
 gi|320661376|gb|EFX28791.1| hypothetical protein ECO5905_01202 [Escherichia coli O55:H7 str.
           USDA 5905]
          Length = 374

 Score = 65.2 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 16/78 (20%), Positives = 30/78 (38%), Gaps = 6/78 (7%)

Query: 10  FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLL 69
              +  ++ ++ +      P         +  ++ +    +D +    G   P V   LL
Sbjct: 290 LPDAPENSFYSPDQEDVALPFP------ELLANVGDEVTPVDVVAERAGQPVPEVVTQLL 343

Query: 70  ELDLAGRLCHHPEGKVSL 87
           EL+LAG +   P G V L
Sbjct: 344 ELELAGWIAAVPGGYVRL 361


>gi|194435063|ref|ZP_03067301.1| DNA protecting protein DprA [Shigella dysenteriae 1012]
 gi|194416670|gb|EDX32801.1| DNA protecting protein DprA [Shigella dysenteriae 1012]
 gi|332086255|gb|EGI91411.1| DNA protecting protein DprA [Shigella dysenteriae 155-74]
          Length = 374

 Score = 65.2 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 16/78 (20%), Positives = 30/78 (38%), Gaps = 6/78 (7%)

Query: 10  FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLL 69
              +  ++ ++ +      P         +  ++ +    +D +    G   P V   LL
Sbjct: 290 LPDAPENSFYSPDQEDVALPFP------ELLANVGDEVTPVDVVAERAGQPVPEVVTQLL 343

Query: 70  ELDLAGRLCHHPEGKVSL 87
           EL+LAG +   P G V L
Sbjct: 344 ELELAGWIAAVPGGYVRL 361


>gi|218706893|ref|YP_002414412.1| DNA protecting protein DprA [Escherichia coli UMN026]
 gi|293406883|ref|ZP_06650807.1| hypothetical protein ECGG_03573 [Escherichia coli FVEC1412]
 gi|298382624|ref|ZP_06992219.1| DNA processing protein [Escherichia coli FVEC1302]
 gi|300896633|ref|ZP_07115150.1| DNA protecting protein DprA [Escherichia coli MS 198-1]
 gi|301018857|ref|ZP_07183096.1| DNA protecting protein DprA [Escherichia coli MS 69-1]
 gi|331664898|ref|ZP_08365799.1| protein smf [Escherichia coli TA143]
 gi|218433990|emb|CAR14907.1| conserved hypothetical protein [Escherichia coli UMN026]
 gi|291425694|gb|EFE98728.1| hypothetical protein ECGG_03573 [Escherichia coli FVEC1412]
 gi|298276460|gb|EFI17978.1| DNA processing protein [Escherichia coli FVEC1302]
 gi|300359510|gb|EFJ75380.1| DNA protecting protein DprA [Escherichia coli MS 198-1]
 gi|300399514|gb|EFJ83052.1| DNA protecting protein DprA [Escherichia coli MS 69-1]
 gi|331057408|gb|EGI29394.1| protein smf [Escherichia coli TA143]
          Length = 374

 Score = 65.2 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 16/78 (20%), Positives = 30/78 (38%), Gaps = 6/78 (7%)

Query: 10  FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLL 69
              +  ++ ++ +      P         +  ++ +    +D +    G   P V   LL
Sbjct: 290 LPDAPENSFYSPDQEDVALPFP------ELLANVGDEVTPVDVVAERAGQPVPEVVTQLL 343

Query: 70  ELDLAGRLCHHPEGKVSL 87
           EL+LAG +   P G V L
Sbjct: 344 ELELAGWIAAVPGGYVRL 361


>gi|187922315|ref|YP_001893957.1| DNA protecting protein DprA [Burkholderia phytofirmans PsJN]
 gi|187713509|gb|ACD14733.1| DNA protecting protein DprA [Burkholderia phytofirmans PsJN]
          Length = 422

 Score = 65.2 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 15/79 (18%), Positives = 30/79 (37%)

Query: 12  SSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLEL 71
            +    +    +           E  R+  +L + P  ++ +   T +E   +   LL+L
Sbjct: 343 EASPAVSAEAPLAAATPCPPANPEAQRLLAALGHSPTTLEILATRTEMEDADLQTALLQL 402

Query: 72  DLAGRLCHHPEGKVSLTMH 90
           +LAG +   P G+     H
Sbjct: 403 ELAGHVTMLPGGRFMRASH 421


>gi|283835703|ref|ZP_06355444.1| hypothetical protein CIT292_10095 [Citrobacter youngae ATCC 29220]
 gi|291068382|gb|EFE06491.1| DNA protecting protein DprA [Citrobacter youngae ATCC 29220]
          Length = 374

 Score = 65.2 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 16/78 (20%), Positives = 28/78 (35%), Gaps = 6/78 (7%)

Query: 10  FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLL 69
                  + ++ +      P         +  ++ +    +D +    G   P V   LL
Sbjct: 290 LPDEPEKSIYSPDHEEVALPFP------ELLANVGDEVTPVDVVAERAGQPVPEVVAQLL 343

Query: 70  ELDLAGRLCHHPEGKVSL 87
           EL+LAG +   P G V L
Sbjct: 344 ELELAGWIAAVPGGYVRL 361


>gi|188492261|ref|ZP_02999531.1| DNA protecting protein DprA [Escherichia coli 53638]
 gi|188487460|gb|EDU62563.1| DNA protecting protein DprA [Escherichia coli 53638]
          Length = 374

 Score = 65.2 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 16/78 (20%), Positives = 30/78 (38%), Gaps = 6/78 (7%)

Query: 10  FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLL 69
              +  ++ ++ +      P         +  ++ +    +D +    G   P V   LL
Sbjct: 290 LPDAPENSFYSPDQEDVALPFP------ELLANVGDEVTPVDVVAERAGQPVPEVVTQLL 343

Query: 70  ELDLAGRLCHHPEGKVSL 87
           EL+LAG +   P G V L
Sbjct: 344 ELELAGWIAAVPGGYVRL 361


>gi|326403290|ref|YP_004283371.1| putative DNA processing protein [Acidiphilium multivorum AIU301]
 gi|325050151|dbj|BAJ80489.1| putative DNA processing protein [Acidiphilium multivorum AIU301]
          Length = 373

 Score = 65.2 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 18/89 (20%), Positives = 30/89 (33%), Gaps = 3/89 (3%)

Query: 2   VHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEA 61
           + P                         +     R  I + L+  P+ +D++  H     
Sbjct: 287 LFPDARIAAPPPGLGEPPDAAPETG---DELDRARSEIPRLLSASPVSVDELARHCQFST 343

Query: 62  PVVYLVLLELDLAGRLCHHPEGKVSLTMH 90
             +  VL EL+LAGR+   P  +V L   
Sbjct: 344 SALTAVLTELELAGRIETLPGNRVCLLSE 372


>gi|148259743|ref|YP_001233870.1| DNA protecting protein DprA [Acidiphilium cryptum JF-5]
 gi|146401424|gb|ABQ29951.1| DNA protecting protein DprA [Acidiphilium cryptum JF-5]
          Length = 373

 Score = 65.2 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 18/89 (20%), Positives = 30/89 (33%), Gaps = 3/89 (3%)

Query: 2   VHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEA 61
           + P                         +     R  I + L+  P+ +D++  H     
Sbjct: 287 LFPDARIAAPPPGLGEPPDAAPETG---DELDRARSEIPRLLSASPVSVDELARHCQFST 343

Query: 62  PVVYLVLLELDLAGRLCHHPEGKVSLTMH 90
             +  VL EL+LAGR+   P  +V L   
Sbjct: 344 SALTAVLTELELAGRIETLPGNRVCLLSE 372


>gi|126725956|ref|ZP_01741798.1| DNA processing protein DprA, putative [Rhodobacterales bacterium
           HTCC2150]
 gi|126705160|gb|EBA04251.1| DNA processing protein DprA, putative [Rhodobacterales bacterium
           HTCC2150]
          Length = 390

 Score = 65.2 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 20/87 (22%), Positives = 32/87 (36%), Gaps = 2/87 (2%)

Query: 3   HPQIEQNFFSSQSDTNHTKNIN--ITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIE 60
            P  +Q         N  K      T +P   +  +  I   L+  PI  D +I    + 
Sbjct: 302 QPLSKQIESHETLSGNPIKETEYKPTVHPHQQKDVQSHIMALLSINPIAEDQLIRDLDLP 361

Query: 61  APVVYLVLLELDLAGRLCHHPEGKVSL 87
           +  V   LL+L+L G +     G +S 
Sbjct: 362 SATVSAKLLDLELEGAIMRQSGGLLSR 388


>gi|254246862|ref|ZP_04940183.1| SMF protein [Burkholderia cenocepacia PC184]
 gi|124871638|gb|EAY63354.1| SMF protein [Burkholderia cenocepacia PC184]
          Length = 475

 Score = 65.2 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 16/84 (19%), Positives = 31/84 (36%)

Query: 11  FSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLE 70
            +       T                  +  +L   P+  + +  H+G+   V++  LL 
Sbjct: 382 IAQAGRPAATTAPASIEAAPPGTPSEQAVLTALGYGPVTYEWLAEHSGLSDDVLHGALLA 441

Query: 71  LDLAGRLCHHPEGKVSLTMHLPSP 94
           L+LAGR+     G+ +     P+P
Sbjct: 442 LELAGRVASVAGGRFARLDAAPTP 465


>gi|163742204|ref|ZP_02149592.1| DNA processing protein DprA, putative [Phaeobacter gallaeciensis
           2.10]
 gi|161384534|gb|EDQ08915.1| DNA processing protein DprA, putative [Phaeobacter gallaeciensis
           2.10]
          Length = 355

 Score = 65.2 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 18/93 (19%), Positives = 28/93 (30%)

Query: 3   HPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAP 62
            P       +S   T              T     RI   L   P   D ++    I + 
Sbjct: 254 RPVPPPEAAASARLTELPPPPKEQRSLSDTAALHQRILDRLGPAPTAEDQLVRDLAIPSR 313

Query: 63  VVYLVLLELDLAGRLCHHPEGKVSLTMHLPSPQ 95
            +   L +L+L+G +     G + L      PQ
Sbjct: 314 DLAPALTDLELSGAVARAAGGLLILGDFDREPQ 346


>gi|82778583|ref|YP_404932.1| DNA protecting protein DprA [Shigella dysenteriae Sd197]
 gi|309785608|ref|ZP_07680239.1| DNA protecting protein DprA [Shigella dysenteriae 1617]
 gi|81242731|gb|ABB63441.1| predicted Rossmann-fold nucleotide-binding protein [Shigella
           dysenteriae Sd197]
 gi|308926728|gb|EFP72204.1| DNA protecting protein DprA [Shigella dysenteriae 1617]
          Length = 374

 Score = 65.2 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 16/78 (20%), Positives = 30/78 (38%), Gaps = 6/78 (7%)

Query: 10  FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLL 69
              +  ++ ++ +      P         +  ++ +    +D +    G   P V   LL
Sbjct: 290 LPDAPENSFYSPDQEDVALPFP------ELLANVGDEVTPVDVVAERAGQPVPEVVTQLL 343

Query: 70  ELDLAGRLCHHPEGKVSL 87
           EL+LAG +   P G V L
Sbjct: 344 ELELAGWIAAVPGGYVRL 361


>gi|107024059|ref|YP_622386.1| DNA processing protein DprA [Burkholderia cenocepacia AU 1054]
 gi|105894248|gb|ABF77413.1| DNA protecting protein DprA [Burkholderia cenocepacia AU 1054]
          Length = 475

 Score = 65.2 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 17/84 (20%), Positives = 33/84 (39%)

Query: 11  FSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLE 70
            +  + T  T                  +  +L   P+  + +  H+G+   V++  LL 
Sbjct: 382 IAQTNRTAATTAPASIEAAPPGTPSEQAVLTALGYGPVTYEWLAEHSGLSNDVLHGALLA 441

Query: 71  LDLAGRLCHHPEGKVSLTMHLPSP 94
           L+LAGR+     G+ +     P+P
Sbjct: 442 LELAGRVASVAGGRFARLDAAPTP 465


>gi|332085432|gb|EGI90598.1| DNA protecting protein DprA [Shigella boydii 5216-82]
          Length = 364

 Score = 65.2 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 16/78 (20%), Positives = 30/78 (38%), Gaps = 6/78 (7%)

Query: 10  FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLL 69
              +  ++ ++ +      P         +  ++ +    +D +    G   P V   LL
Sbjct: 280 LPDAPENSFYSPDQEDVALPFP------ELLANVGDEVTPVDVVAERAGQPVPEVVTQLL 333

Query: 70  ELDLAGRLCHHPEGKVSL 87
           EL+LAG +   P G V L
Sbjct: 334 ELELAGWIAAVPGGYVRL 351


>gi|209920751|ref|YP_002294835.1| DNA protecting protein DprA [Escherichia coli SE11]
 gi|209914010|dbj|BAG79084.1| conserved hypothetical protein [Escherichia coli SE11]
          Length = 374

 Score = 65.2 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 17/71 (23%), Positives = 27/71 (38%), Gaps = 2/71 (2%)

Query: 19  HTKNINITHYPEYTQCERV--RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGR 76
                N  + P+          +  ++ +    +D +    G   P V   LLEL+LAG 
Sbjct: 291 PDAPENSFYSPDQQDVALPFPELLANVGDEVTPVDVVAERAGQPVPEVVTQLLELELAGW 350

Query: 77  LCHHPEGKVSL 87
           +   P G V L
Sbjct: 351 IAAVPGGYVRL 361


>gi|293416704|ref|ZP_06659341.1| DNA processing protein [Escherichia coli B185]
 gi|291431280|gb|EFF04265.1| DNA processing protein [Escherichia coli B185]
          Length = 374

 Score = 65.2 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 16/78 (20%), Positives = 30/78 (38%), Gaps = 6/78 (7%)

Query: 10  FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLL 69
              +  ++ ++ +      P         +  ++ +    +D +    G   P V   LL
Sbjct: 290 LPDAPENSFYSPDQEDVALPFP------ELLANVGDEVTPVDVVAERAGQPVPEVVTQLL 343

Query: 70  ELDLAGRLCHHPEGKVSL 87
           EL+LAG +   P G V L
Sbjct: 344 ELELAGWIAAVPGGYVRL 361


>gi|109896357|ref|YP_659612.1| DNA protecting protein DprA [Pseudoalteromonas atlantica T6c]
 gi|109698638|gb|ABG38558.1| DNA protecting protein DprA [Pseudoalteromonas atlantica T6c]
          Length = 379

 Score = 65.2 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 12/51 (23%), Positives = 23/51 (45%)

Query: 37  VRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
            ++  S++     +D ++   G+    V   LLE +L G +   P G + L
Sbjct: 326 DKLLDSVDFETTPLDIVVERCGMPVAEVMSQLLEYELRGLVAAVPGGYLKL 376


>gi|170769588|ref|ZP_02904041.1| DNA protecting protein DprA [Escherichia albertii TW07627]
 gi|170121645|gb|EDS90576.1| DNA protecting protein DprA [Escherichia albertii TW07627]
          Length = 374

 Score = 65.2 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 16/78 (20%), Positives = 29/78 (37%), Gaps = 6/78 (7%)

Query: 10  FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLL 69
              +   + ++ +      P         +  ++ +    +D +    G   P V   LL
Sbjct: 290 LPGAPEKSFYSPDQEDVALPFP------ELLANVGDEVTPVDVVAERAGQPVPEVVTQLL 343

Query: 70  ELDLAGRLCHHPEGKVSL 87
           EL+LAG +   P G V L
Sbjct: 344 ELELAGWIAAVPGGYVRL 361


>gi|254511723|ref|ZP_05123790.1| DNA protecting protein DprA [Rhodobacteraceae bacterium KLH11]
 gi|221535434|gb|EEE38422.1| DNA protecting protein DprA [Rhodobacteraceae bacterium KLH11]
          Length = 351

 Score = 65.2 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 18/84 (21%), Positives = 29/84 (34%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVV 64
            +      S          + +            I   L   PI  D +I      A  V
Sbjct: 267 ALPPISPKSVEQPPLPFATDTSKAKIPPNTLHQAILTRLGPSPIAEDQLIRDISASAGEV 326

Query: 65  YLVLLELDLAGRLCHHPEGKVSLT 88
             VL++L+L G++   P G +SL+
Sbjct: 327 GPVLVDLELDGKILRQPGGLLSLS 350


>gi|221201857|ref|ZP_03574894.1| DNA protecting protein DprA [Burkholderia multivorans CGD2M]
 gi|221207637|ref|ZP_03580645.1| DNA protecting protein DprA [Burkholderia multivorans CGD2]
 gi|221172483|gb|EEE04922.1| DNA protecting protein DprA [Burkholderia multivorans CGD2]
 gi|221178277|gb|EEE10687.1| DNA protecting protein DprA [Burkholderia multivorans CGD2M]
          Length = 478

 Score = 65.2 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 14/64 (21%), Positives = 26/64 (40%)

Query: 31  YTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMH 90
                   +  +L   P+  + +    G+    ++  LL L+LAGR+   P G+      
Sbjct: 405 PACPAEQAVLTALGYGPVTYEWLAERCGLPDDALHRALLALELAGRVAPLPGGRYGRLDG 464

Query: 91  LPSP 94
            P+P
Sbjct: 465 PPNP 468


>gi|15833405|ref|NP_312178.1| DNA protecting protein DprA [Escherichia coli O157:H7 str. Sakai]
 gi|168786175|ref|ZP_02811182.1| DNA protecting protein DprA [Escherichia coli O157:H7 str. EC869]
 gi|217325833|ref|ZP_03441917.1| DNA protecting protein DprA [Escherichia coli O157:H7 str. TW14588]
 gi|261224590|ref|ZP_05938871.1| DNA protecting protein DprA [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261254516|ref|ZP_05947049.1| DNA protecting protein DprA [Escherichia coli O157:H7 str. FRIK966]
 gi|13363624|dbj|BAB37574.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai]
 gi|189373826|gb|EDU92242.1| DNA protecting protein DprA [Escherichia coli O157:H7 str. EC869]
 gi|209757368|gb|ACI76996.1| hypothetical protein ECs4151 [Escherichia coli]
 gi|209757370|gb|ACI76997.1| hypothetical protein ECs4151 [Escherichia coli]
 gi|217322054|gb|EEC30478.1| DNA protecting protein DprA [Escherichia coli O157:H7 str. TW14588]
 gi|320639590|gb|EFX09184.1| hypothetical protein ECO5101_01180 [Escherichia coli O157:H7 str.
           G5101]
 gi|320645088|gb|EFX14104.1| hypothetical protein ECO9389_00924 [Escherichia coli O157:H- str.
           493-89]
 gi|320650399|gb|EFX18865.1| hypothetical protein ECO2687_03814 [Escherichia coli O157:H- str. H
           2687]
 gi|320666398|gb|EFX33381.1| hypothetical protein ECOSU61_15290 [Escherichia coli O157:H7 str.
           LSU-61]
 gi|326342534|gb|EGD66308.1| Rossmann fold nucleotide-binding protein Smf possibly involved in
           DNA uptake [Escherichia coli O157:H7 str. 1044]
          Length = 374

 Score = 65.2 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 16/78 (20%), Positives = 30/78 (38%), Gaps = 6/78 (7%)

Query: 10  FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLL 69
              +  ++ ++ +      P         +  ++ +    +D +    G   P V   LL
Sbjct: 290 LPDAPENSFYSPDQEDVALPFP------ELLANVGDEVTPVDVVAERAGQPVPEVVTQLL 343

Query: 70  ELDLAGRLCHHPEGKVSL 87
           EL+LAG +   P G V L
Sbjct: 344 ELELAGWIAAVPGGYVRL 361


>gi|332830027|gb|EGK02655.1| hypothetical protein HMPREF9455_00905 [Dysgonomonas gadei ATCC
           BAA-286]
          Length = 373

 Score = 65.2 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 15/58 (25%), Positives = 24/58 (41%), Gaps = 1/58 (1%)

Query: 32  TQCERVRIKQSLNN-VPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
              E   I   L     +HID +     I A  ++  LLEL++ G + + P    +L 
Sbjct: 316 LTDEEKIITDKLGTIDSLHIDQLARELNIPAYQLFTTLLELEMKGLIKNLPGNMYALA 373


>gi|187731689|ref|YP_001881969.1| DNA protecting protein DprA [Shigella boydii CDC 3083-94]
 gi|187428681|gb|ACD07955.1| DNA protecting protein DprA [Shigella boydii CDC 3083-94]
 gi|320173930|gb|EFW49106.1| Rossmann fold nucleotide-binding protein Smf possibly involved in
           DNA uptake [Shigella dysenteriae CDC 74-1112]
          Length = 374

 Score = 65.2 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 17/71 (23%), Positives = 27/71 (38%), Gaps = 2/71 (2%)

Query: 19  HTKNINITHYPEYTQCERV--RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGR 76
                N  + P+          +  ++ +    +D +    G   P V   LLEL+LAG 
Sbjct: 291 PDAPENSFYSPDQQDVALPFPELLANVGDEVTPVDVVAERAGQPVPEVVTQLLELELAGW 350

Query: 77  LCHHPEGKVSL 87
           +   P G V L
Sbjct: 351 IAAVPGGYVRL 361


>gi|300903534|ref|ZP_07121456.1| DNA protecting protein DprA [Escherichia coli MS 84-1]
 gi|301305495|ref|ZP_07211587.1| DNA protecting protein DprA [Escherichia coli MS 124-1]
 gi|300404407|gb|EFJ87945.1| DNA protecting protein DprA [Escherichia coli MS 84-1]
 gi|300839190|gb|EFK66950.1| DNA protecting protein DprA [Escherichia coli MS 124-1]
 gi|315255869|gb|EFU35837.1| DNA protecting protein DprA [Escherichia coli MS 85-1]
          Length = 374

 Score = 65.2 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 17/71 (23%), Positives = 27/71 (38%), Gaps = 2/71 (2%)

Query: 19  HTKNINITHYPEYTQCERV--RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGR 76
                N  + P+          +  ++ +    +D +    G   P V   LLEL+LAG 
Sbjct: 291 PDAPENSFYSPDQQDVALPFPELLANVGDEVTPVDVVAERAGQPVPEVVTQLLELELAGW 350

Query: 77  LCHHPEGKVSL 87
           +   P G V L
Sbjct: 351 IAAVPGGYVRL 361


>gi|297183540|gb|ADI19669.1| predicted rossmann fold nucleotide-binding protein involved in DNA
           uptake [uncultured Alteromonadales bacterium
           HF4000_16C08]
          Length = 373

 Score = 65.2 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 18/79 (22%), Positives = 29/79 (36%)

Query: 9   NFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVL 68
           +  + Q   +  K  NI+   E       ++  S++     ID I     +        L
Sbjct: 292 DEIAVQPYADLGKGNNISEKSEVNNLATDKLLDSVDYDITAIDVIAQRCSMPVQQAMAEL 351

Query: 69  LELDLAGRLCHHPEGKVSL 87
           LE +L G +   P G V L
Sbjct: 352 LEYELRGLVAAIPGGYVKL 370


>gi|284923292|emb|CBG36386.1| conserved hypothetical protein [Escherichia coli 042]
          Length = 374

 Score = 65.2 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 16/78 (20%), Positives = 30/78 (38%), Gaps = 6/78 (7%)

Query: 10  FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLL 69
              +  ++ ++ +      P         +  ++ +    +D +    G   P V   LL
Sbjct: 290 LPDAPENSFYSPDQEDVALPFP------ELLANVGDEVTPVDVVAERAGQPVPEVVTQLL 343

Query: 70  ELDLAGRLCHHPEGKVSL 87
           EL+LAG +   P G V L
Sbjct: 344 ELELAGWIAAVPGGYVRL 361


>gi|471305|emb|CAA54827.1| orf374 [Escherichia coli]
          Length = 374

 Score = 65.2 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 17/71 (23%), Positives = 27/71 (38%), Gaps = 2/71 (2%)

Query: 19  HTKNINITHYPEYTQCERV--RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGR 76
                N  + P+          +  ++ +    +D +    G   P V   LLEL+LAG 
Sbjct: 291 PDAPENSFYSPDQQDVALPFPELLANVGDEVTPVDVVAERAGQPVPEVVTQLLELELAGW 350

Query: 77  LCHHPEGKVSL 87
           +   P G V L
Sbjct: 351 IAAVPGGYVRL 361


>gi|332304411|ref|YP_004432262.1| DNA protecting protein DprA [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332171740|gb|AEE20994.1| DNA protecting protein DprA [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 379

 Score = 64.9 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 12/51 (23%), Positives = 23/51 (45%)

Query: 37  VRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
            ++  S++     +D ++   G+    V   LLE +L G +   P G + L
Sbjct: 326 DKLLDSVDFETTPLDIVVERCGMPVAEVMSQLLEYELRGLVTAVPGGYLKL 376


>gi|224826192|ref|ZP_03699295.1| DNA protecting protein DprA [Lutiella nitroferrum 2002]
 gi|224601829|gb|EEG08009.1| DNA protecting protein DprA [Lutiella nitroferrum 2002]
          Length = 366

 Score = 64.9 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 15/53 (28%), Positives = 24/53 (45%)

Query: 35  ERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
               +   L   P+ +D +     + A  VY +LLEL+L GR+   P G+   
Sbjct: 312 AETPLLVQLGYDPVDVDSLAARLELTAGEVYAMLLELELEGRVASLPGGRFQR 364


>gi|49176336|ref|YP_026211.1| conserved protein [Escherichia coli str. K-12 substr. MG1655]
 gi|89110725|ref|AP_004505.1| hypothetical protein [Escherichia coli str. K-12 substr. W3110]
 gi|157162759|ref|YP_001460077.1| DNA protecting protein DprA [Escherichia coli HS]
 gi|170018479|ref|YP_001723433.1| DNA protecting protein DprA [Escherichia coli ATCC 8739]
 gi|170082806|ref|YP_001732126.1| hypothetical protein ECDH10B_3460 [Escherichia coli str. K-12
           substr. DH10B]
 gi|194440009|ref|ZP_03072067.1| DNA protecting protein DprA [Escherichia coli 101-1]
 gi|238902376|ref|YP_002928172.1| hypothetical protein BWG_2976 [Escherichia coli BW2952]
 gi|253771891|ref|YP_003034722.1| DNA protecting protein DprA [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|254038446|ref|ZP_04872502.1| DNA protecting protein DprA [Escherichia sp. 1_1_43]
 gi|254163213|ref|YP_003046321.1| DNA protecting protein DprA [Escherichia coli B str. REL606]
 gi|297517903|ref|ZP_06936289.1| DNA protecting protein DprA [Escherichia coli OP50]
 gi|300932178|ref|ZP_07147458.1| DNA protecting protein DprA [Escherichia coli MS 187-1]
 gi|300946507|ref|ZP_07160773.1| DNA protecting protein DprA [Escherichia coli MS 116-1]
 gi|300955323|ref|ZP_07167705.1| DNA protecting protein DprA [Escherichia coli MS 175-1]
 gi|301021205|ref|ZP_07185239.1| DNA protecting protein DprA [Escherichia coli MS 196-1]
 gi|312972453|ref|ZP_07786627.1| DNA protecting protein DprA [Escherichia coli 1827-70]
 gi|401096|sp|P30852|SMF_ECOLI RecName: Full=Protein smf
 gi|49087|emb|CAA46763.1| smf [Escherichia coli K-12]
 gi|443988|emb|CAA54366.1| smf [Escherichia coli K-12]
 gi|48994932|gb|AAT48176.1| conserved protein [Escherichia coli str. K-12 substr. MG1655]
 gi|85676756|dbj|BAE78006.1| conserved hypothetical protein [Escherichia coli str. K12 substr.
           W3110]
 gi|157068439|gb|ABV07694.1| DNA protecting protein DprA [Escherichia coli HS]
 gi|169753407|gb|ACA76106.1| DNA protecting protein DprA [Escherichia coli ATCC 8739]
 gi|169890641|gb|ACB04348.1| conserved protein [Escherichia coli str. K-12 substr. DH10B]
 gi|194421061|gb|EDX37090.1| DNA protecting protein DprA [Escherichia coli 101-1]
 gi|226838952|gb|EEH70975.1| DNA protecting protein DprA [Escherichia sp. 1_1_43]
 gi|238860422|gb|ACR62420.1| conserved protein [Escherichia coli BW2952]
 gi|242378812|emb|CAQ33604.1| conserved protein [Escherichia coli BL21(DE3)]
 gi|253322935|gb|ACT27537.1| DNA protecting protein DprA [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|253975114|gb|ACT40785.1| hypothetical protein ECB_03136 [Escherichia coli B str. REL606]
 gi|253979270|gb|ACT44940.1| hypothetical protein ECD_03136 [Escherichia coli BL21(DE3)]
 gi|260447696|gb|ACX38118.1| DNA protecting protein DprA [Escherichia coli DH1]
 gi|299881613|gb|EFI89824.1| DNA protecting protein DprA [Escherichia coli MS 196-1]
 gi|300317767|gb|EFJ67551.1| DNA protecting protein DprA [Escherichia coli MS 175-1]
 gi|300453813|gb|EFK17433.1| DNA protecting protein DprA [Escherichia coli MS 116-1]
 gi|300460062|gb|EFK23555.1| DNA protecting protein DprA [Escherichia coli MS 187-1]
 gi|310334830|gb|EFQ01035.1| DNA protecting protein DprA [Escherichia coli 1827-70]
 gi|315137861|dbj|BAJ45020.1| DNA protecting protein DprA [Escherichia coli DH1]
 gi|323934516|gb|EGB30924.1| DNA protecting protein DprA [Escherichia coli E1520]
 gi|323939293|gb|EGB35505.1| DNA protecting protein DprA [Escherichia coli E482]
 gi|323959564|gb|EGB55217.1| DNA protecting protein DprA [Escherichia coli H489]
 gi|323970089|gb|EGB65363.1| DNA protecting protein DprA [Escherichia coli TA007]
 gi|332345233|gb|AEE58567.1| DNA protecting protein DprA [Escherichia coli UMNK88]
          Length = 374

 Score = 64.9 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 17/71 (23%), Positives = 27/71 (38%), Gaps = 2/71 (2%)

Query: 19  HTKNINITHYPEYTQCERV--RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGR 76
                N  + P+          +  ++ +    +D +    G   P V   LLEL+LAG 
Sbjct: 291 PDAPENSFYSPDQQDVALPFPELLANVGDEVTPVDVVAERAGQPVPEVVTQLLELELAGW 350

Query: 77  LCHHPEGKVSL 87
           +   P G V L
Sbjct: 351 IAAVPGGYVRL 361


>gi|170681650|ref|YP_001745548.1| DNA protecting protein DprA [Escherichia coli SMS-3-5]
 gi|215488585|ref|YP_002331016.1| DNA protecting protein DprA [Escherichia coli O127:H6 str.
           E2348/69]
 gi|300935283|ref|ZP_07150294.1| DNA protecting protein DprA [Escherichia coli MS 21-1]
 gi|312968389|ref|ZP_07782599.1| DNA protecting protein DprA [Escherichia coli 2362-75]
 gi|170519368|gb|ACB17546.1| DNA protecting protein DprA [Escherichia coli SMS-3-5]
 gi|215266657|emb|CAS11096.1| predicted protein [Escherichia coli O127:H6 str. E2348/69]
 gi|300459486|gb|EFK22979.1| DNA protecting protein DprA [Escherichia coli MS 21-1]
 gi|312287214|gb|EFR15124.1| DNA protecting protein DprA [Escherichia coli 2362-75]
 gi|323189109|gb|EFZ74393.1| DNA protecting protein DprA [Escherichia coli RN587/1]
          Length = 374

 Score = 64.9 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 16/78 (20%), Positives = 30/78 (38%), Gaps = 6/78 (7%)

Query: 10  FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLL 69
              +  ++ ++ +      P         +  ++ +    +D +    G   P V   LL
Sbjct: 290 LPDAPENSFYSPDQEDVALPFP------ELLANVGDEVTPVDVVAERAGQPVPEVVTQLL 343

Query: 70  ELDLAGRLCHHPEGKVSL 87
           EL+LAG +   P G V L
Sbjct: 344 ELELAGWIAAVPGGYVRL 361


>gi|16762877|ref|NP_458494.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|29144364|ref|NP_807706.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|213161457|ref|ZP_03347167.1| hypothetical protein Salmoneentericaenterica_16122 [Salmonella
           enterica subsp. enterica serovar Typhi str. E00-7866]
 gi|213650878|ref|ZP_03380931.1| hypothetical protein SentesTy_28815 [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
 gi|289824190|ref|ZP_06543785.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-3139]
 gi|25346559|pir||AC1010 conserved hypothetical protein STY4392 [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16505184|emb|CAD09180.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29140002|gb|AAO71566.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
          Length = 374

 Score = 64.9 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 17/78 (21%), Positives = 32/78 (41%), Gaps = 6/78 (7%)

Query: 10  FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLL 69
             ++  ++ ++ N +    P         +  ++ +    +D +    G   P V   LL
Sbjct: 290 LPTTAENSLYSLNQDEAALPFP------ELLANVGDEVTPVDVVAERAGQPVPAVVAQLL 343

Query: 70  ELDLAGRLCHHPEGKVSL 87
           EL+LAG +   P G V L
Sbjct: 344 ELELAGWIAAVPGGYVRL 361


>gi|191169308|ref|ZP_03031057.1| DNA protecting protein DprA [Escherichia coli B7A]
 gi|218555843|ref|YP_002388756.1| DNA protecting protein DprA [Escherichia coli IAI1]
 gi|218696978|ref|YP_002404645.1| DNA protecting protein DprA [Escherichia coli 55989]
 gi|256020644|ref|ZP_05434509.1| DNA protecting protein DprA [Shigella sp. D9]
 gi|300822911|ref|ZP_07103047.1| DNA protecting protein DprA [Escherichia coli MS 119-7]
 gi|300918260|ref|ZP_07134864.1| DNA protecting protein DprA [Escherichia coli MS 115-1]
 gi|307315136|ref|ZP_07594719.1| DNA protecting protein DprA [Escherichia coli W]
 gi|309794561|ref|ZP_07688983.1| DNA protecting protein DprA [Escherichia coli MS 145-7]
 gi|331670115|ref|ZP_08370954.1| protein smf [Escherichia coli TA271]
 gi|331679354|ref|ZP_08380024.1| protein smf [Escherichia coli H591]
 gi|332281840|ref|ZP_08394253.1| DNA protecting protein DprA [Shigella sp. D9]
 gi|190900663|gb|EDV60463.1| DNA protecting protein DprA [Escherichia coli B7A]
 gi|218353710|emb|CAU99980.1| conserved hypothetical protein [Escherichia coli 55989]
 gi|218362611|emb|CAR00237.1| conserved hypothetical protein [Escherichia coli IAI1]
 gi|300414521|gb|EFJ97831.1| DNA protecting protein DprA [Escherichia coli MS 115-1]
 gi|300524677|gb|EFK45746.1| DNA protecting protein DprA [Escherichia coli MS 119-7]
 gi|306905485|gb|EFN36020.1| DNA protecting protein DprA [Escherichia coli W]
 gi|308121611|gb|EFO58873.1| DNA protecting protein DprA [Escherichia coli MS 145-7]
 gi|315062577|gb|ADT76904.1| DNA protecting protein DprA [Escherichia coli W]
 gi|323182764|gb|EFZ68165.1| DNA protecting protein DprA [Escherichia coli 1357]
 gi|323376836|gb|ADX49104.1| DNA protecting protein DprA [Escherichia coli KO11]
 gi|323944294|gb|EGB40370.1| DNA protecting protein DprA [Escherichia coli H120]
 gi|324017408|gb|EGB86627.1| DNA protecting protein DprA [Escherichia coli MS 117-3]
 gi|324116325|gb|EGC10245.1| DNA protecting protein DprA [Escherichia coli E1167]
 gi|331062177|gb|EGI34097.1| protein smf [Escherichia coli TA271]
 gi|331072526|gb|EGI43851.1| protein smf [Escherichia coli H591]
 gi|332104192|gb|EGJ07538.1| DNA protecting protein DprA [Shigella sp. D9]
          Length = 374

 Score = 64.9 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 17/71 (23%), Positives = 27/71 (38%), Gaps = 2/71 (2%)

Query: 19  HTKNINITHYPEYTQCERV--RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGR 76
                N  + P+          +  ++ +    +D +    G   P V   LLEL+LAG 
Sbjct: 291 PDAPENSFYSPDQQDVALPFPELLANVGDEVTPVDVVAERAGQPVPEVVTQLLELELAGW 350

Query: 77  LCHHPEGKVSL 87
           +   P G V L
Sbjct: 351 IAAVPGGYVRL 361


>gi|193071554|ref|ZP_03052463.1| DNA protecting protein DprA [Escherichia coli E110019]
 gi|192955142|gb|EDV85636.1| DNA protecting protein DprA [Escherichia coli E110019]
 gi|320199473|gb|EFW74063.1| Rossmann fold nucleotide-binding protein Smf possibly involved in
           DNA uptake [Escherichia coli EC4100B]
          Length = 374

 Score = 64.9 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 17/71 (23%), Positives = 27/71 (38%), Gaps = 2/71 (2%)

Query: 19  HTKNINITHYPEYTQCERV--RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGR 76
                N  + P+          +  ++ +    +D +    G   P V   LLEL+LAG 
Sbjct: 291 PDAPENSFYSPDQQDVALPFPELLANVGDEVTPVDVVAERAGQPVPEVVTQLLELELAGW 350

Query: 77  LCHHPEGKVSL 87
           +   P G V L
Sbjct: 351 IAAVPGGYVRL 361


>gi|294777365|ref|ZP_06742816.1| DNA protecting protein DprA [Bacteroides vulgatus PC510]
 gi|294448433|gb|EFG16982.1| DNA protecting protein DprA [Bacteroides vulgatus PC510]
          Length = 371

 Score = 64.9 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 15/89 (16%), Positives = 29/89 (32%), Gaps = 4/89 (4%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYP--EYTQCERVRIKQSLN--NVPIHIDDIIHHTGIE 60
              ++   +    +  K               E  RI + L      + I+ ++  T I 
Sbjct: 283 TSAEDLVKAMGWESSPKTEKTVQRELFPDLSEEEERIVKRLGKMPEGLQINTLVIDTNIP 342

Query: 61  APVVYLVLLELDLAGRLCHHPEGKVSLTM 89
              +  +L EL++ G +     G   L M
Sbjct: 343 VNRMSALLFELEMKGVIRALAGGVYRLIM 371


>gi|157156735|ref|YP_001464753.1| DNA protecting protein DprA [Escherichia coli E24377A]
 gi|300921906|ref|ZP_07138061.1| DNA protecting protein DprA [Escherichia coli MS 182-1]
 gi|301325149|ref|ZP_07218681.1| DNA protecting protein DprA [Escherichia coli MS 78-1]
 gi|157078765|gb|ABV18473.1| DNA protecting protein DprA [Escherichia coli E24377A]
 gi|300421707|gb|EFK05018.1| DNA protecting protein DprA [Escherichia coli MS 182-1]
 gi|300847981|gb|EFK75741.1| DNA protecting protein DprA [Escherichia coli MS 78-1]
          Length = 374

 Score = 64.9 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 17/71 (23%), Positives = 27/71 (38%), Gaps = 2/71 (2%)

Query: 19  HTKNINITHYPEYTQCERV--RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGR 76
                N  + P+          +  ++ +    +D +    G   P V   LLEL+LAG 
Sbjct: 291 PDAPENSFYSPDQQDVALPFPELLANVGDEVTPVDVVAERAGQPVPEVVTQLLELELAGW 350

Query: 77  LCHHPEGKVSL 87
           +   P G V L
Sbjct: 351 IAAVPGGYVRL 361


>gi|193066497|ref|ZP_03047541.1| DNA protecting protein DprA [Escherichia coli E22]
 gi|194430286|ref|ZP_03062781.1| DNA protecting protein DprA [Escherichia coli B171]
 gi|260846083|ref|YP_003223861.1| hypothetical protein ECO103_4017 [Escherichia coli O103:H2 str.
           12009]
 gi|300815504|ref|ZP_07095729.1| DNA protecting protein DprA [Escherichia coli MS 107-1]
 gi|192925878|gb|EDV80528.1| DNA protecting protein DprA [Escherichia coli E22]
 gi|194411675|gb|EDX28002.1| DNA protecting protein DprA [Escherichia coli B171]
 gi|257761230|dbj|BAI32727.1| conserved predicted protein [Escherichia coli O103:H2 str. 12009]
 gi|300532396|gb|EFK53458.1| DNA protecting protein DprA [Escherichia coli MS 107-1]
 gi|323162964|gb|EFZ48799.1| DNA protecting protein DprA [Escherichia coli E128010]
          Length = 374

 Score = 64.9 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 17/71 (23%), Positives = 27/71 (38%), Gaps = 2/71 (2%)

Query: 19  HTKNINITHYPEYTQCERV--RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGR 76
                N  + P+          +  ++ +    +D +    G   P V   LLEL+LAG 
Sbjct: 291 PDAPENSFYSPDQQDVALPFPELLANVGDEVTPVDVVAERAGQPVPEVVTQLLELELAGW 350

Query: 77  LCHHPEGKVSL 87
           +   P G V L
Sbjct: 351 IAAVPGGYVRL 361


>gi|320195377|gb|EFW70004.1| Rossmann fold nucleotide-binding protein Smf possibly involved in
           DNA uptake [Escherichia coli WV_060327]
          Length = 374

 Score = 64.9 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 16/78 (20%), Positives = 30/78 (38%), Gaps = 6/78 (7%)

Query: 10  FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLL 69
              +  ++ ++ +      P         +  ++ +    +D +    G   P V   LL
Sbjct: 290 LPDAPENSFYSPDQEDVALPFP------ELLANVGDEVTPVDVVAERAGQPVPEVVTQLL 343

Query: 70  ELDLAGRLCHHPEGKVSL 87
           EL+LAG +   P G V L
Sbjct: 344 ELELAGWIAAVPGGYVRL 361


>gi|260857406|ref|YP_003231297.1| hypothetical protein ECO26_4387 [Escherichia coli O26:H11 str.
           11368]
 gi|257756055|dbj|BAI27557.1| conserved predicted protein [Escherichia coli O26:H11 str. 11368]
          Length = 374

 Score = 64.9 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 17/71 (23%), Positives = 27/71 (38%), Gaps = 2/71 (2%)

Query: 19  HTKNINITHYPEYTQCERV--RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGR 76
                N  + P+          +  ++ +    +D +    G   P V   LLEL+LAG 
Sbjct: 291 PDAPENSFYSPDQQDVALPFPELLANVGDEVTPVDVVAERAGQPVPEVVTQLLELELAGW 350

Query: 77  LCHHPEGKVSL 87
           +   P G V L
Sbjct: 351 IAAVPGGYVRL 361


>gi|74313804|ref|YP_312223.1| DNA protecting protein DprA [Shigella sonnei Ss046]
 gi|73857281|gb|AAZ89988.1| Predicted Rossmann-fold nucleotide-binding protein [Shigella sonnei
           Ss046]
 gi|323164850|gb|EFZ50641.1| DNA protecting protein DprA [Shigella sonnei 53G]
          Length = 374

 Score = 64.9 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 17/71 (23%), Positives = 27/71 (38%), Gaps = 2/71 (2%)

Query: 19  HTKNINITHYPEYTQCERV--RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGR 76
                N  + P+          +  ++ +    +D +    G   P V   LLEL+LAG 
Sbjct: 291 PDAPENSFYSPDQQDVALPFPELLANVGDEVTPVDVVAERAGQPVPEVVTQLLELELAGW 350

Query: 77  LCHHPEGKVSL 87
           +   P G V L
Sbjct: 351 IAAVPGGYVRL 361


>gi|212692602|ref|ZP_03300730.1| hypothetical protein BACDOR_02099 [Bacteroides dorei DSM 17855]
 gi|237709086|ref|ZP_04539567.1| conserved hypothetical protein [Bacteroides sp. 9_1_42FAA]
 gi|265752610|ref|ZP_06088179.1| conserved hypothetical protein [Bacteroides sp. 3_1_33FAA]
 gi|212664887|gb|EEB25459.1| hypothetical protein BACDOR_02099 [Bacteroides dorei DSM 17855]
 gi|229456782|gb|EEO62503.1| conserved hypothetical protein [Bacteroides sp. 9_1_42FAA]
 gi|263235796|gb|EEZ21291.1| conserved hypothetical protein [Bacteroides sp. 3_1_33FAA]
          Length = 371

 Score = 64.9 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 15/89 (16%), Positives = 28/89 (31%), Gaps = 4/89 (4%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYP--EYTQCERVRIKQSLN--NVPIHIDDIIHHTGIE 60
              ++        +  K               E  RI + L      + I+ ++  T I 
Sbjct: 283 TSAEDLVKGMGWESSPKTEKTVQRELFPDLSEEEERIVKRLGKIPEGLQINTLVIDTNIP 342

Query: 61  APVVYLVLLELDLAGRLCHHPEGKVSLTM 89
              +  +L EL++ G +     G   L M
Sbjct: 343 VNRMSALLFELEMKGVIRALAGGVYRLIM 371


>gi|323173922|gb|EFZ59550.1| DNA protecting protein DprA [Escherichia coli LT-68]
          Length = 364

 Score = 64.9 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 17/71 (23%), Positives = 27/71 (38%), Gaps = 2/71 (2%)

Query: 19  HTKNINITHYPEYTQCERV--RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGR 76
                N  + P+          +  ++ +    +D +    G   P V   LLEL+LAG 
Sbjct: 281 PDAPENSFYSPDQQDVALPFPELLANVGDEVTPVDVVAERAGQPVPEVVTQLLELELAGW 340

Query: 77  LCHHPEGKVSL 87
           +   P G V L
Sbjct: 341 IAAVPGGYVRL 351


>gi|198243264|ref|YP_002217369.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|197937780|gb|ACH75113.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
          Length = 374

 Score = 64.9 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 17/78 (21%), Positives = 32/78 (41%), Gaps = 6/78 (7%)

Query: 10  FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLL 69
             ++  ++ ++ N +    P         +  ++ +    +D +    G   P V   LL
Sbjct: 290 LPTTAENSLYSLNQDEAALPFP------ELLANVGDEVTPVDVVAERAGQPVPAVVAQLL 343

Query: 70  ELDLAGRLCHHPEGKVSL 87
           EL+LAG +   P G V L
Sbjct: 344 ELELAGWIAAVPGGYVRL 361


>gi|293412704|ref|ZP_06655372.1| hypothetical protein ECEG_03768 [Escherichia coli B354]
 gi|291468351|gb|EFF10844.1| hypothetical protein ECEG_03768 [Escherichia coli B354]
          Length = 364

 Score = 64.9 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 16/78 (20%), Positives = 30/78 (38%), Gaps = 6/78 (7%)

Query: 10  FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLL 69
              +  ++ ++ +      P         +  ++ +    +D +    G   P V   LL
Sbjct: 280 LPDAPENSFYSPDQEDVALPFP------ELLANVGDEVTPVDVVAERAGQPVPEVVTQLL 333

Query: 70  ELDLAGRLCHHPEGKVSL 87
           EL+LAG +   P G V L
Sbjct: 334 ELELAGWIAAVPGGYVRL 351


>gi|26249870|ref|NP_755910.1| DNA protecting protein DprA [Escherichia coli CFT073]
 gi|91212712|ref|YP_542698.1| DNA protecting protein DprA [Escherichia coli UTI89]
 gi|117625568|ref|YP_858891.1| hypothetical protein APECO1_3161 [Escherichia coli APEC O1]
 gi|218560347|ref|YP_002393260.1| DNA protecting protein DprA [Escherichia coli S88]
 gi|218691572|ref|YP_002399784.1| DNA protecting protein DprA [Escherichia coli ED1a]
 gi|227883417|ref|ZP_04001222.1| SMF family Rossmann fold nucleotide-binding protein [Escherichia
           coli 83972]
 gi|300979822|ref|ZP_07174724.1| DNA protecting protein DprA [Escherichia coli MS 45-1]
 gi|301046056|ref|ZP_07193235.1| DNA protecting protein DprA [Escherichia coli MS 185-1]
 gi|331659576|ref|ZP_08360514.1| protein smf [Escherichia coli TA206]
 gi|26110298|gb|AAN82484.1|AE016767_244 Unknown protein fragment 1 [Escherichia coli CFT073]
 gi|91074286|gb|ABE09167.1| unknown protein [Escherichia coli UTI89]
 gi|115514692|gb|ABJ02767.1| conserved hypothetical protein [Escherichia coli APEC O1]
 gi|218367116|emb|CAR04890.1| conserved hypothetical protein [Escherichia coli S88]
 gi|218429136|emb|CAR10088.2| conserved hypothetical protein [Escherichia coli ED1a]
 gi|227839561|gb|EEJ50027.1| SMF family Rossmann fold nucleotide-binding protein [Escherichia
           coli 83972]
 gi|294490069|gb|ADE88825.1| DNA protecting protein DprA [Escherichia coli IHE3034]
 gi|300301941|gb|EFJ58326.1| DNA protecting protein DprA [Escherichia coli MS 185-1]
 gi|300409428|gb|EFJ92966.1| DNA protecting protein DprA [Escherichia coli MS 45-1]
 gi|307555373|gb|ADN48148.1| DNA protecting protein DprA [Escherichia coli ABU 83972]
 gi|307628320|gb|ADN72624.1| DNA protecting protein DprA [Escherichia coli UM146]
 gi|315292339|gb|EFU51691.1| DNA protecting protein DprA [Escherichia coli MS 153-1]
 gi|315297151|gb|EFU56431.1| DNA protecting protein DprA [Escherichia coli MS 16-3]
 gi|323950199|gb|EGB46081.1| DNA protecting protein DprA [Escherichia coli H252]
 gi|324009051|gb|EGB78270.1| DNA protecting protein DprA [Escherichia coli MS 57-2]
 gi|331052791|gb|EGI24824.1| protein smf [Escherichia coli TA206]
          Length = 374

 Score = 64.9 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 16/78 (20%), Positives = 30/78 (38%), Gaps = 6/78 (7%)

Query: 10  FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLL 69
              +  ++ ++ +      P         +  ++ +    +D +    G   P V   LL
Sbjct: 290 LPDAPENSFYSPDQEDVALPFP------ELLANVGDEVTPVDVVAERAGQPVPEVVTQLL 343

Query: 70  ELDLAGRLCHHPEGKVSL 87
           EL+LAG +   P G V L
Sbjct: 344 ELELAGWIAAVPGGYVRL 361


>gi|83954521|ref|ZP_00963232.1| DNA processing protein DprA, putative [Sulfitobacter sp. NAS-14.1]
 gi|83840805|gb|EAP79976.1| DNA processing protein DprA, putative [Sulfitobacter sp. NAS-14.1]
          Length = 365

 Score = 64.9 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 16/84 (19%), Positives = 27/84 (32%), Gaps = 3/84 (3%)

Query: 8   QNFFSSQSDTNHTKNINITHYPEYT---QCERVRIKQSLNNVPIHIDDIIHHTGIEAPVV 64
            +          +  I+    P            I   L   P+  D ++    +   + 
Sbjct: 281 MDQLGRAKAAAASPPISQAAAPAPQRDIAALHTDILSRLGPSPVAEDQLLRDLAVAPGIA 340

Query: 65  YLVLLELDLAGRLCHHPEGKVSLT 88
             VL+EL+L G +  H  G VS  
Sbjct: 341 TPVLVELELNGHILRHAGGLVSRA 364


>gi|110643524|ref|YP_671254.1| DNA protecting protein DprA [Escherichia coli 536]
 gi|191174469|ref|ZP_03035970.1| DNA protecting protein DprA [Escherichia coli F11]
 gi|300973965|ref|ZP_07172372.1| DNA protecting protein DprA [Escherichia coli MS 200-1]
 gi|306816372|ref|ZP_07450510.1| DNA protecting protein DprA [Escherichia coli NC101]
 gi|331649082|ref|ZP_08350168.1| protein smf [Escherichia coli M605]
 gi|110345116|gb|ABG71353.1| hypothetical protein Smf [Escherichia coli 536]
 gi|190905277|gb|EDV64915.1| DNA protecting protein DprA [Escherichia coli F11]
 gi|222034994|emb|CAP77737.1| Protein smf [Escherichia coli LF82]
 gi|281180320|dbj|BAI56650.1| conserved hypothetical protein [Escherichia coli SE15]
 gi|300308975|gb|EFJ63495.1| DNA protecting protein DprA [Escherichia coli MS 200-1]
 gi|305850768|gb|EFM51225.1| DNA protecting protein DprA [Escherichia coli NC101]
 gi|312947836|gb|ADR28663.1| DNA protecting protein DprA [Escherichia coli O83:H1 str. NRG 857C]
 gi|324014962|gb|EGB84181.1| DNA protecting protein DprA [Escherichia coli MS 60-1]
 gi|330909330|gb|EGH37844.1| rossmann fold nucleotide-binding protein Smf possibly involved in
           DNA uptake [Escherichia coli AA86]
 gi|331041580|gb|EGI13724.1| protein smf [Escherichia coli M605]
          Length = 374

 Score = 64.9 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 16/78 (20%), Positives = 30/78 (38%), Gaps = 6/78 (7%)

Query: 10  FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLL 69
              +  ++ ++ +      P         +  ++ +    +D +    G   P V   LL
Sbjct: 290 LPDAPENSFYSPDQEDVALPFP------ELLANVGDEVTPVDVVAERAGQPVPEVVTQLL 343

Query: 70  ELDLAGRLCHHPEGKVSL 87
           EL+LAG +   P G V L
Sbjct: 344 ELELAGWIAAVPGGYVRL 361


>gi|293453604|ref|ZP_06664023.1| DNA processing protein [Escherichia coli B088]
 gi|291321730|gb|EFE61161.1| DNA processing protein [Escherichia coli B088]
          Length = 367

 Score = 64.9 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 17/71 (23%), Positives = 27/71 (38%), Gaps = 2/71 (2%)

Query: 19  HTKNINITHYPEYTQCERV--RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGR 76
                N  + P+          +  ++ +    +D +    G   P V   LLEL+LAG 
Sbjct: 284 PDAPENSFYSPDQQDVALPFPELLANVGDEVTPVDVVAERAGQPVPEVVTQLLELELAGW 343

Query: 77  LCHHPEGKVSL 87
           +   P G V L
Sbjct: 344 IAAVPGGYVRL 354


>gi|325267229|ref|ZP_08133892.1| DNA protecting protein DprA [Kingella denitrificans ATCC 33394]
 gi|324981290|gb|EGC16939.1| DNA protecting protein DprA [Kingella denitrificans ATCC 33394]
          Length = 397

 Score = 64.9 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 12/49 (24%), Positives = 20/49 (40%)

Query: 39  IKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           +   +   PIH D +     +    +Y  L EL+L G +   P G+   
Sbjct: 347 LLAMMGYDPIHPDLLAEKCKLATDEIYAQLTELELDGVVAAMPGGRFQR 395


>gi|237703015|ref|ZP_04533496.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA]
 gi|226902279|gb|EEH88538.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA]
 gi|315284580|gb|EFU44025.1| DNA protecting protein DprA [Escherichia coli MS 110-3]
 gi|323954592|gb|EGB50375.1| DNA protecting protein DprA [Escherichia coli H263]
          Length = 374

 Score = 64.9 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 16/78 (20%), Positives = 30/78 (38%), Gaps = 6/78 (7%)

Query: 10  FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLL 69
              +  ++ ++ +      P         +  ++ +    +D +    G   P V   LL
Sbjct: 290 LPDAPENSFYSPDQEDVALPFP------ELLANVGDEVTPVDVVAERAGQPVPEVVTQLL 343

Query: 70  ELDLAGRLCHHPEGKVSL 87
           EL+LAG +   P G V L
Sbjct: 344 ELELAGWIAAVPGGYVRL 361


>gi|168239762|ref|ZP_02664820.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|194735114|ref|YP_002116349.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|194710616|gb|ACF89837.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197287577|gb|EDY26969.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|322615054|gb|EFY11978.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315996572]
 gi|322617341|gb|EFY14242.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-1]
 gi|322625563|gb|EFY22388.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-3]
 gi|322626405|gb|EFY23214.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-4]
 gi|322632083|gb|EFY28836.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-1]
 gi|322635038|gb|EFY31761.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-2]
 gi|322643261|gb|EFY39828.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 531954]
 gi|322646655|gb|EFY43162.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Montevideo str. NC_MB110209-0054]
 gi|322650001|gb|EFY46420.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Montevideo str. OH_2009072675]
 gi|322652718|gb|EFY49058.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Montevideo str. CASC_09SCPH15965]
 gi|322659525|gb|EFY55769.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 19N]
 gi|322665533|gb|EFY61720.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 81038-01]
 gi|322670427|gb|EFY66566.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Montevideo str. MD_MDA09249507]
 gi|322670500|gb|EFY66634.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 414877]
 gi|322675076|gb|EFY71159.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 366867]
 gi|322681613|gb|EFY77642.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 413180]
 gi|322685957|gb|EFY81946.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 446600]
 gi|323195827|gb|EFZ81000.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609458-1]
 gi|323196417|gb|EFZ81568.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556150-1]
 gi|323202702|gb|EFZ87741.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609460]
 gi|323207307|gb|EFZ92257.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 507440-20]
 gi|323211257|gb|EFZ96102.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556152]
 gi|323216034|gb|EGA00765.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB101509-0077]
 gi|323223475|gb|EGA07803.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB102109-0047]
 gi|323226795|gb|EGA10985.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB110209-0055]
 gi|323231843|gb|EGA15953.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB111609-0052]
 gi|323233204|gb|EGA17299.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009083312]
 gi|323237271|gb|EGA21336.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009085258]
 gi|323245506|gb|EGA29505.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315731156]
 gi|323249012|gb|EGA32934.1| hypothetical protein SEEM9199_19300 [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2009159199]
 gi|323250635|gb|EGA34516.1| hypothetical protein SEEM8282_12355 [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008282]
 gi|323263013|gb|EGA46560.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008284]
 gi|323266013|gb|EGA49508.1| hypothetical protein SEEM8285_14309 [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008285]
 gi|323272770|gb|EGA56173.1| hypothetical protein SEEM8287_01932 [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008287]
          Length = 374

 Score = 64.9 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 17/78 (21%), Positives = 32/78 (41%), Gaps = 6/78 (7%)

Query: 10  FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLL 69
             ++  ++ ++ N +    P         +  ++ +    +D +    G   P V   LL
Sbjct: 290 LPTTAENSLYSLNQDEAALPFP------ELLANVGDEVTPVDVVAERAGQPVPAVVAQLL 343

Query: 70  ELDLAGRLCHHPEGKVSL 87
           EL+LAG +   P G V L
Sbjct: 344 ELELAGWIAAVPGGYVRL 361


>gi|197261825|ref|ZP_03161899.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|207858647|ref|YP_002245298.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|197240080|gb|EDY22700.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|206710450|emb|CAR34808.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
          Length = 374

 Score = 64.9 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 17/78 (21%), Positives = 32/78 (41%), Gaps = 6/78 (7%)

Query: 10  FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLL 69
             ++  ++ ++ N +    P         +  ++ +    +D +    G   P V   LL
Sbjct: 290 LPTTAENSLYSLNQDEAALPFP------ELLANVGDEVTPVDVVAERAGQPVPAVVAQLL 343

Query: 70  ELDLAGRLCHHPEGKVSL 87
           EL+LAG +   P G V L
Sbjct: 344 ELELAGWIAAVPGGYVRL 361


>gi|56415325|ref|YP_152400.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|197364255|ref|YP_002143892.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|56129582|gb|AAV79088.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|197095732|emb|CAR61302.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
          Length = 374

 Score = 64.9 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 17/78 (21%), Positives = 32/78 (41%), Gaps = 6/78 (7%)

Query: 10  FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLL 69
             ++  ++ ++ N +    P         +  ++ +    +D +    G   P V   LL
Sbjct: 290 LPTTAENSLYSLNQDEAALPFP------ELLANVGDEVTPVDVVAERAGQPVPAVVAQLL 343

Query: 70  ELDLAGRLCHHPEGKVSL 87
           EL+LAG +   P G V L
Sbjct: 344 ELELAGWIAAVPGGYVRL 361


>gi|168823237|ref|ZP_02835237.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|205340490|gb|EDZ27254.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|320087851|emb|CBY97614.1| Protein smf [Salmonella enterica subsp. enterica serovar
           Weltevreden str. 2007-60-3289-1]
          Length = 374

 Score = 64.9 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 17/78 (21%), Positives = 32/78 (41%), Gaps = 6/78 (7%)

Query: 10  FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLL 69
             ++  ++ ++ N +    P         +  ++ +    +D +    G   P V   LL
Sbjct: 290 LPTTAENSLYSLNQDEAALPFP------ELLANVGDEVTPVDVVAERAGQPVPAVVAQLL 343

Query: 70  ELDLAGRLCHHPEGKVSL 87
           EL+LAG +   P G V L
Sbjct: 344 ELELAGWIAAVPGGYVRL 361


>gi|167554202|ref|ZP_02347943.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|205321543|gb|EDZ09382.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
          Length = 374

 Score = 64.9 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 17/78 (21%), Positives = 32/78 (41%), Gaps = 6/78 (7%)

Query: 10  FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLL 69
             ++  ++ ++ N +    P         +  ++ +    +D +    G   P V   LL
Sbjct: 290 LPTTAENSLYSLNQDEAALPFP------ELLANVGDEVTPVDVVAERAGQPVPAVVAQLL 343

Query: 70  ELDLAGRLCHHPEGKVSL 87
           EL+LAG +   P G V L
Sbjct: 344 ELELAGWIAAVPGGYVRL 361


>gi|319764919|ref|YP_004128856.1| DNA protecting protein dpra [Alicycliphilus denitrificans BC]
 gi|317119480|gb|ADV01969.1| DNA protecting protein DprA [Alicycliphilus denitrificans BC]
          Length = 379

 Score = 64.9 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 15/70 (21%), Positives = 29/70 (41%)

Query: 18  NHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRL 77
              +    +  P         +  +L   P+ +D ++  TG+ A  + + LLEL+L G++
Sbjct: 306 PAAEQAPASDAPPPAAPAHQEVLDALGFDPLGLDALVARTGLPAATLQVRLLELELDGQV 365

Query: 78  CHHPEGKVSL 87
              P G    
Sbjct: 366 ARLPGGLFQR 375


>gi|291612478|ref|YP_003522635.1| DNA protecting protein DprA [Sideroxydans lithotrophicus ES-1]
 gi|291582590|gb|ADE10248.1| DNA protecting protein DprA [Sideroxydans lithotrophicus ES-1]
          Length = 354

 Score = 64.9 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 11/57 (19%), Positives = 23/57 (40%)

Query: 31  YTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
                   +   L   P+ +D ++  +G+    +  +LL+L+L G +   P G    
Sbjct: 296 SNNAPEHPLFMHLGFEPLDVDALMQLSGLTIAELSAILLQLELDGHIASLPGGLYQR 352


>gi|227329890|ref|ZP_03833914.1| hypothetical protein PcarcW_22156 [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
          Length = 278

 Score = 64.5 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 17/80 (21%), Positives = 30/80 (37%)

Query: 8   QNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLV 67
           +   S            I++  E  +     +  ++ +    +D +    G   P +   
Sbjct: 186 EQLVSELQWLPMQSGQTISNEEEDGELPFADVLANVGDEVTPVDVVAERAGQPVPEIVTK 245

Query: 68  LLELDLAGRLCHHPEGKVSL 87
           LLEL+LAG +   P G V L
Sbjct: 246 LLELELAGWIAAVPGGYVRL 265


>gi|62181911|ref|YP_218328.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|224585200|ref|YP_002638999.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|238913880|ref|ZP_04657717.1| hypothetical protein SentesTe_22485 [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
 gi|62129544|gb|AAX67247.1| putative protein involved in DNA uptake [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|224469728|gb|ACN47558.1| hypothetical protein SPC_3474 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|322716397|gb|EFZ07968.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. A50]
          Length = 374

 Score = 64.5 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 17/78 (21%), Positives = 32/78 (41%), Gaps = 6/78 (7%)

Query: 10  FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLL 69
             ++  ++ ++ N +    P         +  ++ +    +D +    G   P V   LL
Sbjct: 290 LPTTAENSLYSLNQDEAALPFP------ELLANVGDEVTPVDVVAERAGQPVPAVVAQLL 343

Query: 70  ELDLAGRLCHHPEGKVSL 87
           EL+LAG +   P G V L
Sbjct: 344 ELELAGWIAAVPGGYVRL 361


>gi|16766694|ref|NP_462309.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|167995180|ref|ZP_02576270.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|168245232|ref|ZP_02670164.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|194443920|ref|YP_002042657.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194450294|ref|YP_002047430.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|197251290|ref|YP_002148326.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|16421961|gb|AAL22268.1| putative protein involved in DNA uptake [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|194402583|gb|ACF62805.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194408598|gb|ACF68817.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|197214993|gb|ACH52390.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|205327101|gb|EDZ13865.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|205336013|gb|EDZ22777.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|261248562|emb|CBG26400.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267995614|gb|ACY90499.1| hypothetical protein STM14_4108 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
 gi|301159948|emb|CBW19467.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312914428|dbj|BAJ38402.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|321226457|gb|EFX51507.1| Rossmann fold nucleotide-binding protein Smf possibly involved in
           DNA uptake [Salmonella enterica subsp. enterica serovar
           Typhimurium str. TN061786]
 gi|332990257|gb|AEF09240.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Typhimurium str. UK-1]
          Length = 374

 Score = 64.5 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 17/78 (21%), Positives = 32/78 (41%), Gaps = 6/78 (7%)

Query: 10  FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLL 69
             ++  ++ ++ N +    P         +  ++ +    +D +    G   P V   LL
Sbjct: 290 LPTTAENSLYSLNQDEAALPFP------ELLANVGDEVTPVDVVAERAGQPVPAVVAQLL 343

Query: 70  ELDLAGRLCHHPEGKVSL 87
           EL+LAG +   P G V L
Sbjct: 344 ELELAGWIAAVPGGYVRL 361


>gi|168752266|ref|ZP_02777288.1| DNA protecting protein DprA [Escherichia coli O157:H7 str. EC4113]
 gi|168758513|ref|ZP_02783520.1| DNA protecting protein DprA [Escherichia coli O157:H7 str. EC4401]
 gi|168769147|ref|ZP_02794154.1| DNA protecting protein DprA [Escherichia coli O157:H7 str. EC4486]
 gi|168777857|ref|ZP_02802864.1| DNA protecting protein DprA [Escherichia coli O157:H7 str. EC4196]
 gi|168783852|ref|ZP_02808859.1| DNA protecting protein DprA [Escherichia coli O157:H7 str. EC4076]
 gi|195939833|ref|ZP_03085215.1| hypothetical protein EscherichcoliO157_26116 [Escherichia coli
           O157:H7 str. EC4024]
 gi|208808566|ref|ZP_03250903.1| DNA protecting protein DprA [Escherichia coli O157:H7 str. EC4206]
 gi|208812997|ref|ZP_03254326.1| DNA protecting protein DprA [Escherichia coli O157:H7 str. EC4045]
 gi|208818340|ref|ZP_03258660.1| DNA protecting protein DprA [Escherichia coli O157:H7 str. EC4042]
 gi|209395952|ref|YP_002272742.1| DNA protecting protein DprA [Escherichia coli O157:H7 str. EC4115]
 gi|254795222|ref|YP_003080059.1| DNA protecting protein DprA [Escherichia coli O157:H7 str. TW14359]
 gi|187766998|gb|EDU30842.1| DNA protecting protein DprA [Escherichia coli O157:H7 str. EC4196]
 gi|188013853|gb|EDU51975.1| DNA protecting protein DprA [Escherichia coli O157:H7 str. EC4113]
 gi|188998884|gb|EDU67870.1| DNA protecting protein DprA [Escherichia coli O157:H7 str. EC4076]
 gi|189354674|gb|EDU73093.1| DNA protecting protein DprA [Escherichia coli O157:H7 str. EC4401]
 gi|189361780|gb|EDU80199.1| DNA protecting protein DprA [Escherichia coli O157:H7 str. EC4486]
 gi|208728367|gb|EDZ77968.1| DNA protecting protein DprA [Escherichia coli O157:H7 str. EC4206]
 gi|208734274|gb|EDZ82961.1| DNA protecting protein DprA [Escherichia coli O157:H7 str. EC4045]
 gi|208738463|gb|EDZ86145.1| DNA protecting protein DprA [Escherichia coli O157:H7 str. EC4042]
 gi|209157352|gb|ACI34785.1| DNA protecting protein DprA [Escherichia coli O157:H7 str. EC4115]
 gi|209757372|gb|ACI76998.1| hypothetical protein ECs4151 [Escherichia coli]
 gi|209757376|gb|ACI77000.1| hypothetical protein ECs4151 [Escherichia coli]
 gi|254594622|gb|ACT73983.1| conserved protein [Escherichia coli O157:H7 str. TW14359]
 gi|326344521|gb|EGD68270.1| Rossmann fold nucleotide-binding protein Smf possibly involved in
           DNA uptake [Escherichia coli O157:H7 str. 1125]
          Length = 374

 Score = 64.5 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 16/78 (20%), Positives = 30/78 (38%), Gaps = 6/78 (7%)

Query: 10  FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLL 69
              +  ++ ++ +      P         +  ++ +    +D +    G   P V   LL
Sbjct: 290 LPDAPENSFYSPDQEDVALPFP------ELLANVGDEVTPVDVVAERAGRPVPEVVTQLL 343

Query: 70  ELDLAGRLCHHPEGKVSL 87
           EL+LAG +   P G V L
Sbjct: 344 ELELAGWIAAVPGGYVRL 361


>gi|85373787|ref|YP_457849.1| DNA processing chain A [Erythrobacter litoralis HTCC2594]
 gi|84786870|gb|ABC63052.1| DNA processing chain A [Erythrobacter litoralis HTCC2594]
          Length = 367

 Score = 64.5 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 38/78 (48%), Gaps = 1/78 (1%)

Query: 12  SSQSDTNHTKNINITHYPEYT-QCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLE 70
           S +S       +     PE   + E   +   L   P+ +D++I  +G  A  V L LLE
Sbjct: 289 SPRSSFREAAALEFDPAPEELAEAEPADVAGLLTTAPVAVDELIRQSGEPAAAVQLALLE 348

Query: 71  LDLAGRLCHHPEGKVSLT 88
           L+++G+L  H  G+VS T
Sbjct: 349 LEISGQLTRHAGGRVSRT 366


>gi|294789444|ref|ZP_06754681.1| putative DNA processing protein DprA [Simonsiella muelleri ATCC
           29453]
 gi|294482657|gb|EFG30347.1| putative DNA processing protein DprA [Simonsiella muelleri ATCC
           29453]
          Length = 421

 Score = 64.5 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 17/87 (19%), Positives = 28/87 (32%), Gaps = 2/87 (2%)

Query: 3   HPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAP 62
            P  +    +          I               +  ++ N  +H D I   T I   
Sbjct: 337 KPVNKPTPITPTLL--PVDEIVDNFVDNSVNESTKSVLNAMGNEIVHPDFIAEKTNIPTD 394

Query: 63  VVYLVLLELDLAGRLCHHPEGKVSLTM 89
            +Y +LLE +LAG +     G+   T 
Sbjct: 395 EIYAILLECELAGWVMATAGGRYQRTT 421


>gi|258517150|ref|YP_003193372.1| DNA protecting protein DprA [Desulfotomaculum acetoxidans DSM 771]
 gi|257780855|gb|ACV64749.1| DNA protecting protein DprA [Desulfotomaculum acetoxidans DSM 771]
          Length = 368

 Score = 64.5 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 10/76 (13%), Positives = 25/76 (32%)

Query: 12  SSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLEL 71
             + ++N        +           I   L+ +P  ++ +    G     +  +L  +
Sbjct: 292 ERRINSNEAHRNKRVNEIPPLSQIEKEIYDHLSPIPQSVEQLAGILGSNPSALLRILCAM 351

Query: 72  DLAGRLCHHPEGKVSL 87
           +L G++     G V  
Sbjct: 352 ELEGKIELLAGGMVRR 367


>gi|254251080|ref|ZP_04944398.1| hypothetical protein BDAG_00251 [Burkholderia dolosa AUO158]
 gi|124893689|gb|EAY67569.1| hypothetical protein BDAG_00251 [Burkholderia dolosa AUO158]
          Length = 440

 Score = 64.5 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 20/93 (21%), Positives = 38/93 (40%), Gaps = 1/93 (1%)

Query: 2   VHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEA 61
           + P   +   +     N     +    P  T  ER  +  +L   P+  + +  H+G+  
Sbjct: 339 IAPVSGEGKPAPTVSPNACAAPDAAQPPACTPSERA-VLAALGYGPVTYEWLAEHSGLSD 397

Query: 62  PVVYLVLLELDLAGRLCHHPEGKVSLTMHLPSP 94
             ++  LL L+LAGR+     G+ +     P+P
Sbjct: 398 DALHRALLALELAGRVASVAGGRFARLDAAPTP 430


>gi|168264714|ref|ZP_02686687.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|200387711|ref|ZP_03214323.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|199604809|gb|EDZ03354.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|205346865|gb|EDZ33496.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
          Length = 374

 Score = 64.5 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 17/78 (21%), Positives = 32/78 (41%), Gaps = 6/78 (7%)

Query: 10  FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLL 69
             ++  ++ ++ N +    P         +  ++ +    +D +    G   P V   LL
Sbjct: 290 LPTTAENSLYSLNQDEAALPFP------ELLANVGDEVTPVDVVAERAGQPVPAVVAQLL 343

Query: 70  ELDLAGRLCHHPEGKVSL 87
           EL+LAG +   P G V L
Sbjct: 344 ELELAGWIAAVPGGYVRL 361


>gi|329295655|ref|ZP_08252991.1| DNA protecting protein DprA [Plautia stali symbiont]
          Length = 374

 Score = 64.5 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 19/78 (24%), Positives = 35/78 (44%), Gaps = 6/78 (7%)

Query: 10  FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLL 69
             +S S+T +++  +    P  +      +  ++ +    +D +    G   PV+   LL
Sbjct: 290 LPASISETIYSQLSDDVALPFPS------VLANVGDEVTPVDVVAERAGQPVPVIAAQLL 343

Query: 70  ELDLAGRLCHHPEGKVSL 87
           EL+LAG +   P G V L
Sbjct: 344 ELELAGWIAAVPGGYVRL 361


>gi|237728620|ref|ZP_04559101.1| conserved hypothetical protein [Citrobacter sp. 30_2]
 gi|226909242|gb|EEH95160.1| conserved hypothetical protein [Citrobacter sp. 30_2]
          Length = 374

 Score = 64.5 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 16/78 (20%), Positives = 28/78 (35%), Gaps = 6/78 (7%)

Query: 10  FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLL 69
                  + ++ +      P         +  ++ +    +D +    G   P V   LL
Sbjct: 290 LPDEPEKSIYSPDHEEVALPFP------ELLANVGDEVTPVDVVAERAGQPVPEVVAQLL 343

Query: 70  ELDLAGRLCHHPEGKVSL 87
           EL+LAG +   P G V L
Sbjct: 344 ELELAGWIAVVPGGYVRL 361


>gi|149186760|ref|ZP_01865071.1| DNA processing chain A [Erythrobacter sp. SD-21]
 gi|148829668|gb|EDL48108.1| DNA processing chain A [Erythrobacter sp. SD-21]
          Length = 372

 Score = 64.5 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 26/77 (33%), Positives = 39/77 (50%)

Query: 12  SSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLEL 71
           S +S      +       E+ + E   I   L   PI +D+++  +G  A  V L LLEL
Sbjct: 295 SPRSTFREPVSHFDFEPAEFAEAEPADIASLLTTAPIAVDELVRQSGKGAAAVQLALLEL 354

Query: 72  DLAGRLCHHPEGKVSLT 88
           ++AGRL  H  G+VSL+
Sbjct: 355 EIAGRLERHAAGRVSLS 371


>gi|309703697|emb|CBJ03038.1| conserved hypothetical protein [Escherichia coli ETEC H10407]
          Length = 374

 Score = 64.5 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 16/78 (20%), Positives = 30/78 (38%), Gaps = 6/78 (7%)

Query: 10  FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLL 69
              +  ++ ++ +      P         +  ++ +    +D +    G   P V   LL
Sbjct: 290 LPDAPENSFYSPDQQDVALPFPG------LLANVGDEVTPVDVVAERAGQPVPEVVTQLL 343

Query: 70  ELDLAGRLCHHPEGKVSL 87
           EL+LAG +   P G V L
Sbjct: 344 ELELAGWIAAVPGGYVRL 361


>gi|89895301|ref|YP_518788.1| hypothetical protein DSY2555 [Desulfitobacterium hafniense Y51]
 gi|219669735|ref|YP_002460170.1| DNA protecting protein DprA [Desulfitobacterium hafniense DCB-2]
 gi|89334749|dbj|BAE84344.1| hypothetical protein [Desulfitobacterium hafniense Y51]
 gi|219539995|gb|ACL21734.1| DNA protecting protein DprA [Desulfitobacterium hafniense DCB-2]
          Length = 389

 Score = 64.5 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 29/56 (51%)

Query: 33  QCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
             E+ +I   L++VP HID I  ++ +    + L LLEL LAGR+   P     L 
Sbjct: 331 SSEQQQILNQLSDVPTHIDQITMNSEVPPEQIPLALLELQLAGRIEQLPGQLYVLA 386


>gi|159043687|ref|YP_001532481.1| DNA protecting protein DprA [Dinoroseobacter shibae DFL 12]
 gi|157911447|gb|ABV92880.1| DNA protecting protein DprA [Dinoroseobacter shibae DFL 12]
          Length = 379

 Score = 64.5 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 17/64 (26%), Positives = 29/64 (45%), Gaps = 6/64 (9%)

Query: 24  NITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEG 83
                       R R+  +L   P+  D +I   G+ A  V   L+EL+++G++   P G
Sbjct: 320 PSA------DELRGRVLATLGATPLPEDQVIRALGLPAAQVNAALVELEMSGQITRAPGG 373

Query: 84  KVSL 87
            +SL
Sbjct: 374 MLSL 377


>gi|238763700|ref|ZP_04624659.1| DNA protecting protein DprA [Yersinia kristensenii ATCC 33638]
 gi|238698002|gb|EEP90760.1| DNA protecting protein DprA [Yersinia kristensenii ATCC 33638]
          Length = 373

 Score = 64.5 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 16/68 (23%), Positives = 28/68 (41%)

Query: 20  TKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCH 79
              + I+   E  +     +  ++ +    +D +    G   P +   LLEL+LAG +  
Sbjct: 293 PDKVIISSSEEQVELPFADVLANVGDEVTPVDVVAERAGQPVPDIVSKLLELELAGWIAA 352

Query: 80  HPEGKVSL 87
            P G V L
Sbjct: 353 VPGGYVRL 360


>gi|328954307|ref|YP_004371641.1| DNA protecting protein DprA [Desulfobacca acetoxidans DSM 11109]
 gi|328454631|gb|AEB10460.1| DNA protecting protein DprA [Desulfobacca acetoxidans DSM 11109]
          Length = 366

 Score = 64.5 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 17/64 (26%), Positives = 26/64 (40%)

Query: 25  ITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGK 84
               P  +      I   L+N P+ +DD+I  +G+ A  V   L  L+L G +   P   
Sbjct: 302 EAKVPTPSARIEDPIIAHLSNAPVQLDDLIRTSGLAAGEVMSRLTLLELQGLVRELPGKF 361

Query: 85  VSLT 88
             L 
Sbjct: 362 FLLA 365


>gi|296535601|ref|ZP_06897782.1| DNA protecting protein DprA [Roseomonas cervicalis ATCC 49957]
 gi|296264117|gb|EFH10561.1| DNA protecting protein DprA [Roseomonas cervicalis ATCC 49957]
          Length = 364

 Score = 64.5 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 13/84 (15%), Positives = 32/84 (38%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVV 64
            +      +         +           E  ++   + + P+ +D+++    + A  V
Sbjct: 278 TLPSAPRRTAGAARRPAPVEAALPLASPLDEAGQLLDLIGSSPVVVDELLRRCHLSAAAV 337

Query: 65  YLVLLELDLAGRLCHHPEGKVSLT 88
             +LL+L+L GR+   P  +V  +
Sbjct: 338 QALLLDLELEGRIQALPGNRVVRS 361


>gi|254463451|ref|ZP_05076867.1| DNA protecting protein DprA [Rhodobacterales bacterium HTCC2083]
 gi|206680040|gb|EDZ44527.1| DNA protecting protein DprA [Rhodobacteraceae bacterium HTCC2083]
          Length = 356

 Score = 64.5 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 15/68 (22%), Positives = 24/68 (35%)

Query: 20  TKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCH 79
            ++         T     RI   L   PI  D ++   G     V   L  L++ G++  
Sbjct: 288 AESTKPKRSLFETSKLLQRILDQLGPSPIAEDQLLRDIGAHTSKVIPALTNLEMDGQIKR 347

Query: 80  HPEGKVSL 87
            P G +S 
Sbjct: 348 GPGGMISR 355


>gi|296445900|ref|ZP_06887851.1| DNA protecting protein DprA [Methylosinus trichosporium OB3b]
 gi|296256568|gb|EFH03644.1| DNA protecting protein DprA [Methylosinus trichosporium OB3b]
          Length = 412

 Score = 64.1 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 21/51 (41%), Positives = 28/51 (54%)

Query: 37  VRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
             +   L   P+ ID++I   G+ A  V+  LLELDLAGR+  H    VSL
Sbjct: 361 AHVVALLGPAPVTIDELIRAAGLPAREVHAALLELDLAGRVARHGANLVSL 411


>gi|241762041|ref|ZP_04760125.1| DNA protecting protein DprA [Zymomonas mobilis subsp. mobilis ATCC
           10988]
 gi|241373507|gb|EER63094.1| DNA protecting protein DprA [Zymomonas mobilis subsp. mobilis ATCC
           10988]
          Length = 385

 Score = 64.1 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 23/84 (27%), Positives = 43/84 (51%), Gaps = 3/84 (3%)

Query: 7   EQNFFSSQSDTNHTKNINITHYPEYTQ---CERVRIKQSLNNVPIHIDDIIHHTGIEAPV 63
           E++    +        I     P   +    ER  I+  + + P+ ++++I  +G+E  +
Sbjct: 300 EKSPLEPRFSGLENGQIGYRSSPAIAEVKAKEREIIQSLIGSAPVGVNELIRQSGLENAI 359

Query: 64  VYLVLLELDLAGRLCHHPEGKVSL 87
           +  +LLE++LAGRL  H  G+VSL
Sbjct: 360 IQTILLEMELAGRLESHAGGRVSL 383


>gi|163738379|ref|ZP_02145794.1| DNA processing protein DprA, putative [Phaeobacter gallaeciensis
           BS107]
 gi|161388300|gb|EDQ12654.1| DNA processing protein DprA, putative [Phaeobacter gallaeciensis
           BS107]
          Length = 355

 Score = 64.1 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 16/93 (17%), Positives = 27/93 (29%)

Query: 3   HPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAP 62
            P       +S   T              T      I   L   P   D ++    I + 
Sbjct: 254 RPVPPPEAAASARLTELPPPPKEQRSLSDTAALHQLILDRLGPAPTAEDQLVRDLAIPSR 313

Query: 63  VVYLVLLELDLAGRLCHHPEGKVSLTMHLPSPQ 95
            +   L +L+L+G +     G +      P P+
Sbjct: 314 DLAPALTDLELSGAVARAAGGLLIRGDFDPDPK 346


>gi|319785848|ref|YP_004145323.1| DNA protecting protein DprA [Pseudoxanthomonas suwonensis 11-1]
 gi|317464360|gb|ADV26092.1| DNA protecting protein DprA [Pseudoxanthomonas suwonensis 11-1]
          Length = 375

 Score = 64.1 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 13/80 (16%), Positives = 29/80 (36%)

Query: 10  FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLL 69
                       +   T        +  R+ ++L + PI +D ++  TG+    +  +LL
Sbjct: 290 LALEPDVAPEGASAGGTETAPPLSADHQRLWRALGHDPIPMDVLVERTGLTPASLSSMLL 349

Query: 70  ELDLAGRLCHHPEGKVSLTM 89
            ++L GR+          + 
Sbjct: 350 AMELDGRVVAEHGRYARRST 369


>gi|89071023|ref|ZP_01158240.1| DNA processing protein DprA, putative [Oceanicola granulosus
           HTCC2516]
 gi|89043411|gb|EAR49628.1| DNA processing protein DprA, putative [Oceanicola granulosus
           HTCC2516]
          Length = 356

 Score = 64.1 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 19/89 (21%), Positives = 31/89 (34%), Gaps = 1/89 (1%)

Query: 1   MVHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCE-RVRIKQSLNNVPIHIDDIIHHTGI 59
           ++ P   +                    P  T  E   RI + L   P+  D +I    +
Sbjct: 267 VIGPAAPEAPRQPDLPLVAPDPPPPAVRPAATMAELHRRILEKLGPSPLAEDQLIRDLAV 326

Query: 60  EAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
            A  +   L EL+L G +   P G +S +
Sbjct: 327 TATALAPALTELELDGAVTRQPGGLLSRS 355


>gi|302036384|ref|YP_003796706.1| protein SMF, putative DNA protecting protein DprA [Candidatus
           Nitrospira defluvii]
 gi|300604448|emb|CBK40780.1| Protein SMF, putative DNA protecting protein DprA [Candidatus
           Nitrospira defluvii]
          Length = 378

 Score = 64.1 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 18/88 (20%), Positives = 37/88 (42%), Gaps = 5/88 (5%)

Query: 2   VHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEA 61
           + PQ++   F ++          +    E    +   +  +L+ +P  +D++I  +G+ A
Sbjct: 291 LLPQLDP-AFRARLAEGAGT---VAQPKEPFSLDETLVYDALSVLPQPVDEVIRRSGLPA 346

Query: 62  PVVYLVLLELDLAGRLCHHPEG-KVSLT 88
             V  +LL L+L   +   P    V L 
Sbjct: 347 AQVAAILLSLELKNCIRQLPGNEYVRLA 374


>gi|238783198|ref|ZP_04627224.1| DNA protecting protein DprA [Yersinia bercovieri ATCC 43970]
 gi|238715994|gb|EEQ07980.1| DNA protecting protein DprA [Yersinia bercovieri ATCC 43970]
          Length = 373

 Score = 64.1 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 14/51 (27%), Positives = 23/51 (45%)

Query: 37  VRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
             +  ++ +    +D +    G   P +   LLEL+LAG +   P G V L
Sbjct: 310 ADVLANVGDEVTPVDVVAERAGQPVPEIVSKLLELELAGWIAAVPGGYVRL 360


>gi|237749119|ref|ZP_04579599.1| DNA processing protein [Oxalobacter formigenes OXCC13]
 gi|229380481|gb|EEO30572.1| DNA processing protein [Oxalobacter formigenes OXCC13]
          Length = 375

 Score = 64.1 bits (155), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 12/62 (19%), Positives = 24/62 (38%)

Query: 26  THYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
               +    E+  I   +   P+  D +     ++A  + + LL L+L+G +   P G  
Sbjct: 310 ERAEDEFSDEQKLILAQMGYDPVDADILSERCDMDAASLSVELLNLELSGNVESLPGGFY 369

Query: 86  SL 87
             
Sbjct: 370 RR 371


>gi|332525406|ref|ZP_08401566.1| putative SMF protein [Rubrivivax benzoatilyticus JA2]
 gi|332108675|gb|EGJ09899.1| putative SMF protein [Rubrivivax benzoatilyticus JA2]
          Length = 365

 Score = 64.1 bits (155), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 15/70 (21%), Positives = 26/70 (37%)

Query: 20  TKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCH 79
           T+                 +  +L + P  +D ++  TG     +   LLEL+L G+L  
Sbjct: 294 TRPAAALSAVPDADTPADPVLAALGHEPATLDALLARTGWPTAELSARLLELELDGQLAR 353

Query: 80  HPEGKVSLTM 89
            P G     +
Sbjct: 354 LPGGLFQRRV 363


>gi|251788005|ref|YP_003002726.1| DNA protecting protein DprA [Dickeya zeae Ech1591]
 gi|247536626|gb|ACT05247.1| DNA protecting protein DprA [Dickeya zeae Ech1591]
          Length = 377

 Score = 64.1 bits (155), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 13/51 (25%), Positives = 23/51 (45%)

Query: 37  VRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
             +  ++ +    +D +    G   P V   LL+L+LAG +   P G V +
Sbjct: 314 ADVLATVGDEVTPVDVVAERAGQPVPEVVSKLLDLELAGWIAAVPGGYVRI 364


>gi|298372209|ref|ZP_06982199.1| DNA processing protein DprA [Bacteroidetes oral taxon 274 str.
           F0058]
 gi|298275113|gb|EFI16664.1| DNA processing protein DprA [Bacteroidetes oral taxon 274 str.
           F0058]
          Length = 363

 Score = 64.1 bits (155), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 13/78 (16%), Positives = 26/78 (33%)

Query: 9   NFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVL 68
           + F S   ++  +      +PE    E   I   L   P  ++++     I    +   L
Sbjct: 285 DIFLSMGWSHSCQKPQTELFPEELTAEEGDIVAILRKKPTEVNELSRMVDIPIQKLISTL 344

Query: 69  LELDLAGRLCHHPEGKVS 86
           + L+  G +   P     
Sbjct: 345 ILLEFKGVVKALPGNIYK 362


>gi|322420083|ref|YP_004199306.1| DNA protecting protein DprA [Geobacter sp. M18]
 gi|320126470|gb|ADW14030.1| DNA protecting protein DprA [Geobacter sp. M18]
          Length = 359

 Score = 64.1 bits (155), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 16/80 (20%), Positives = 28/80 (35%)

Query: 8   QNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLV 67
           ++     S      +            +   +   L    + IDDII  + + A  V   
Sbjct: 279 EDILEELSIEPLATHPLQKPPCFPLTPQEAELYALLCQGVLQIDDIIVQSALTAGEVSAT 338

Query: 68  LLELDLAGRLCHHPEGKVSL 87
           LL L+L G +   P  + S+
Sbjct: 339 LLRLELKGIVTQLPGKRFSV 358


>gi|323136208|ref|ZP_08071290.1| DNA protecting protein DprA [Methylocystis sp. ATCC 49242]
 gi|322398282|gb|EFY00802.1| DNA protecting protein DprA [Methylocystis sp. ATCC 49242]
          Length = 424

 Score = 63.7 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 26/88 (29%), Positives = 38/88 (43%), Gaps = 7/88 (7%)

Query: 7   EQNFFSSQSDTNHTKNINITHYPEYTQCERVRI-------KQSLNNVPIHIDDIIHHTGI 59
           E+   S        +    T  P+ +     R+          L   P+ +D++I   G+
Sbjct: 331 EEGPPSPLFAAPEPELGPETASPDPSAPVHGRVADPHEVVLSLLGPSPVAVDELIRIAGL 390

Query: 60  EAPVVYLVLLELDLAGRLCHHPEGKVSL 87
            A  V+ VL+ELDLAGRL  H    VSL
Sbjct: 391 PARDVHGVLVELDLAGRLERHGTNAVSL 418


>gi|56552090|ref|YP_162929.1| DNA protecting protein DprA [Zymomonas mobilis subsp. mobilis ZM4]
 gi|56543664|gb|AAV89818.1| DNA protecting protein DprA [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 385

 Score = 63.7 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 22/84 (26%), Positives = 43/84 (51%), Gaps = 3/84 (3%)

Query: 7   EQNFFSSQSDTNHTKNINITHYPEYTQ---CERVRIKQSLNNVPIHIDDIIHHTGIEAPV 63
           E++    +        I     P   +    +R  I+  + + P+ ++++I  +G+E  +
Sbjct: 300 EKSPLEPRFSGLENGQIGYRSSPAIAEVKAKDREIIQSLIGSAPVGVNELIRQSGLENAI 359

Query: 64  VYLVLLELDLAGRLCHHPEGKVSL 87
           +  +LLE++LAGRL  H  G+VSL
Sbjct: 360 IQTILLEMELAGRLESHAGGRVSL 383


>gi|331684928|ref|ZP_08385514.1| protein smf [Escherichia coli H299]
 gi|331077299|gb|EGI48511.1| protein smf [Escherichia coli H299]
          Length = 374

 Score = 63.7 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 16/75 (21%), Positives = 30/75 (40%), Gaps = 6/75 (8%)

Query: 13  SQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELD 72
           +  ++ ++ +      P         +  ++ +    +D +    G   P V   LLEL+
Sbjct: 293 APENSFYSPDQEDVALPFP------ELLANVGDEVTPVDVVAERAGQPVPEVVTQLLELE 346

Query: 73  LAGRLCHHPEGKVSL 87
           LAG +   P G V L
Sbjct: 347 LAGWIAAVPGGYVRL 361


>gi|167834977|ref|ZP_02461860.1| DNA protecting protein DprA [Burkholderia thailandensis MSMB43]
          Length = 396

 Score = 63.7 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 14/83 (16%), Positives = 32/83 (38%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVV 64
             E  F  ++                    +  R+  ++   P+ ++ +   T + +  +
Sbjct: 292 LEEFGFDPARPAGATRGAPAAAEADVDPDDDARRLLAAIGYGPVPLELLAQRTALSSGAL 351

Query: 65  YLVLLELDLAGRLCHHPEGKVSL 87
           +  LL+L+LAGR+   P G+   
Sbjct: 352 HRRLLQLELAGRIAALPGGRYMR 374


>gi|113869637|ref|YP_728126.1| Smf protein [Ralstonia eutropha H16]
 gi|113528413|emb|CAJ94758.1| Smf protein [Ralstonia eutropha H16]
          Length = 399

 Score = 63.7 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 13/66 (19%), Positives = 22/66 (33%)

Query: 22  NINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHP 81
           ++               +  +L   P+ +D +   +G     V   LLEL+LAG     P
Sbjct: 332 SVPEQPDLSDFAGHADPLLAALGYDPVTLDALCERSGQPPEAVAARLLELELAGHAERLP 391

Query: 82  EGKVSL 87
                 
Sbjct: 392 GNVFRR 397


>gi|332967865|gb|EGK06961.1| SMF-family protein [Kingella kingae ATCC 23330]
          Length = 401

 Score = 63.7 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 16/73 (21%), Positives = 27/73 (36%), Gaps = 4/73 (5%)

Query: 19  HTKNINITHYPEYTQCERVR----IKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLA 74
               I+  + PE            +  ++   PIH D +  +  + A  VY  L EL+L 
Sbjct: 327 PIAQISEVNEPETPSSLHENSDNVLLNAMGFSPIHPDLLAENLNLPAVDVYAELTELELD 386

Query: 75  GRLCHHPEGKVSL 87
           G +     G+   
Sbjct: 387 GWIVSMAGGRFQR 399


>gi|332884289|gb|EGK04557.1| hypothetical protein HMPREF9456_00884 [Dysgonomonas mossii DSM
           22836]
          Length = 373

 Score = 63.7 bits (154), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 15/84 (17%), Positives = 30/84 (35%), Gaps = 5/84 (5%)

Query: 10  FFSSQSDTNHTKNINITHYPEYT----QCERVRIKQSLNN-VPIHIDDIIHHTGIEAPVV 64
           F       N +         +        +   I   L+    IHID +    G+ A  +
Sbjct: 290 FLQQMGWDNESPKKKKAPIQQSLFTILTDDEQTIVNKLSEKESIHIDQLARELGVPAYSL 349

Query: 65  YLVLLELDLAGRLCHHPEGKVSLT 88
           +  LLE+++ G +   P    +++
Sbjct: 350 FSTLLEMEMKGMIRTLPGNLYTIS 373


>gi|332991531|gb|AEF01586.1| DNA protecting protein DprA [Alteromonas sp. SN2]
          Length = 385

 Score = 63.7 bits (154), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 15/79 (18%), Positives = 27/79 (34%)

Query: 9   NFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVL 68
           +     +     +N  ++   E       ++  S++     ID I          V   L
Sbjct: 304 DEIVVSTGERECQNEALSKKSEVNNLATDKLLDSVDYDITAIDVIAQRCTSPVNEVMASL 363

Query: 69  LELDLAGRLCHHPEGKVSL 87
           LE +L G +   P G + L
Sbjct: 364 LEYELRGLVAAVPGGYIKL 382


>gi|225025550|ref|ZP_03714742.1| hypothetical protein EIKCOROL_02450 [Eikenella corrodens ATCC
           23834]
 gi|224941696|gb|EEG22905.1| hypothetical protein EIKCOROL_02450 [Eikenella corrodens ATCC
           23834]
          Length = 430

 Score = 63.7 bits (154), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 13/76 (17%), Positives = 27/76 (35%)

Query: 12  SSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLEL 71
                    +   +   P  T+ E   + Q++    +H D +     + A  VY  L  L
Sbjct: 347 RQAESLPSEQPALVDATPASTETETSPLLQAMGYDAVHPDSLAERLKLPAADVYAELTLL 406

Query: 72  DLAGRLCHHPEGKVSL 87
           ++ G++     G+   
Sbjct: 407 EINGQIAPLSGGRYQR 422


>gi|238792970|ref|ZP_04636600.1| DNA protecting protein DprA [Yersinia intermedia ATCC 29909]
 gi|238727824|gb|EEQ19348.1| DNA protecting protein DprA [Yersinia intermedia ATCC 29909]
          Length = 373

 Score = 63.7 bits (154), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 14/51 (27%), Positives = 23/51 (45%)

Query: 37  VRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
             +  ++ +    +D +    G   P +   LLEL+LAG +   P G V L
Sbjct: 310 ADVLANVGDEVTPVDVVAERAGQPVPDIVSKLLELELAGWIAAVPGGYVRL 360


>gi|161506041|ref|YP_001573153.1| DNA protecting protein DprA [Salmonella enterica subsp. arizonae
           serovar 62:z4,z23:-- str. RSK2980]
 gi|160867388|gb|ABX24011.1| hypothetical protein SARI_04222 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 364

 Score = 63.7 bits (154), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 15/50 (30%), Positives = 23/50 (46%)

Query: 38  RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
            +  ++ +    +D +    G   P V   LLEL+LAG +   P G V L
Sbjct: 302 ELLANVGDEVTPVDVVAERAGQPVPAVVAQLLELELAGWIAAVPGGYVRL 351


>gi|284006130|emb|CBA71371.1| DNA processing protein [Arsenophonus nasoniae]
          Length = 376

 Score = 63.7 bits (154), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 14/49 (28%), Positives = 23/49 (46%)

Query: 39  IKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           I + +N  P  ID I   +G+    V   LLE +L G++     G + +
Sbjct: 327 ILRYINFEPTPIDLIAERSGLSVIEVSAQLLEFELMGKVIFVSGGYIRV 375


>gi|83950056|ref|ZP_00958789.1| DNA processing protein DprA, putative [Roseovarius nubinhibens ISM]
 gi|83837955|gb|EAP77251.1| DNA processing protein DprA, putative [Roseovarius nubinhibens ISM]
          Length = 362

 Score = 63.7 bits (154), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 17/73 (23%), Positives = 27/73 (36%)

Query: 16  DTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAG 75
             +             T     +I   L   P+  D +I   G+ A  V   L++L+LAG
Sbjct: 289 APDIPAAPPEKRSLRDTAQLHSQILNRLGPSPLPEDQLIRDMGLGANAVAPALVDLELAG 348

Query: 76  RLCHHPEGKVSLT 88
           R+     G +S  
Sbjct: 349 RIQRQAGGLLSRN 361


>gi|148256077|ref|YP_001240662.1| DNA processing chain A (DprA/Smf) [Bradyrhizobium sp. BTAi1]
 gi|146408250|gb|ABQ36756.1| DNA processing chain A (DprA/Smf) [Bradyrhizobium sp. BTAi1]
          Length = 372

 Score = 63.7 bits (154), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 26/80 (32%), Positives = 38/80 (47%)

Query: 9   NFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVL 68
                    +  ++      P     +R +I   L   P+ IDD+I  +G+   V+ +VL
Sbjct: 293 PIMERPPSASLRESDEELFAPAPESHDRDQIIALLGPTPVSIDDLIRISGLSPAVLRVVL 352

Query: 69  LELDLAGRLCHHPEGKVSLT 88
           LEL+LAGRL  H  G VSL 
Sbjct: 353 LELELAGRLERHGGGMVSLA 372


>gi|150003815|ref|YP_001298559.1| putative DNA processing Smf-like protein [Bacteroides vulgatus ATCC
           8482]
 gi|149932239|gb|ABR38937.1| putative DNA processing Smf-like protein [Bacteroides vulgatus ATCC
           8482]
          Length = 371

 Score = 63.7 bits (154), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 15/89 (16%), Positives = 30/89 (33%), Gaps = 4/89 (4%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYP--EYTQCERVRIKQSLN--NVPIHIDDIIHHTGIE 60
              ++   +    +  K               E  RI + L   +  + I+ ++  T I 
Sbjct: 283 TSAEDLVKAMGWESSPKTEKTVQRELFPDLSEEEERIVKRLGKMSEGLQINTLVIDTNIP 342

Query: 61  APVVYLVLLELDLAGRLCHHPEGKVSLTM 89
              +  +L EL++ G +     G   L M
Sbjct: 343 VNRMSALLFELEMKGVIRALAGGVYRLIM 371


>gi|4511994|gb|AAD21554.1| DNA processing chain A [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 385

 Score = 63.7 bits (154), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 19/53 (35%), Positives = 36/53 (67%)

Query: 35  ERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           +R  I+  + + P+ ++++I  +G+E  ++  +LLE++LAGRL  H  G+VSL
Sbjct: 331 DREIIQSLIGSGPVGVNELIRQSGLENAIIQTILLEMELAGRLESHAGGRVSL 383


>gi|238797210|ref|ZP_04640711.1| DNA protecting protein DprA [Yersinia mollaretii ATCC 43969]
 gi|238718847|gb|EEQ10662.1| DNA protecting protein DprA [Yersinia mollaretii ATCC 43969]
          Length = 373

 Score = 63.3 bits (153), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 14/51 (27%), Positives = 23/51 (45%)

Query: 37  VRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
             +  ++ +    +D +    G   P +   LLEL+LAG +   P G V L
Sbjct: 310 ADVLANVGDEVTPVDVVAERAGQPVPDIVSKLLELELAGWIAAVPGGYVRL 360


>gi|300718671|ref|YP_003743474.1| DNA protecting protein [Erwinia billingiae Eb661]
 gi|299064507|emb|CAX61627.1| DNA protecting protein [Erwinia billingiae Eb661]
          Length = 374

 Score = 63.3 bits (153), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 14/51 (27%), Positives = 23/51 (45%)

Query: 37  VRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
             +  ++ +    +D +    G   P +   LLEL+LAG +   P G V L
Sbjct: 311 ADVLANVGDEVTPVDVVAERAGQPVPTIVAKLLELELAGWIAAVPGGYVRL 361


>gi|323256863|gb|EGA40577.1| hypothetical protein SEEM8283_16851 [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008283]
          Length = 127

 Score = 63.3 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 17/78 (21%), Positives = 32/78 (41%), Gaps = 6/78 (7%)

Query: 10  FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLL 69
             ++  ++ ++ N +    P         +  ++ +    +D +    G   P V   LL
Sbjct: 43  LPTTAENSLYSLNQDEAALPFP------ELLANVGDEVTPVDVVAERAGQPVPAVVAQLL 96

Query: 70  ELDLAGRLCHHPEGKVSL 87
           EL+LAG +   P G V L
Sbjct: 97  ELELAGWIAAVPGGYVRL 114


>gi|242237893|ref|YP_002986074.1| DNA protecting protein DprA [Dickeya dadantii Ech703]
 gi|242129950|gb|ACS84252.1| DNA protecting protein DprA [Dickeya dadantii Ech703]
          Length = 377

 Score = 63.3 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 13/60 (21%), Positives = 24/60 (40%)

Query: 28  YPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
                +     +  ++ +    +D +    G   P V   LL+L+LAG +   P G V +
Sbjct: 305 PEAELELPFADVLANVGDEVTPVDVVAERAGQPVPEVVSKLLDLELAGWIAAVPGGYVRI 364


>gi|261342755|ref|ZP_05970613.1| DNA protecting protein DprA [Enterobacter cancerogenus ATCC 35316]
 gi|288314934|gb|EFC53872.1| DNA protecting protein DprA [Enterobacter cancerogenus ATCC 35316]
          Length = 374

 Score = 63.3 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 16/78 (20%), Positives = 29/78 (37%), Gaps = 6/78 (7%)

Query: 10  FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLL 69
                   +++ +      P        ++  ++ +    +D +    G   PV    LL
Sbjct: 290 LPEEPEKRHNSSDQQAVALPFP------KLLANVGDEVTPVDVVAERAGQPVPVTVAQLL 343

Query: 70  ELDLAGRLCHHPEGKVSL 87
           EL+LAG +   P G V L
Sbjct: 344 ELELAGWIAAVPGGYVRL 361


>gi|170079101|ref|YP_001735739.1| DNA protecting protein [Synechococcus sp. PCC 7002]
 gi|169886770|gb|ACB00484.1| DNA protecting protein [Synechococcus sp. PCC 7002]
          Length = 381

 Score = 63.3 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 16/85 (18%), Positives = 32/85 (37%), Gaps = 4/85 (4%)

Query: 3   HPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAP 62
            PQ+  +F     +     + +          E + + Q++   P   D I+  +G+ A 
Sbjct: 300 SPQLSLSFPEPAVEPTPQPSTDFR----QISPELLPLWQAIAPEPTAFDLIVVQSGMGAD 355

Query: 63  VVYLVLLELDLAGRLCHHPEGKVSL 87
            V   LL+ +L G +   P  +   
Sbjct: 356 QVSATLLQWELEGFITQLPGMRYRR 380


>gi|110679407|ref|YP_682414.1| DNA processing protein DprA, putative [Roseobacter denitrificans
           OCh 114]
 gi|109455523|gb|ABG31728.1| DNA processing protein DprA, putative [Roseobacter denitrificans
           OCh 114]
          Length = 389

 Score = 63.3 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 15/86 (17%), Positives = 31/86 (36%)

Query: 3   HPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAP 62
            P++     ++       +   I    +       +I   L+  P+  D +I    + A 
Sbjct: 304 APELPLPASATARPKETARPTKIKTTLKQAAALHRQILSKLSPAPVPEDQLIRDLAVSAS 363

Query: 63  VVYLVLLELDLAGRLCHHPEGKVSLT 88
                LL+L+L G++     G +S  
Sbjct: 364 EAAPALLDLELDGQIKREAGGMLSRA 389


>gi|91205528|ref|YP_537883.1| putative DNA processing protein DprA [Rickettsia bellii RML369-C]
 gi|91069072|gb|ABE04794.1| Putative DNA processing protein DprA [Rickettsia bellii RML369-C]
          Length = 225

 Score = 63.3 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 24/67 (35%), Positives = 39/67 (58%)

Query: 21  KNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHH 80
           K +N     E ++ ER  + + L+ VPI  D +   T +  P++Y ++LEL+LAG+   H
Sbjct: 153 KRLNTIQVKEPSEKERAAVIELLSAVPIDFDYLQKMTELPLPIIYTIILELELAGKAMRH 212

Query: 81  PEGKVSL 87
           P  K+SL
Sbjct: 213 PSNKISL 219


>gi|58039717|ref|YP_191681.1| DNA processing chain A [Gluconobacter oxydans 621H]
 gi|58002131|gb|AAW61025.1| DNA processing chain A [Gluconobacter oxydans 621H]
          Length = 394

 Score = 63.3 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 15/82 (18%), Positives = 30/82 (36%)

Query: 6   IEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVY 65
                 +  S+ +       +         +  +   L+  P+ +DD++         V 
Sbjct: 310 AHSPPLTGFSEPSTPWGSPTSEDWVEPDLAQKTVCSLLSVTPVAVDDVVRRCQFSVSAVL 369

Query: 66  LVLLELDLAGRLCHHPEGKVSL 87
             L EL+L G +   P G+V+L
Sbjct: 370 ATLAELELGGVVEFVPGGRVAL 391


>gi|300692921|ref|YP_003753916.1| smf, DNA processing chain A (drpA) [Ralstonia solanacearum PSI07]
 gi|299079981|emb|CBJ52658.1| putative smf, DNA processing chain A (drpA) [Ralstonia solanacearum
           PSI07]
          Length = 401

 Score = 63.3 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 14/47 (29%), Positives = 24/47 (51%)

Query: 39  IKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
           +  +L   P+ +D +   TG  A ++   LL L+L GR+   P G+ 
Sbjct: 351 LLDALGFDPVDLDTLCERTGQTAAILSAQLLALELGGRIERQPGGRF 397


>gi|146313351|ref|YP_001178425.1| DNA protecting protein DprA [Enterobacter sp. 638]
 gi|145320227|gb|ABP62374.1| DNA protecting protein DprA [Enterobacter sp. 638]
          Length = 374

 Score = 63.3 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 17/78 (21%), Positives = 29/78 (37%), Gaps = 6/78 (7%)

Query: 10  FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLL 69
             S+     ++ +      P         +  ++ +    +D +    G   PV    LL
Sbjct: 290 IPSAPEMVLYSSDQEEVALPFP------ELLANVGDEVTPVDVVAERAGQSVPVTVAQLL 343

Query: 70  ELDLAGRLCHHPEGKVSL 87
           EL+LAG +   P G V L
Sbjct: 344 ELELAGWIAAVPGGYVRL 361


>gi|95929065|ref|ZP_01311810.1| DNA processing protein DprA, putative [Desulfuromonas acetoxidans
           DSM 684]
 gi|95134966|gb|EAT16620.1| DNA processing protein DprA, putative [Desulfuromonas acetoxidans
           DSM 684]
          Length = 363

 Score = 63.3 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 12/66 (18%), Positives = 22/66 (33%)

Query: 23  INITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPE 82
                        +  + + L   P H+D +   +G+    V  ++L L+L G     P 
Sbjct: 295 EENEPTVPPLSNSQDMVLRKLGKTPRHLDKLATESGLTPMEVSAIVLHLELLGLAQSLPG 354

Query: 83  GKVSLT 88
           G     
Sbjct: 355 GHYIRA 360


>gi|118578968|ref|YP_900218.1| DNA protecting protein DprA [Pelobacter propionicus DSM 2379]
 gi|118501678|gb|ABK98160.1| DNA protecting protein DprA [Pelobacter propionicus DSM 2379]
          Length = 371

 Score = 63.3 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 19/71 (26%), Positives = 30/71 (42%), Gaps = 4/71 (5%)

Query: 20  TKNINITHYPEY----TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAG 75
             +  ++  PE            + + L   P+HIDDII  T + A  V  +LL L+L G
Sbjct: 297 VPSGAVSPPPEPRVFALTPREAGVYELLARGPLHIDDIIVQTELTAAEVSSMLLHLELKG 356

Query: 76  RLCHHPEGKVS 86
            +   P    +
Sbjct: 357 AVTPLPGAHYA 367


>gi|332163226|ref|YP_004299803.1| DNA protecting protein DprA [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|325667456|gb|ADZ44100.1| DNA protecting protein DprA [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
          Length = 373

 Score = 63.3 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 16/68 (23%), Positives = 29/68 (42%)

Query: 20  TKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCH 79
            + + I+   E  +     +  ++ +    +D +    G   P +   LLEL+LAG +  
Sbjct: 293 PEKVIISSSEEQVELPFADVLANVGDEVTPVDVVAERAGQPVPDIVSKLLELELAGWIAA 352

Query: 80  HPEGKVSL 87
            P G V L
Sbjct: 353 VPGGYVRL 360


>gi|258541849|ref|YP_003187282.1| DNA processing chain A SMF [Acetobacter pasteurianus IFO 3283-01]
 gi|256632927|dbj|BAH98902.1| DNA processing chain A SMF [Acetobacter pasteurianus IFO 3283-01]
 gi|256635984|dbj|BAI01953.1| DNA processing chain A SMF [Acetobacter pasteurianus IFO 3283-03]
 gi|256639039|dbj|BAI05001.1| DNA processing chain A SMF [Acetobacter pasteurianus IFO 3283-07]
 gi|256642093|dbj|BAI08048.1| DNA processing chain A SMF [Acetobacter pasteurianus IFO 3283-22]
 gi|256645148|dbj|BAI11096.1| DNA processing chain A SMF [Acetobacter pasteurianus IFO 3283-26]
 gi|256648203|dbj|BAI14144.1| DNA processing chain A SMF [Acetobacter pasteurianus IFO 3283-32]
 gi|256651256|dbj|BAI17190.1| DNA processing chain A SMF [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256654247|dbj|BAI20174.1| DNA processing chain A SMF [Acetobacter pasteurianus IFO 3283-12]
          Length = 214

 Score = 63.3 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 22/88 (25%), Positives = 33/88 (37%), Gaps = 2/88 (2%)

Query: 3   HPQIEQNFFSSQS--DTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIE 60
            P     F S Q+  +                Q  R  +   L+  PI +DD+I      
Sbjct: 119 EPPERAFFASPQNVDEKEPIALKPHFSAASTAQDVRENLLSLLSFTPIAVDDLIRRCQFS 178

Query: 61  APVVYLVLLELDLAGRLCHHPEGKVSLT 88
           A  V + L EL+L+G +  +  G V L 
Sbjct: 179 ASAVLVALTELELSGCVSTYSGGMVGLA 206


>gi|22127894|ref|NP_671317.1| DNA protecting protein DprA [Yersinia pestis KIM 10]
 gi|45440101|ref|NP_991640.1| DNA protecting protein DprA [Yersinia pestis biovar Microtus str.
           91001]
 gi|108809221|ref|YP_653137.1| DNA protecting protein DprA [Yersinia pestis Antiqua]
 gi|108813986|ref|YP_649753.1| DNA protecting protein DprA [Yersinia pestis Nepal516]
 gi|145597484|ref|YP_001161559.1| DNA protecting protein DprA [Yersinia pestis Pestoides F]
 gi|150260709|ref|ZP_01917437.1| hypothetical protein YPE_3025 [Yersinia pestis CA88-4125]
 gi|153950674|ref|YP_001402829.1| DNA protecting protein DprA [Yersinia pseudotuberculosis IP 31758]
 gi|165927839|ref|ZP_02223671.1| DNA protecting protein DprA [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165936410|ref|ZP_02224978.1| DNA protecting protein DprA [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|166010455|ref|ZP_02231353.1| DNA protecting protein DprA [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166213168|ref|ZP_02239203.1| DNA protecting protein DprA [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167399527|ref|ZP_02305051.1| DNA protecting protein DprA [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167418705|ref|ZP_02310458.1| DNA protecting protein DprA [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167425608|ref|ZP_02317361.1| DNA protecting protein DprA [Yersinia pestis biovar Mediaevalis
           str. K1973002]
 gi|167468247|ref|ZP_02332951.1| DNA protecting protein DprA [Yersinia pestis FV-1]
 gi|218927449|ref|YP_002345324.1| DNA protecting protein DprA [Yersinia pestis CO92]
 gi|229836275|ref|ZP_04456442.1| Rossmann fold nucleotide-binding protein Smf possibly involved in
           DNA uptake [Yersinia pestis Pestoides A]
 gi|229840101|ref|ZP_04460260.1| Rossmann fold nucleotide-binding protein Smf possibly involved in
           DNA uptake [Yersinia pestis biovar Orientalis str.
           PEXU2]
 gi|229842183|ref|ZP_04462338.1| Rossmann fold nucleotide-binding protein Smf possibly involved in
           DNA uptake [Yersinia pestis biovar Orientalis str. India
           195]
 gi|229904517|ref|ZP_04519628.1| Rossmann fold nucleotide-binding protein Smf possibly involved in
           DNA uptake [Yersinia pestis Nepal516]
 gi|270488265|ref|ZP_06205339.1| DNA protecting protein DprA [Yersinia pestis KIM D27]
 gi|294502317|ref|YP_003566379.1| hypothetical protein YPZ3_0207 [Yersinia pestis Z176003]
 gi|21961031|gb|AAM87568.1|AE014004_6 hypothetical protein y4024 [Yersinia pestis KIM 10]
 gi|45434956|gb|AAS60517.1| Predicted Rossmann fold nucleotide-binding protein involved in DNA
           uptake [Yersinia pestis biovar Microtus str. 91001]
 gi|108777634|gb|ABG20153.1| hypothetical protein YPN_3826 [Yersinia pestis Nepal516]
 gi|108781134|gb|ABG15192.1| hypothetical protein YPA_3230 [Yersinia pestis Antiqua]
 gi|115346060|emb|CAL18926.1| conserved hypothetical protein [Yersinia pestis CO92]
 gi|145209180|gb|ABP38587.1| hypothetical protein YPDSF_0165 [Yersinia pestis Pestoides F]
 gi|149290117|gb|EDM40194.1| hypothetical protein YPE_3025 [Yersinia pestis CA88-4125]
 gi|152962169|gb|ABS49630.1| DNA protecting protein DprA [Yersinia pseudotuberculosis IP 31758]
 gi|165915526|gb|EDR34135.1| DNA protecting protein DprA [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|165920115|gb|EDR37416.1| DNA protecting protein DprA [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165990545|gb|EDR42846.1| DNA protecting protein DprA [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166205466|gb|EDR49946.1| DNA protecting protein DprA [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166962699|gb|EDR58720.1| DNA protecting protein DprA [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167052031|gb|EDR63439.1| DNA protecting protein DprA [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167055298|gb|EDR65092.1| DNA protecting protein DprA [Yersinia pestis biovar Mediaevalis
           str. K1973002]
 gi|229678635|gb|EEO74740.1| Rossmann fold nucleotide-binding protein Smf possibly involved in
           DNA uptake [Yersinia pestis Nepal516]
 gi|229690493|gb|EEO82547.1| Rossmann fold nucleotide-binding protein Smf possibly involved in
           DNA uptake [Yersinia pestis biovar Orientalis str. India
           195]
 gi|229696467|gb|EEO86514.1| Rossmann fold nucleotide-binding protein Smf possibly involved in
           DNA uptake [Yersinia pestis biovar Orientalis str.
           PEXU2]
 gi|229706343|gb|EEO92350.1| Rossmann fold nucleotide-binding protein Smf possibly involved in
           DNA uptake [Yersinia pestis Pestoides A]
 gi|262360397|gb|ACY57118.1| hypothetical protein YPD4_0209 [Yersinia pestis D106004]
 gi|262364347|gb|ACY60904.1| hypothetical protein YPD8_0214 [Yersinia pestis D182038]
 gi|270336769|gb|EFA47546.1| DNA protecting protein DprA [Yersinia pestis KIM D27]
 gi|294352776|gb|ADE63117.1| hypothetical protein YPZ3_0207 [Yersinia pestis Z176003]
 gi|320013376|gb|ADV96947.1| Rossmann fold nucleotide-binding protein Smfpossibly involved in
           DNA uptake [Yersinia pestis biovar Medievalis str.
           Harbin 35]
          Length = 373

 Score = 63.3 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 14/68 (20%), Positives = 28/68 (41%)

Query: 20  TKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCH 79
            + + I+   E  +     +  ++ +    +D +    G     +   LLEL+LAG +  
Sbjct: 293 PEEVIISSPQEQVELPFADVLANVGDEVTPVDVVAERAGQPVQDIASKLLELELAGWIAA 352

Query: 80  HPEGKVSL 87
            P G V +
Sbjct: 353 VPGGYVRI 360


>gi|330861817|emb|CBX71989.1| protein smf [Yersinia enterocolitica W22703]
          Length = 367

 Score = 63.3 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 16/68 (23%), Positives = 29/68 (42%)

Query: 20  TKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCH 79
            + + I+   E  +     +  ++ +    +D +    G   P +   LLEL+LAG +  
Sbjct: 287 PEKVIISSSEEQVELPFADVLANVGDEVTPVDVVAERAGQPVPDIVSKLLELELAGWIAA 346

Query: 80  HPEGKVSL 87
            P G V L
Sbjct: 347 VPGGYVRL 354


>gi|161526294|ref|YP_001581306.1| DNA protecting protein DprA [Burkholderia multivorans ATCC 17616]
 gi|189348992|ref|YP_001944620.1| DNA processing protein [Burkholderia multivorans ATCC 17616]
 gi|160343723|gb|ABX16809.1| DNA protecting protein DprA [Burkholderia multivorans ATCC 17616]
 gi|189333014|dbj|BAG42084.1| DNA processing protein [Burkholderia multivorans ATCC 17616]
          Length = 425

 Score = 63.3 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 13/64 (20%), Positives = 25/64 (39%)

Query: 31  YTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMH 90
                   +  +L   P+  + +    G+    ++  LL L+LAGR+     G+      
Sbjct: 352 PACPAEQAVLTALGYGPVTYEWLAERCGLPDDTLHRALLALELAGRVAPLAGGRYGRLDG 411

Query: 91  LPSP 94
            P+P
Sbjct: 412 PPNP 415


>gi|39997645|ref|NP_953596.1| DNA processing protein DprA [Geobacter sulfurreducens PCA]
 gi|39984537|gb|AAR35923.1| DNA processing protein DprA [Geobacter sulfurreducens PCA]
 gi|298506585|gb|ADI85308.1| DNA uptake/processing protein SMF [Geobacter sulfurreducens KN400]
          Length = 356

 Score = 63.3 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 13/50 (26%), Positives = 21/50 (42%)

Query: 36  RVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
              +       P+HID+II  + +    V  +LL L+L G +   P    
Sbjct: 304 EAALMAMFGADPLHIDEIIAKSALTVGEVSAMLLRLELKGVVTQLPGKFF 353


>gi|318607708|emb|CBY29206.1| rossmann fold nucleotide-binding protein Smf possibly involved in
           DNA uptake [Yersinia enterocolitica subsp. palearctica
           Y11]
          Length = 373

 Score = 63.3 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 16/68 (23%), Positives = 29/68 (42%)

Query: 20  TKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCH 79
            + + I+   E  +     +  ++ +    +D +    G   P +   LLEL+LAG +  
Sbjct: 293 PEKVIISSSEEQVELPFADVLANVGDEVTPVDVVAERAGQPVPDIVSKLLELELAGWIAA 352

Query: 80  HPEGKVSL 87
            P G V L
Sbjct: 353 VPGGYVRL 360


>gi|194333226|ref|YP_002015086.1| DNA protecting protein DprA [Prosthecochloris aestuarii DSM 271]
 gi|194311044|gb|ACF45439.1| DNA protecting protein DprA [Prosthecochloris aestuarii DSM 271]
          Length = 382

 Score = 63.3 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 14/53 (26%), Positives = 25/53 (47%)

Query: 30  EYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPE 82
           +    E  +I  +L + P+HID +   T I A  + + L EL++   +   P 
Sbjct: 324 QSLSKEEQQILHTLGDKPLHIDLLAEKTAIPASSLLIRLFELEIKNLVEQLPG 376


>gi|325109981|ref|YP_004271049.1| DNA protecting protein DprA [Planctomyces brasiliensis DSM 5305]
 gi|324970249|gb|ADY61027.1| DNA protecting protein DprA [Planctomyces brasiliensis DSM 5305]
          Length = 389

 Score = 63.3 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 17/85 (20%), Positives = 31/85 (36%), Gaps = 2/85 (2%)

Query: 3   HPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAP 62
            P+ E    S     +                ++  I   L++ P+HID +I  +G+E  
Sbjct: 304 RPRTEGTAVSP--AADPNGQEVRAPRELVLSDQQKAILNLLHDEPVHIDRVIDQSGLEPS 361

Query: 63  VVYLVLLELDLAGRLCHHPEGKVSL 87
            V   L  L++   +   P   +S 
Sbjct: 362 RVLSTLTVLEMKRLVKRLPGNYLSR 386


>gi|170697717|ref|ZP_02888804.1| DNA protecting protein DprA [Burkholderia ambifaria IOP40-10]
 gi|170137332|gb|EDT05573.1| DNA protecting protein DprA [Burkholderia ambifaria IOP40-10]
          Length = 422

 Score = 63.3 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 16/67 (23%), Positives = 29/67 (43%), Gaps = 3/67 (4%)

Query: 30  EYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL-- 87
                    +  +L   P+  + +  H+G+   V++  LL L+LAGR+   P G+ +   
Sbjct: 348 PPHTPAERSVLAALGYGPVTYEWLAEHSGLSDDVLHSALLALELAGRVASVPGGRFARLD 407

Query: 88  -TMHLPS 93
              H P 
Sbjct: 408 AARHPPP 414


>gi|167645473|ref|YP_001683136.1| DNA protecting protein DprA [Caulobacter sp. K31]
 gi|167347903|gb|ABZ70638.1| DNA protecting protein DprA [Caulobacter sp. K31]
          Length = 366

 Score = 62.9 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 21/85 (24%), Positives = 34/85 (40%), Gaps = 6/85 (7%)

Query: 8   QNFFSSQSDTNHTKNINITHYPEYTQCE------RVRIKQSLNNVPIHIDDIIHHTGIEA 61
           ++   S S   H +     +  E    E      R  + + L+  P+  DD++  T    
Sbjct: 280 EDVLRSLSGQAHLRERERPYAAEDDDAEIDHEALREEVARLLSPTPVSRDDLVRATRAPT 339

Query: 62  PVVYLVLLELDLAGRLCHHPEGKVS 86
             V   L+EL LA R+   P G V+
Sbjct: 340 SAVMAALVELALAERVELLPGGMVA 364


>gi|51597954|ref|YP_072145.1| DNA protecting protein DprA [Yersinia pseudotuberculosis IP 32953]
 gi|170022578|ref|YP_001719083.1| DNA protecting protein DprA [Yersinia pseudotuberculosis YPIII]
 gi|186897150|ref|YP_001874262.1| DNA protecting protein DprA [Yersinia pseudotuberculosis PB1/+]
 gi|51591236|emb|CAH22902.1| conserved hypothetical protein [Yersinia pseudotuberculosis IP
           32953]
 gi|169749112|gb|ACA66630.1| DNA protecting protein DprA [Yersinia pseudotuberculosis YPIII]
 gi|186700176|gb|ACC90805.1| DNA protecting protein DprA [Yersinia pseudotuberculosis PB1/+]
          Length = 373

 Score = 62.9 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 14/68 (20%), Positives = 28/68 (41%)

Query: 20  TKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCH 79
            + + I+   E  +     +  ++ +    +D +    G     +   LLEL+LAG +  
Sbjct: 293 PEEVIISSPKEQVELPFADVLANVGDEVTPVDVVAERAGQPVQDIASKLLELELAGWIAA 352

Query: 80  HPEGKVSL 87
            P G V +
Sbjct: 353 VPGGYVRI 360


>gi|73543092|ref|YP_297612.1| SMF protein [Ralstonia eutropha JMP134]
 gi|72120505|gb|AAZ62768.1| SMF protein [Ralstonia eutropha JMP134]
          Length = 379

 Score = 62.9 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 13/58 (22%), Positives = 22/58 (37%)

Query: 29  PEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
           P         +   L + P+ +D +   +G+    +   LLEL+L GR    P     
Sbjct: 319 PPMRSTPDDPLLAVLTHDPVTLDTLCERSGLAPETLATRLLELELEGRAERLPGNLFR 376


>gi|289809873|ref|ZP_06540502.1| DNA protecting protein DprA [Salmonella enterica subsp. enterica
           serovar Typhi str. AG3]
          Length = 248

 Score = 62.9 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 17/78 (21%), Positives = 32/78 (41%), Gaps = 6/78 (7%)

Query: 10  FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLL 69
             ++  ++ ++ N +    P         +  ++ +    +D +    G   P V   LL
Sbjct: 164 LPTTAENSLYSLNQDEAALPFP------ELLTNVGDEVTPVDVVAERAGQPVPAVVAQLL 217

Query: 70  ELDLAGRLCHHPEGKVSL 87
           EL+LAG +   P G V L
Sbjct: 218 ELELAGWIAAVPGGYVRL 235


>gi|123444063|ref|YP_001008033.1| DNA protecting protein DprA [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|122091024|emb|CAL13907.1| conserved hypothetical protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 373

 Score = 62.9 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 16/68 (23%), Positives = 29/68 (42%)

Query: 20  TKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCH 79
            + + I+   E  +     +  ++ +    +D +    G   P +   LLEL+LAG +  
Sbjct: 293 PEKVIISSSEEQVELPFADVLANVGDEVTPVDVVAERAGQPVPDIVSKLLELELAGWIAA 352

Query: 80  HPEGKVSL 87
            P G V L
Sbjct: 353 VPGGYVRL 360


>gi|119356222|ref|YP_910866.1| DNA protecting protein DprA [Chlorobium phaeobacteroides DSM 266]
 gi|119353571|gb|ABL64442.1| DNA protecting protein DprA [Chlorobium phaeobacteroides DSM 266]
          Length = 381

 Score = 62.9 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 15/77 (19%), Positives = 31/77 (40%), Gaps = 3/77 (3%)

Query: 9   NFFSSQSDTNHTKNINITHYPEYT---QCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVY 65
           +  S  +  +  +NI   +          E + +   +    +HID I   TG++   + 
Sbjct: 297 DIISEVAPQSSRENIPRQNPIALDMHLSAEELNVLAIMGKESVHIDTIASKTGLDVSTLL 356

Query: 66  LVLLELDLAGRLCHHPE 82
           + L EL++   +  HP 
Sbjct: 357 VRLFELEMKRAVIQHPG 373


>gi|295096930|emb|CBK86020.1| DNA protecting protein DprA [Enterobacter cloacae subsp. cloacae
           NCTC 9394]
          Length = 379

 Score = 62.9 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 15/50 (30%), Positives = 24/50 (48%)

Query: 38  RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           ++  ++ +    +D +    G   PV    LLEL+LAG +   P G V L
Sbjct: 317 KLLANVGDEVTPVDVVAERAGQPVPVTVAQLLELELAGWIAAVPGGYVRL 366


>gi|17544787|ref|NP_518189.1| SMF protein [Ralstonia solanacearum GMI1000]
 gi|17427076|emb|CAD13596.1| putative smf protein (predicted rossmann fold nucleotide-binding
           protein involved in dna uptake) [Ralstonia solanacearum
           GMI1000]
          Length = 401

 Score = 62.9 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 14/47 (29%), Positives = 23/47 (48%)

Query: 39  IKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
           +  +L   P+ +D +   TG  A  +   LL L+LAG +   P G+ 
Sbjct: 351 LLDALGFDPVDLDTLCERTGQTAANLSAQLLALELAGHIERQPGGRF 397


>gi|172062106|ref|YP_001809758.1| DNA protecting protein DprA [Burkholderia ambifaria MC40-6]
 gi|171994623|gb|ACB65542.1| DNA protecting protein DprA [Burkholderia ambifaria MC40-6]
          Length = 422

 Score = 62.9 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 15/67 (22%), Positives = 28/67 (41%), Gaps = 3/67 (4%)

Query: 30  EYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL-- 87
                    +  +L   P+  + +  H+G+   V++  LL L+LAGR+     G+ +   
Sbjct: 348 PPDTPAERSVLAALGYGPVTYEWLAEHSGLSDDVLHSALLALELAGRVASVAGGRFARLD 407

Query: 88  -TMHLPS 93
              H P 
Sbjct: 408 AARHPPP 414


>gi|34499722|ref|NP_903937.1| smf protein [Chromobacterium violaceum ATCC 12472]
 gi|34105573|gb|AAQ61927.1| smf protein [Chromobacterium violaceum ATCC 12472]
          Length = 359

 Score = 62.9 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 17/56 (30%), Positives = 27/56 (48%)

Query: 32  TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
            + E   +  S+   P+  D +    G+    VY +LLEL+LAGR+   P G+   
Sbjct: 300 EEPETPPLLNSMGWEPVLADALAGTLGLTPGEVYAMLLELELAGRVASLPGGRFQR 355


>gi|254483307|ref|ZP_05096538.1| DNA protecting protein DprA [marine gamma proteobacterium HTCC2148]
 gi|214036402|gb|EEB77078.1| DNA protecting protein DprA [marine gamma proteobacterium HTCC2148]
          Length = 301

 Score = 62.9 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 15/70 (21%), Positives = 28/70 (40%)

Query: 17  TNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGR 76
                 ++    PE    +   + + L    I +D ++  +G+    V   L  L+LAGR
Sbjct: 230 QQELSQVSTIPSPESISEQDCLLLELLGFEVISLDQLVVASGLPVGQVMGELSSLELAGR 289

Query: 77  LCHHPEGKVS 86
           +   P G + 
Sbjct: 290 VNRCPGGYIR 299


>gi|83945523|ref|ZP_00957870.1| dprA protein [Oceanicaulis alexandrii HTCC2633]
 gi|83851099|gb|EAP88957.1| dprA protein [Oceanicaulis alexandrii HTCC2633]
          Length = 372

 Score = 62.9 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 21/86 (24%), Positives = 31/86 (36%)

Query: 1   MVHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIE 60
           ++                  +  +     E     R RI   L+  P+  D++   T   
Sbjct: 285 ILSGARRPKLEEPSGADFEDEFEDARALDEAVSDIRERIAGLLSPTPVSRDELARLTRAP 344

Query: 61  APVVYLVLLELDLAGRLCHHPEGKVS 86
           A VV   L+EL+LAGR    P G V 
Sbjct: 345 ARVVLAALVELELAGRCEIWPNGMVC 370


>gi|147677580|ref|YP_001211795.1| Rossmann fold nucleotide-binding protein [Pelotomaculum
           thermopropionicum SI]
 gi|146273677|dbj|BAF59426.1| predicted Rossmann fold nucleotide-binding protein [Pelotomaculum
           thermopropionicum SI]
          Length = 367

 Score = 62.9 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 13/67 (19%), Positives = 24/67 (35%)

Query: 22  NINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHP 81
             +          E   +   L+  P+ +D+II  +G+        L+ L+L G     P
Sbjct: 296 KKDEPGEAVKMSREEEAVYSLLSVDPVPLDEIIGRSGLTPQKAMAALMYLELKGLARQMP 355

Query: 82  EGKVSLT 88
               + T
Sbjct: 356 GKFYTRT 362


>gi|322831107|ref|YP_004211134.1| DNA protecting protein DprA [Rahnella sp. Y9602]
 gi|321166308|gb|ADW72007.1| DNA protecting protein DprA [Rahnella sp. Y9602]
          Length = 389

 Score = 62.9 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 18/86 (20%), Positives = 32/86 (37%), Gaps = 2/86 (2%)

Query: 4   PQIEQNFFSSQSDTNHTKNINITHYPEYTQCER--VRIKQSLNNVPIHIDDIIHHTGIEA 61
           P I+ +         H+    +      ++ E     +  ++      +D +    G   
Sbjct: 291 PNIKASESLKMPPDGHSDASEVNICAPDSEVELPFADVLANVEYEVTSVDVVAERAGQPV 350

Query: 62  PVVYLVLLELDLAGRLCHHPEGKVSL 87
           P V   LLEL+LAG +   P G V +
Sbjct: 351 PEVVGKLLELELAGWIAAVPGGYVRI 376


>gi|299068357|emb|CBJ39581.1| putative smf, DNA processing chain A (drpA) [Ralstonia solanacearum
           CMR15]
          Length = 401

 Score = 62.9 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 14/47 (29%), Positives = 23/47 (48%)

Query: 39  IKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
           +  +L   P+ +D +   TG  A  +   LL L+LAG +   P G+ 
Sbjct: 351 LLDALGFDPVDLDTLCERTGQTAANLSAQLLALELAGHIERQPGGRF 397


>gi|307728141|ref|YP_003905365.1| DNA protecting protein DprA [Burkholderia sp. CCGE1003]
 gi|307582676|gb|ADN56074.1| DNA protecting protein DprA [Burkholderia sp. CCGE1003]
          Length = 433

 Score = 62.9 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 17/88 (19%), Positives = 37/88 (42%), Gaps = 3/88 (3%)

Query: 3   HPQIEQNFFSSQSDTNHTKNINITHYPEYT---QCERVRIKQSLNNVPIHIDDIIHHTGI 59
            P+      S++      +    T     T   + +  R+  +L + P  ++ +   T +
Sbjct: 338 EPECGAQLPSTEPAPAEARRPVATVATVATVAFEPDAQRLLAALGHAPTSLEILATRTEM 397

Query: 60  EAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           +  V+   LL+L+LAG +   P G+ + 
Sbjct: 398 DYAVLQATLLQLELAGHVSALPGGRYAR 425


>gi|91791395|ref|YP_561046.1| DNA processing protein DprA, putative [Shewanella denitrificans
           OS217]
 gi|91713397|gb|ABE53323.1| DNA processing protein DprA, putative [Shewanella denitrificans
           OS217]
          Length = 362

 Score = 62.5 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 15/50 (30%), Positives = 25/50 (50%)

Query: 38  RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
            +  S+      ID ++ H+G    +V + +LEL+L G +   P G V L
Sbjct: 310 PLLASVGYETTSIDAVVEHSGKTIDLVLVQMLELELQGWVAAVPGGYVRL 359


>gi|198282166|ref|YP_002218487.1| DNA protecting protein DprA [Acidithiobacillus ferrooxidans ATCC
           53993]
 gi|218666611|ref|YP_002424531.1| DNA processing protein DprA, putative [Acidithiobacillus
           ferrooxidans ATCC 23270]
 gi|198246687|gb|ACH82280.1| DNA protecting protein DprA [Acidithiobacillus ferrooxidans ATCC
           53993]
 gi|218518824|gb|ACK79410.1| DNA processing protein DprA, putative [Acidithiobacillus
           ferrooxidans ATCC 23270]
          Length = 365

 Score = 62.5 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 11/68 (16%), Positives = 29/68 (42%)

Query: 20  TKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCH 79
            + +      +     + R+  +++  P+  + I +  G+    +  +LL+++L G L  
Sbjct: 293 AQAMAPAADWQPEDPAQARVWAAMDFDPLAPEQIANRCGLTLTELSAILLDMELQGYLAA 352

Query: 80  HPEGKVSL 87
            P G+   
Sbjct: 353 CPGGRFCR 360


>gi|255531337|ref|YP_003091709.1| DNA protecting protein DprA [Pedobacter heparinus DSM 2366]
 gi|255344321|gb|ACU03647.1| DNA protecting protein DprA [Pedobacter heparinus DSM 2366]
          Length = 363

 Score = 62.5 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 16/60 (26%), Positives = 22/60 (36%)

Query: 29  PEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
           P     E  +I   L   PI ID+I          + + LL L++ G L   P     L 
Sbjct: 304 PVGLSDEEQKIVNILTATPIGIDEIGQQLNFSQSKLAMHLLSLEMQGILVALPGKFYKLN 363


>gi|258514507|ref|YP_003190729.1| DNA protecting protein DprA [Desulfotomaculum acetoxidans DSM 771]
 gi|257778212|gb|ACV62106.1| DNA protecting protein DprA [Desulfotomaculum acetoxidans DSM 771]
          Length = 366

 Score = 62.5 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 13/79 (16%), Positives = 29/79 (36%)

Query: 9   NFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVL 68
           +       T        T+       +   +   ++  P+H D+I+  + + A  V   L
Sbjct: 282 DILDELGITTLFPVEESTNASVALNRDEETVFGLISVNPVHFDEIVDKSNLPAQKVLASL 341

Query: 69  LELDLAGRLCHHPEGKVSL 87
           + L+L   +   P  + +L
Sbjct: 342 MFLELKNLVRQLPGRQYAL 360


>gi|114561214|ref|YP_748727.1| DNA protecting protein DprA [Shewanella frigidimarina NCIMB 400]
 gi|114332507|gb|ABI69889.1| DNA protecting protein DprA [Shewanella frigidimarina NCIMB 400]
          Length = 338

 Score = 62.5 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 16/71 (22%), Positives = 32/71 (45%), Gaps = 6/71 (8%)

Query: 17  TNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGR 76
            +H ++ +++  P         +  S+      ID ++  +G    +V + +LEL+L G 
Sbjct: 271 RHHIQDNDVSDLPFPP------LLASVGYETTAIDSVVEDSGKPIDLVLIQMLELELQGW 324

Query: 77  LCHHPEGKVSL 87
           +   P G V L
Sbjct: 325 VAAVPGGYVRL 335


>gi|90019672|ref|YP_525499.1| filamentous hemagglutinin-like protein [Saccharophagus degradans
           2-40]
 gi|89949272|gb|ABD79287.1| DNA processing protein DprA, putative [Saccharophagus degradans
           2-40]
          Length = 399

 Score = 62.5 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 14/69 (20%), Positives = 23/69 (33%)

Query: 19  HTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLC 78
             +N    H           +   L+  P  ID +   T      V   LL ++L G + 
Sbjct: 330 PAENSLPKHDELIANDLEDDVLAKLDYSPTPIDALAERTKKPIGEVMSCLLTMELKGLVA 389

Query: 79  HHPEGKVSL 87
           +   G + L
Sbjct: 390 NLGAGYMRL 398


>gi|190576009|ref|YP_001973854.1| putative Smf protein [Stenotrophomonas maltophilia K279a]
 gi|190013931|emb|CAQ47571.1| putative Smf protein [Stenotrophomonas maltophilia K279a]
          Length = 375

 Score = 62.5 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 19/87 (21%), Positives = 36/87 (41%), Gaps = 3/87 (3%)

Query: 1   MVHPQIEQNFFSSQSD-TNHTKNINITHYPE--YTQCERVRIKQSLNNVPIHIDDIIHHT 57
           ++ P + Q     QS     T+       P       +   + ++L++ P  +D +I   
Sbjct: 285 LLAPALRQQLPGLQSRLGTPTEQAPPALLPARWADDPDYQCLWRALDHDPSSMDSLITRC 344

Query: 58  GIEAPVVYLVLLELDLAGRLCHHPEGK 84
           G+ AP V  +LL ++LAG +       
Sbjct: 345 GLTAPQVSSMLLAMELAGIVVCVHGRY 371


>gi|188535242|ref|YP_001909039.1| Predicted Rossmann fold nucleotide-binding protein involved in DNA
           uptake [Erwinia tasmaniensis Et1/99]
 gi|188030284|emb|CAO98173.1| Predicted Rossmann fold nucleotide-binding protein involved in DNA
           uptake [Erwinia tasmaniensis Et1/99]
          Length = 374

 Score = 62.5 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 16/79 (20%), Positives = 32/79 (40%), Gaps = 8/79 (10%)

Query: 9   NFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVL 68
             F+  ++ +   +     +P+        +  ++ +    +D +    G   P +   L
Sbjct: 291 PVFAPVTNNSAGSSNPPLPFPD--------VLANVGDEVTPVDVVAERAGQPVPAIVAKL 342

Query: 69  LELDLAGRLCHHPEGKVSL 87
           LEL+LAG +   P G V L
Sbjct: 343 LELELAGWIAAVPGGYVRL 361


>gi|238788877|ref|ZP_04632667.1| hypothetical protein yfred0001_26840 [Yersinia frederiksenii ATCC
           33641]
 gi|238722904|gb|EEQ14554.1| hypothetical protein yfred0001_26840 [Yersinia frederiksenii ATCC
           33641]
          Length = 373

 Score = 62.5 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 14/49 (28%), Positives = 23/49 (46%)

Query: 39  IKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           +  ++ +    +D +    G   P +   LLEL+LAG +   P G V L
Sbjct: 312 VLANVGDEVTPVDVVAERAGQPVPDIVSKLLELELAGWIAAVPGGYVRL 360


>gi|289209435|ref|YP_003461501.1| DNA protecting protein DprA [Thioalkalivibrio sp. K90mix]
 gi|288945066|gb|ADC72765.1| DNA protecting protein DprA [Thioalkalivibrio sp. K90mix]
          Length = 377

 Score = 62.5 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 13/72 (18%), Positives = 28/72 (38%)

Query: 16  DTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAG 75
               T +       E    E+ R+  ++   PI ++ +   T +    +  +L+ L+L G
Sbjct: 298 APGETASTPPEPAREPLDPEQERVLNAMGFDPIPLETLRDRTKLTIERLSSMLVLLELNG 357

Query: 76  RLCHHPEGKVSL 87
           R+     G+   
Sbjct: 358 RVAALDHGRYQR 369


>gi|213419663|ref|ZP_03352729.1| hypothetical protein Salmonentericaenterica_18473 [Salmonella
           enterica subsp. enterica serovar Typhi str. E01-6750]
          Length = 145

 Score = 62.5 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 17/78 (21%), Positives = 32/78 (41%), Gaps = 6/78 (7%)

Query: 10  FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLL 69
             ++  ++ ++ N +    P         +  ++ +    +D +    G   P V   LL
Sbjct: 61  LPTTAENSLYSLNQDEAALPFP------ELLANVGDEVTPVDVVAERAGQPVPAVVAQLL 114

Query: 70  ELDLAGRLCHHPEGKVSL 87
           EL+LAG +   P G V L
Sbjct: 115 ELELAGWIAAVPGGYVRL 132


>gi|54310615|ref|YP_131635.1| putative Smf protein [Photobacterium profundum SS9]
 gi|46915058|emb|CAG21833.1| Hypothetical Smf protein [Photobacterium profundum SS9]
          Length = 365

 Score = 62.5 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 12/60 (20%), Positives = 24/60 (40%)

Query: 27  HYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
             PE  +     +  ++    I +D +     +    V + LL+L+L G +   P G + 
Sbjct: 302 PQPENEELPFSAVLATVGKEAIPVDVVAERCKLPIHEVMMQLLDLELQGVVSTVPGGYIR 361


>gi|16329968|ref|NP_440696.1| hypothetical protein slr1197 [Synechocystis sp. PCC 6803]
 gi|3914979|sp|P73345|SMF_SYNY3 RecName: Full=Protein smf
 gi|1652454|dbj|BAA17376.1| slr1197 [Synechocystis sp. PCC 6803]
          Length = 398

 Score = 62.5 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 15/75 (20%), Positives = 28/75 (37%)

Query: 13  SQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELD 72
               T       +T  PE  +    +I  ++   P  +D I+  T +    V   LL+L+
Sbjct: 323 PTLTTGARGKQPLTEPPEDLEPTLKKILAAVQEEPTALDQIVAVTALAIGDVSAGLLQLE 382

Query: 73  LAGRLCHHPEGKVSL 87
           + G +   P  +   
Sbjct: 383 ILGLVSQEPGMRYQR 397


>gi|90413781|ref|ZP_01221769.1| Hypothetical Smf protein [Photobacterium profundum 3TCK]
 gi|90325250|gb|EAS41747.1| Hypothetical Smf protein [Photobacterium profundum 3TCK]
          Length = 364

 Score = 62.2 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 12/60 (20%), Positives = 24/60 (40%)

Query: 27  HYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
             PE  +     +  ++    I +D +     +    V + LL+L+L G +   P G + 
Sbjct: 301 PQPENEELPFSAVLATVGKEAIPVDVVAERCKLPIHEVMMQLLDLELQGVVSTVPGGYIR 360


>gi|195941055|ref|ZP_03086437.1| hypothetical protein EscherichcoliO157_32466 [Escherichia coli
           O157:H7 str. EC4024]
          Length = 246

 Score = 62.2 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 15/50 (30%), Positives = 24/50 (48%)

Query: 38  RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           ++  ++ +    +D +    G   PV    LLEL+LAG +   P G V L
Sbjct: 184 KLLANVGDEVTPVDVVAERAGQPVPVTVAQLLELELAGWIAAVPGGYVRL 233


>gi|325518085|gb|EGC97880.1| SMF protein [Burkholderia sp. TJI49]
          Length = 116

 Score = 62.2 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 14/63 (22%), Positives = 29/63 (46%)

Query: 32  TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHL 91
                  +  +L   P+  + +  H+G+    ++  LL L+LAG +   P G+ +    +
Sbjct: 44  DNPTEQAVLAALGYGPVTYEWLAEHSGLPDDDLHRALLALELAGHVAPLPGGRFARLDAV 103

Query: 92  PSP 94
           P+P
Sbjct: 104 PTP 106


>gi|152980408|ref|YP_001351831.1| DNA processing protein [Janthinobacterium sp. Marseille]
 gi|151280485|gb|ABR88895.1| DNA processing protein [Janthinobacterium sp. Marseille]
          Length = 371

 Score = 62.2 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 9/67 (13%), Positives = 18/67 (26%)

Query: 21  KNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHH 80
                             +  S+    +  D +     ++   ++  LL L+L G     
Sbjct: 303 PAAPGERATPPADAPYAHVLHSMGYDAVDADTLAQRCQLDIAEIHTHLLTLELDGHTEIL 362

Query: 81  PEGKVSL 87
           P G    
Sbjct: 363 PGGLYRR 369


>gi|323140195|ref|ZP_08075173.1| SMF family protein [Methylocystis sp. ATCC 49242]
 gi|322394547|gb|EFX97170.1| SMF family protein [Methylocystis sp. ATCC 49242]
          Length = 207

 Score = 62.2 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 26/88 (29%), Positives = 38/88 (43%), Gaps = 7/88 (7%)

Query: 7   EQNFFSSQSDTNHTKNINITHYPEYTQCERVRI-------KQSLNNVPIHIDDIIHHTGI 59
           E+   S        +    T  P+ +     R+          L   P+ +D++I   G+
Sbjct: 114 EEGPPSPLFAAPEPELGPETASPDPSAPVHGRVADPHEVVLSLLGPSPVAVDELIRIAGL 173

Query: 60  EAPVVYLVLLELDLAGRLCHHPEGKVSL 87
            A  V+ VL+ELDLAGRL  H    VSL
Sbjct: 174 PARDVHGVLVELDLAGRLERHGTNAVSL 201


>gi|59713148|ref|YP_205924.1| DNA processing protein DprA [Vibrio fischeri ES114]
 gi|59481249|gb|AAW87036.1| DNA processing protein DprA (Smf), possibly competence-related
           [Vibrio fischeri ES114]
          Length = 369

 Score = 62.2 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 10/49 (20%), Positives = 20/49 (40%)

Query: 38  RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
            +  ++      +D I     +    + + LLEL+L G +   P G + 
Sbjct: 317 EVFATVGGEATPVDIIAERCQMPVHEIMMQLLELELQGFIAAVPGGYIK 365


>gi|238752656|ref|ZP_04614127.1| DNA protecting protein DprA [Yersinia rohdei ATCC 43380]
 gi|238709083|gb|EEQ01330.1| DNA protecting protein DprA [Yersinia rohdei ATCC 43380]
          Length = 373

 Score = 62.2 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 14/51 (27%), Positives = 23/51 (45%)

Query: 37  VRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
             +  ++ +    +D +    G   P +   LLEL+LAG +   P G V L
Sbjct: 310 ADVLANVGDEVTPVDVVAERAGQPVPDIVSKLLELELAGWIAAVPGGYVRL 360


>gi|33599233|ref|NP_886793.1| hypothetical protein BB0244 [Bordetella bronchiseptica RB50]
 gi|33575279|emb|CAE30742.1| conserved hypothetical protein [Bordetella bronchiseptica RB50]
          Length = 370

 Score = 62.2 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 15/49 (30%), Positives = 26/49 (53%)

Query: 39  IKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           +  +L   P+H+D +   TG++A  +   LLEL+L GR+     G+   
Sbjct: 320 LLDALGFDPLHLDALQARTGMDAASLNAQLLELELDGRVARVEGGRFQR 368


>gi|192360468|ref|YP_001984037.1| smf protein [Cellvibrio japonicus Ueda107]
 gi|190686633|gb|ACE84311.1| smf protein [Cellvibrio japonicus Ueda107]
          Length = 387

 Score = 62.2 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 13/81 (16%), Positives = 35/81 (43%)

Query: 7   EQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYL 66
           +Q   S+          +             ++ +++   P++ID ++  T ++A ++  
Sbjct: 304 QQLQRSAVKQVQPLPTASTNMPLAELDPAATQLLEAMGYDPVNIDTLVERTSLDAGIIAA 363

Query: 67  VLLELDLAGRLCHHPEGKVSL 87
            L+ L+L+G +C    G + +
Sbjct: 364 QLVSLELSGAICTIAGGYLRV 384


>gi|283788079|ref|YP_003367944.1| hypothetical protein ROD_45361 [Citrobacter rodentium ICC168]
 gi|282951533|emb|CBG91232.1| conserved hypothetical protein [Citrobacter rodentium ICC168]
          Length = 374

 Score = 62.2 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 16/71 (22%), Positives = 26/71 (36%), Gaps = 2/71 (2%)

Query: 19  HTKNINITHYPEYTQCERV--RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGR 76
                N  + P+          +  ++ +    +D +    G   P     LLEL+LAG 
Sbjct: 291 PDDPANRLNSPQQEATALPFPELLANVGDEVTPVDVVAERAGQPVPETVAQLLELELAGW 350

Query: 77  LCHHPEGKVSL 87
           +   P G V L
Sbjct: 351 IAAVPGGYVRL 361


>gi|254477402|ref|ZP_05090788.1| DNA protecting protein DprA [Ruegeria sp. R11]
 gi|214031645|gb|EEB72480.1| DNA protecting protein DprA [Ruegeria sp. R11]
          Length = 362

 Score = 62.2 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 15/83 (18%), Positives = 32/83 (38%)

Query: 3   HPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAP 62
           HP    +  ++ +  +     +     + T      I   L   P+  D ++    + A 
Sbjct: 273 HPASLPDVTNTTAPPDLPPPPSEQRSLQETAALHQEILDRLGPSPLTEDQLLRDLSLAAK 332

Query: 63  VVYLVLLELDLAGRLCHHPEGKV 85
            +  VL +L+L+G +   P G +
Sbjct: 333 DLSPVLTDLELSGDITRQPGGML 355


>gi|332976751|gb|EGK13582.1| DNA processing protein DprA [Desmospora sp. 8437]
          Length = 396

 Score = 62.2 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 9/69 (13%), Positives = 23/69 (33%), Gaps = 2/69 (2%)

Query: 14  QSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDL 73
                  +   +       Q +   +   L   P+ +D +   + +    ++  LL+L +
Sbjct: 324 PQPEAPLREGPLPGT--ELQPQEQALLDLLGEEPLTVDSLADRSDLPLGELHRQLLQLQV 381

Query: 74  AGRLCHHPE 82
            G +   P 
Sbjct: 382 KGWVRQLPG 390


>gi|307132805|ref|YP_003884821.1| Rossmann fold nucleotide-binding protein Smf possibly involved in
           DNA uptake [Dickeya dadantii 3937]
 gi|306530334|gb|ADN00265.1| Rossmann fold nucleotide-binding protein Smf possibly involved in
           DNA uptake [Dickeya dadantii 3937]
          Length = 377

 Score = 62.2 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 15/74 (20%), Positives = 27/74 (36%), Gaps = 2/74 (2%)

Query: 16  DTNHTKNINITHYPEYTQCER--VRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDL 73
                + I         + E     +  ++ +    +D +    G   P V   LL+L+L
Sbjct: 291 ADIPGEGIPEIICAAEGELELPFADVLATVGDEVTPVDVVAERAGQPVPEVVSKLLDLEL 350

Query: 74  AGRLCHHPEGKVSL 87
           AG +   P G V +
Sbjct: 351 AGWIAAVPGGYVRI 364


>gi|56697910|ref|YP_168281.1| DNA processing protein DprA, putative [Ruegeria pomeroyi DSS-3]
 gi|56679647|gb|AAV96313.1| DNA processing protein DprA, putative [Ruegeria pomeroyi DSS-3]
          Length = 382

 Score = 62.2 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 16/87 (18%), Positives = 28/87 (32%), Gaps = 4/87 (4%)

Query: 1   MVHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIE 60
           +  PQ + +              ++             I   L   P+  D +I      
Sbjct: 298 LTAPQPQPDLCDLMQQPAPPAKRSLRETV----ALHSLILDRLGPSPVAEDQLIRDLAAS 353

Query: 61  APVVYLVLLELDLAGRLCHHPEGKVSL 87
              V  VL++L+L GR+     G +S 
Sbjct: 354 PGEVAPVLVDLELEGRINRQAGGLLSR 380


>gi|289432565|ref|YP_003462438.1| DNA protecting protein DprA [Dehalococcoides sp. GT]
 gi|288946285|gb|ADC73982.1| DNA protecting protein DprA [Dehalococcoides sp. GT]
          Length = 373

 Score = 62.2 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 14/70 (20%), Positives = 21/70 (30%)

Query: 21  KNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHH 80
              N T            I   L   P+HID I     +   +V   L  ++L G++   
Sbjct: 294 SEENTTVEIIPENQTESLILGKLGYEPVHIDQICRECALGVALVSGTLAIMELKGQVRST 353

Query: 81  PEGKVSLTMH 90
                  T  
Sbjct: 354 GGMNYVRTRE 363


>gi|73748517|ref|YP_307756.1| putative DNA processing protein DprA [Dehalococcoides sp. CBDB1]
 gi|73660233|emb|CAI82840.1| putative DNA processing protein DprA [Dehalococcoides sp. CBDB1]
          Length = 383

 Score = 62.2 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 14/70 (20%), Positives = 21/70 (30%)

Query: 21  KNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHH 80
              N T            I   L   P+HID I     +   +V   L  ++L G++   
Sbjct: 304 SEENTTVEIIPENQTESLILGKLGYEPVHIDQICRECALGVALVSGTLAIMELKGQVRST 363

Query: 81  PEGKVSLTMH 90
                  T  
Sbjct: 364 GGMNYVRTRE 373


>gi|33594956|ref|NP_882599.1| hypothetical protein BPP0240 [Bordetella parapertussis 12822]
 gi|33565032|emb|CAE39981.1| conserved hypothetical protein [Bordetella parapertussis]
          Length = 370

 Score = 62.2 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 15/49 (30%), Positives = 26/49 (53%)

Query: 39  IKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           +  +L   P+H+D +   TG++A  +   LLEL+L GR+     G+   
Sbjct: 320 LLDALGFDPLHLDALQARTGMDAASLNAQLLELELDGRVARVEGGRFQR 368


>gi|33591759|ref|NP_879403.1| hypothetical protein BP0555 [Bordetella pertussis Tohama I]
 gi|33571402|emb|CAE44883.1| conserved hypothetical protein [Bordetella pertussis Tohama I]
 gi|332381176|gb|AEE66023.1| hypothetical protein BPTD_0564 [Bordetella pertussis CS]
          Length = 370

 Score = 62.2 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 15/49 (30%), Positives = 26/49 (53%)

Query: 39  IKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           +  +L   P+H+D +   TG++A  +   LLEL+L GR+     G+   
Sbjct: 320 LLDALGFDPLHLDALQARTGMDAASLNAQLLELELDGRVARVEGGRFQR 368


>gi|254784307|ref|YP_003071735.1| SMF protein [Teredinibacter turnerae T7901]
 gi|237686231|gb|ACR13495.1| SMF protein [Teredinibacter turnerae T7901]
          Length = 389

 Score = 62.2 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 15/56 (26%), Positives = 22/56 (39%)

Query: 32  TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
              E   I + L      ID+I   T +    V   LL L+L G + +   G + L
Sbjct: 321 ATEEESIILEQLGYESTPIDEIAERTELPVGDVMACLLTLELKGLVANVGTGYMRL 376


>gi|237746965|ref|ZP_04577445.1| DNA processing protein [Oxalobacter formigenes HOxBLS]
 gi|229378316|gb|EEO28407.1| DNA processing protein [Oxalobacter formigenes HOxBLS]
          Length = 373

 Score = 62.2 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 14/85 (16%), Positives = 27/85 (31%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVV 64
           +  Q+        N     +           +  I   +   P+  D +     I+A  +
Sbjct: 287 ETSQDVLEELKHYNSVSESSDRKMEPENTSLQEDILLQMGFDPVDSDTLCERCEIDAASL 346

Query: 65  YLVLLELDLAGRLCHHPEGKVSLTM 89
            + LL L+LAG +     G     +
Sbjct: 347 NVELLSLELAGEVESLAGGFYRRLV 371


>gi|332711096|ref|ZP_08431030.1| DNA protecting protein DprA [Lyngbya majuscula 3L]
 gi|332350078|gb|EGJ29684.1| DNA protecting protein DprA [Lyngbya majuscula 3L]
          Length = 377

 Score = 62.2 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 14/76 (18%), Positives = 28/76 (36%), Gaps = 1/76 (1%)

Query: 13  SQSDTNHTKNINITHYPEY-TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLEL 71
            + D +      +   P    +    ++  ++   P   D I+    +EA  V   LL+L
Sbjct: 298 PELDPHSALEQPLPALPVPTLEPALAKVLDAIAFEPTSFDIIVQQAALEAGSVSSALLQL 357

Query: 72  DLAGRLCHHPEGKVSL 87
           +L G +   P  +   
Sbjct: 358 ELMGLVSQAPGMRYRR 373


>gi|156740191|ref|YP_001430320.1| DNA protecting protein DprA [Roseiflexus castenholzii DSM 13941]
 gi|156231519|gb|ABU56302.1| DNA protecting protein DprA [Roseiflexus castenholzii DSM 13941]
          Length = 360

 Score = 62.2 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 12/69 (17%), Positives = 20/69 (28%)

Query: 20  TKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCH 79
             +                +   +   P+HIDD+   T +    V   L  L+L G +  
Sbjct: 291 AASQQEVRTALPDDPVEAAVLALVGYEPLHIDDLQRRTSMPVYEVSAALAVLELKGFVRQ 350

Query: 80  HPEGKVSLT 88
                  L 
Sbjct: 351 SAPMCYVLA 359


>gi|147669298|ref|YP_001214116.1| DNA protecting protein DprA [Dehalococcoides sp. BAV1]
 gi|146270246|gb|ABQ17238.1| DNA protecting protein DprA [Dehalococcoides sp. BAV1]
          Length = 373

 Score = 61.8 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 14/70 (20%), Positives = 21/70 (30%)

Query: 21  KNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHH 80
              N T            I   L   P+HID I     +   +V   L  ++L G++   
Sbjct: 294 SEENTTVEIIPENQTESLILGKLGYEPVHIDQICRECALGVALVSGTLAIMELKGQVRST 353

Query: 81  PEGKVSLTMH 90
                  T  
Sbjct: 354 GGMNYVRTRE 363


>gi|257091702|ref|YP_003165343.1| DNA protecting protein DprA [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
 gi|257044226|gb|ACV33414.1| DNA protecting protein DprA [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
          Length = 363

 Score = 61.8 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 13/68 (19%), Positives = 28/68 (41%)

Query: 20  TKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCH 79
           +   +          E   +  ++   P  +D++   +G+ A  V ++LL L+L G++  
Sbjct: 292 SAPADRPASATADAAEAGSLLLAMGFDPCSLDELTQRSGLTADAVSVILLHLELDGQVAC 351

Query: 80  HPEGKVSL 87
            P G    
Sbjct: 352 LPGGHYQR 359


>gi|124265474|ref|YP_001019478.1| putative SMF protein [Methylibium petroleiphilum PM1]
 gi|124258249|gb|ABM93243.1| putative SMF protein [Methylibium petroleiphilum PM1]
          Length = 365

 Score = 61.8 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 12/75 (16%), Positives = 24/75 (32%), Gaps = 4/75 (5%)

Query: 17  TNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGR 76
               +    T  P         +  +L + P+ +D +    G     +   LL L+L+G 
Sbjct: 295 DAPDRPSPTTSSPSVEDP----VLAALGHDPVTLDALSARIGWPPAELSARLLALELSGD 350

Query: 77  LCHHPEGKVSLTMHL 91
           +   P       +  
Sbjct: 351 VVRLPGQLFQRLVQA 365


>gi|218440245|ref|YP_002378574.1| DNA protecting protein DprA [Cyanothece sp. PCC 7424]
 gi|218172973|gb|ACK71706.1| DNA protecting protein DprA [Cyanothece sp. PCC 7424]
          Length = 374

 Score = 61.8 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 11/63 (17%), Positives = 26/63 (41%)

Query: 25  ITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGK 84
            +      + +  ++ +++       D I+  TG+    V  +LL+L+L G +   P  +
Sbjct: 311 SSKPTPQLEPQLAQVFEAVGIEATPFDLIVQQTGLSTGEVSGILLQLELLGIVSQLPGMR 370

Query: 85  VSL 87
              
Sbjct: 371 YQR 373


>gi|296133059|ref|YP_003640306.1| transcriptional regulator, MarR family [Thermincola sp. JR]
 gi|296031637|gb|ADG82405.1| transcriptional regulator, MarR family [Thermincola potens JR]
          Length = 359

 Score = 61.8 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 12/65 (18%), Positives = 21/65 (32%)

Query: 21  KNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHH 80
           +                RI   L   P++I++I+   G+    V   L  L+L G +   
Sbjct: 291 RGRQEKREEFDLNPAEQRILACLTLEPVNIEEIVEKAGMNPAEVSAALTFLELKGLVKRI 350

Query: 81  PEGKV 85
                
Sbjct: 351 DGQLF 355


>gi|74316030|ref|YP_313770.1| SMF protein [Thiobacillus denitrificans ATCC 25259]
 gi|74055525|gb|AAZ95965.1| SMF protein [Thiobacillus denitrificans ATCC 25259]
          Length = 320

 Score = 61.8 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 15/68 (22%), Positives = 27/68 (39%)

Query: 18  NHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRL 77
           +          P   + E   +  +L+  P  +D +   TG+    +   LL L+L GR+
Sbjct: 249 DELAWQQRLSPPVLPESEPDPVLDALDGAPTTLDSLAQKTGLTLDALSAKLLALELDGRI 308

Query: 78  CHHPEGKV 85
              P G+ 
Sbjct: 309 AALPGGRY 316


>gi|160934426|ref|ZP_02081813.1| hypothetical protein CLOLEP_03299 [Clostridium leptum DSM 753]
 gi|156867099|gb|EDO60471.1| hypothetical protein CLOLEP_03299 [Clostridium leptum DSM 753]
          Length = 396

 Score = 61.8 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 13/79 (16%), Positives = 30/79 (37%)

Query: 8   QNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLV 67
           QN     +              E      V++ Q+++  P ++D +    G+ A      
Sbjct: 315 QNPLRPPNHRTELPKAPPAIREEELSACAVKLYQAMSWEPAYLDILAEEAGLSAAQALQA 374

Query: 68  LLELDLAGRLCHHPEGKVS 86
           + EL+L+G +  +   + +
Sbjct: 375 VTELELSGIIQSYSGRRYA 393


>gi|193213418|ref|YP_001999371.1| DNA protecting protein DprA [Chlorobaculum parvum NCIB 8327]
 gi|193086895|gb|ACF12171.1| DNA protecting protein DprA [Chlorobaculum parvum NCIB 8327]
          Length = 387

 Score = 61.8 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 16/80 (20%), Positives = 27/80 (33%)

Query: 8   QNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLV 67
                +       +             E  RI +++    IHID I   TGI    + + 
Sbjct: 302 SELPPAAFLPTAGRQDVDKPSLPALTPEESRIIEAIEKEAIHIDLIAEKTGIPIEQLLVH 361

Query: 68  LLELDLAGRLCHHPEGKVSL 87
           L EL++   +   P    S+
Sbjct: 362 LFELEMNRIVLQEPGQLFSI 381


>gi|194367359|ref|YP_002029969.1| DNA protecting protein DprA [Stenotrophomonas maltophilia R551-3]
 gi|194350163|gb|ACF53286.1| DNA protecting protein DprA [Stenotrophomonas maltophilia R551-3]
          Length = 375

 Score = 61.8 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 18/87 (20%), Positives = 35/87 (40%), Gaps = 3/87 (3%)

Query: 1   MVHPQIEQNFFSSQSDTN-HTKNINITHYPE--YTQCERVRIKQSLNNVPIHIDDIIHHT 57
           ++ P + Q     QS     T+       P       +   + ++L++ P  +D +I   
Sbjct: 285 LLAPALRQQLPGLQSRLATPTEQAPPALLPARWADDPDYQCLWRALDHNPSGMDSLITRC 344

Query: 58  GIEAPVVYLVLLELDLAGRLCHHPEGK 84
           G+ A  V  +LL ++LAG +       
Sbjct: 345 GLTASQVSSMLLAMELAGIVVCVHGRY 371


>gi|253700153|ref|YP_003021342.1| DNA protecting protein DprA [Geobacter sp. M21]
 gi|251775003|gb|ACT17584.1| DNA protecting protein DprA [Geobacter sp. M21]
          Length = 359

 Score = 61.8 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 13/81 (16%), Positives = 26/81 (32%)

Query: 8   QNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLV 67
           ++                         +   +   L    + IDDII  + + A  V   
Sbjct: 279 EDILEELGLEPQANLPLPKPSSFELTPQEAELYALLCQGALQIDDIIVQSALTASEVSAT 338

Query: 68  LLELDLAGRLCHHPEGKVSLT 88
           LL L++ G +   P  + ++ 
Sbjct: 339 LLRLEMKGAIVQLPGKRFAVA 359


>gi|300770008|ref|ZP_07079887.1| SMF family DNA processing protein [Sphingobacterium spiritivorum
           ATCC 33861]
 gi|300762484|gb|EFK59301.1| SMF family DNA processing protein [Sphingobacterium spiritivorum
           ATCC 33861]
          Length = 370

 Score = 61.8 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 18/85 (21%), Positives = 30/85 (35%), Gaps = 4/85 (4%)

Query: 7   EQNFFSSQSDTNHTKNINIT---HYPEYTQCERVRIKQSLNNV-PIHIDDIIHHTGIEAP 62
             + F   +     +          P     E+ +I Q L    P  ID+I  H  +   
Sbjct: 280 ASDLFYMMNWEQEQQQKPSAQLSLLPPQLSEEQEKIYQFLQQQNPAPIDEIAIHCALPQS 339

Query: 63  VVYLVLLELDLAGRLCHHPEGKVSL 87
            + + LLEL++ G +   P     L
Sbjct: 340 QLAISLLELEMEGIILSMPGKVYKL 364


>gi|300705528|ref|YP_003747131.1| smf, DNA processing chain a (drpa) [Ralstonia solanacearum
           CFBP2957]
 gi|299073192|emb|CBJ44550.1| putative smf, DNA processing chain A (drpA) [Ralstonia solanacearum
           CFBP2957]
          Length = 403

 Score = 61.8 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 13/47 (27%), Positives = 22/47 (46%)

Query: 39  IKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
           +  +L   P+ +D +   TG  A  +   LL L+L GR+     G+ 
Sbjct: 353 LLDALGFDPVDLDTLCQRTGQTAAPLSAQLLALELEGRIERLAGGRF 399


>gi|309780260|ref|ZP_07675011.1| SMF family protein [Ralstonia sp. 5_7_47FAA]
 gi|308920963|gb|EFP66609.1| SMF family protein [Ralstonia sp. 5_7_47FAA]
          Length = 401

 Score = 61.8 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 13/50 (26%), Positives = 22/50 (44%)

Query: 36  RVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
              +  +L   P+ +D +   TG  A  +   LL L+L  R+   P G+ 
Sbjct: 348 ETALLGALGFDPVDLDTLCERTGQAAAALSSQLLALELDSRVERQPGGRF 397


>gi|303240294|ref|ZP_07326813.1| DNA protecting protein DprA [Acetivibrio cellulolyticus CD2]
 gi|302592204|gb|EFL61933.1| DNA protecting protein DprA [Acetivibrio cellulolyticus CD2]
          Length = 369

 Score = 61.8 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 17/54 (31%), Positives = 27/54 (50%)

Query: 36  RVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTM 89
            V+I + L   P HID I + TG+   V+  V++ L+L G +   P     L +
Sbjct: 316 EVKIVECLKLEPTHIDIIANKTGLNIKVINSVIVMLELKGLVEQLPGKVYKLKL 369


>gi|320161003|ref|YP_004174227.1| putative DNA processing protein [Anaerolinea thermophila UNI-1]
 gi|319994856|dbj|BAJ63627.1| putative DNA processing protein [Anaerolinea thermophila UNI-1]
          Length = 370

 Score = 61.8 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 13/77 (16%), Positives = 25/77 (32%)

Query: 4   PQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPV 63
           P +           +                   +I ++L   P+HID+I     +    
Sbjct: 276 PLLSAEEILEDLHLSRVSEKQTAKKVLPADPLEEKILKALEQQPLHIDEISIAIDLPVEQ 335

Query: 64  VYLVLLELDLAGRLCHH 80
           V  +L  ++L G + H 
Sbjct: 336 VSAILTFMELKGLVRHL 352


>gi|206890890|ref|YP_002248891.1| DNA processing protein DprA [Thermodesulfovibrio yellowstonii DSM
           11347]
 gi|206742828|gb|ACI21885.1| DNA processing protein DprA [Thermodesulfovibrio yellowstonii DSM
           11347]
          Length = 368

 Score = 61.8 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 19/83 (22%), Positives = 32/83 (38%), Gaps = 1/83 (1%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVV 64
             E   F        T+  N T   +    +   +   LN  P+++D+II  TG+    V
Sbjct: 286 LEEIEQFIPLLKKITTELSNETTKTDRLDNDEKIVFNILN-EPLYLDEIILKTGMNTAKV 344

Query: 65  YLVLLELDLAGRLCHHPEGKVSL 87
             +LL L++ G +       V  
Sbjct: 345 LEILLSLEIDGLINKIEGKYVRR 367


>gi|259909965|ref|YP_002650321.1| DNA protecting protein [Erwinia pyrifoliae Ep1/96]
 gi|224965587|emb|CAX57119.1| DNA protecting protein [Erwinia pyrifoliae Ep1/96]
 gi|283480065|emb|CAY75981.1| Protein smf [Erwinia pyrifoliae DSM 12163]
          Length = 374

 Score = 61.8 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 16/79 (20%), Positives = 31/79 (39%), Gaps = 8/79 (10%)

Query: 9   NFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVL 68
              +  ++ +   N     +P+        +  ++ +    +D +    G   P +   L
Sbjct: 291 PVLTPLTNNSDAGNNPPLPFPD--------VLANVGDEVTPVDVVAERAGQPVPAIVAKL 342

Query: 69  LELDLAGRLCHHPEGKVSL 87
           LEL+LAG +   P G V L
Sbjct: 343 LELELAGWIAAVPGGYVRL 361


>gi|119509167|ref|ZP_01628318.1| SMF protein [Nodularia spumigena CCY9414]
 gi|119466333|gb|EAW47219.1| SMF protein [Nodularia spumigena CCY9414]
          Length = 372

 Score = 61.8 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 15/73 (20%), Positives = 29/73 (39%)

Query: 13  SQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELD 72
            + DT  T  I           E  ++  ++ +  +  D ++  TG+    V   LL+L+
Sbjct: 297 PKIDTIDTPPIPEQLNLPKLSSELQQVMDAIASDVLPFDYLVQKTGMNTGSVSSALLQLE 356

Query: 73  LAGRLCHHPEGKV 85
           L G +   P  + 
Sbjct: 357 LMGLVSQLPGMRY 369


>gi|212213457|ref|YP_002304393.1| DNA processing protein [Coxiella burnetii CbuG_Q212]
 gi|212011867|gb|ACJ19248.1| DNA processing protein [Coxiella burnetii CbuG_Q212]
          Length = 308

 Score = 61.8 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 12/67 (17%), Positives = 28/67 (41%)

Query: 21  KNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHH 80
           +    +   +       ++ + +      ID +I  +G  A +V  +LL ++L G +   
Sbjct: 241 EATGASAPIQALDKNEHKLLECIGFEVTSIDQLIARSGFSASIVASLLLRIELQGYIKST 300

Query: 81  PEGKVSL 87
           P G + +
Sbjct: 301 PGGVIRV 307


>gi|94266973|ref|ZP_01290622.1| SMF protein [delta proteobacterium MLMS-1]
 gi|93452328|gb|EAT02959.1| SMF protein [delta proteobacterium MLMS-1]
          Length = 381

 Score = 61.8 bits (149), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 18/88 (20%), Positives = 34/88 (38%)

Query: 1   MVHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIE 60
           +  P   +   +  +  +    I  T        E   +  +L+  P  I++II    + 
Sbjct: 293 LASPLTARFLPAKPAAASSAAAITTTPEATPANAEEQALLATLDGYPRDIEEIIAACRLP 352

Query: 61  APVVYLVLLELDLAGRLCHHPEGKVSLT 88
           AP V  +LLEL++ G +   P  +    
Sbjct: 353 APKVNALLLELEIRGLVESAPGPQYRRA 380


>gi|310765563|gb|ADP10513.1| DNA protecting protein [Erwinia sp. Ejp617]
          Length = 374

 Score = 61.4 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 16/79 (20%), Positives = 31/79 (39%), Gaps = 8/79 (10%)

Query: 9   NFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVL 68
              +  ++ +   N     +P+        +  ++ +    +D +    G   P +   L
Sbjct: 291 PVLTPLTNNSDAGNNPPLPFPD--------VLANVGDEVTPVDVVAERAGQPVPAIVAKL 342

Query: 69  LELDLAGRLCHHPEGKVSL 87
           LEL+LAG +   P G V L
Sbjct: 343 LELELAGWIAAVPGGYVRL 361


>gi|197333945|ref|YP_002157324.1| protein smf (DNA-processing chain A) [Vibrio fischeri MJ11]
 gi|197315435|gb|ACH64882.1| protein smf (DNA-processing chain A) [Vibrio fischeri MJ11]
          Length = 345

 Score = 61.4 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 10/49 (20%), Positives = 20/49 (40%)

Query: 38  RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
            +  ++      +D I     +    + + LLEL+L G +   P G + 
Sbjct: 293 EVFATVGGEATPVDIIAERCQMPVHEIMMQLLELELQGFIAAVPGGYIK 341


>gi|145220350|ref|YP_001131059.1| DNA protecting protein DprA [Prosthecochloris vibrioformis DSM 265]
 gi|145206514|gb|ABP37557.1| DNA protecting protein DprA [Chlorobium phaeovibrioides DSM 265]
          Length = 291

 Score = 61.4 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 14/72 (19%), Positives = 28/72 (38%)

Query: 17  TNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGR 76
           T                 E   + +++   PIHID++   +GI+   + L+L +L++   
Sbjct: 217 TRPGATAETRRPAAPFSAEESALLKAMGEEPIHIDELAQKSGIDYAGLLLLLFDLEMKSA 276

Query: 77  LCHHPEGKVSLT 88
           +   P      T
Sbjct: 277 IEQQPGQFFQRT 288


>gi|148978495|ref|ZP_01814969.1| Smf protein [Vibrionales bacterium SWAT-3]
 gi|145962402|gb|EDK27682.1| Smf protein [Vibrionales bacterium SWAT-3]
          Length = 370

 Score = 61.4 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 14/80 (17%), Positives = 27/80 (33%), Gaps = 11/80 (13%)

Query: 7   EQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYL 66
           + N F         + +   H           +  ++      +D +   T I    V +
Sbjct: 298 QPNLFEPTPSLEENEQLPFPH-----------LLANVGLEATPVDILAQRTHIPVHEVMM 346

Query: 67  VLLELDLAGRLCHHPEGKVS 86
            LLEL+L+G +     G + 
Sbjct: 347 QLLELELSGHVVAVSGGYIR 366


>gi|82701529|ref|YP_411095.1| DNA processing protein DprA, putative [Nitrosospira multiformis
           ATCC 25196]
 gi|82409594|gb|ABB73703.1| DNA protecting protein DprA [Nitrosospira multiformis ATCC 25196]
          Length = 372

 Score = 61.4 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 15/65 (23%), Positives = 28/65 (43%), Gaps = 2/65 (3%)

Query: 25  ITHYPEYTQCERVR--IKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPE 82
               PE  +  R    + + L++  I +D +   +G+    V  +LL L+L G +   P 
Sbjct: 306 PILVPEGGEAAREEFLLLKHLSHDIIDVDTLCLRSGLTVETVSAMLLTLELDGIIASLPG 365

Query: 83  GKVSL 87
           G+   
Sbjct: 366 GRYQR 370


>gi|83642945|ref|YP_431380.1| DNA uptake Rossmann fold nucleotide-binding protein [Hahella
           chejuensis KCTC 2396]
 gi|83630988|gb|ABC26955.1| predicted Rossmann fold nucleotide-binding protein involved in DNA
           uptake [Hahella chejuensis KCTC 2396]
          Length = 389

 Score = 61.4 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 10/74 (13%), Positives = 26/74 (35%)

Query: 13  SQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELD 72
           +  +    ++            +   + + +       D ++  TG+    +  VL+EL+
Sbjct: 313 AAEEFPGQQSQPEPASLRPLSEQAEAVLKGMGYDCTPPDALVERTGLSIAEIRSVLIELE 372

Query: 73  LAGRLCHHPEGKVS 86
           L G +     G + 
Sbjct: 373 LEGWVQEVAGGFIR 386


>gi|213621787|ref|ZP_03374570.1| hypothetical protein SentesTyp_31382 [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-2068]
          Length = 177

 Score = 61.4 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 17/78 (21%), Positives = 32/78 (41%), Gaps = 6/78 (7%)

Query: 10  FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLL 69
             ++  ++ ++ N +    P         +  ++ +    +D +    G   P V   LL
Sbjct: 93  LPTTAENSLYSLNQDEAALPFP------ELLANVGDEVTPVDVVAERAGQPVPAVVAQLL 146

Query: 70  ELDLAGRLCHHPEGKVSL 87
           EL+LAG +   P G V L
Sbjct: 147 ELELAGWIAAVPGGYVRL 164


>gi|164685831|ref|ZP_01945729.2| DNA protecting protein DprA [Coxiella burnetii 'MSU Goat Q177']
 gi|165918185|ref|ZP_02218271.1| DNA protecting protein DprA [Coxiella burnetii RSA 334]
 gi|164601347|gb|EAX33608.2| DNA protecting protein DprA [Coxiella burnetii 'MSU Goat Q177']
 gi|165918045|gb|EDR36649.1| DNA protecting protein DprA [Coxiella burnetii RSA 334]
          Length = 296

 Score = 61.4 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 12/67 (17%), Positives = 28/67 (41%)

Query: 21  KNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHH 80
           +    +   +       ++ + +      ID +I  +G  A +V  +LL ++L G +   
Sbjct: 229 EATGASAPIQALDKNEHKLLECIGFEVTSIDQLIARSGFSASIVASLLLRIELQGYIKST 288

Query: 81  PEGKVSL 87
           P G + +
Sbjct: 289 PGGVIRV 295


>gi|311277760|ref|YP_003939991.1| DNA protecting protein DprA [Enterobacter cloacae SCF1]
 gi|308746955|gb|ADO46707.1| DNA protecting protein DprA [Enterobacter cloacae SCF1]
          Length = 374

 Score = 61.4 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 14/50 (28%), Positives = 22/50 (44%)

Query: 38  RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
            +  ++ +    +D +    G   P     LLEL+LAG +   P G V L
Sbjct: 312 ALLANVGDEVTPVDVVAERAGQPVPETVAQLLELELAGWIAAVPGGYVRL 361


>gi|271502212|ref|YP_003335238.1| DNA protecting protein DprA [Dickeya dadantii Ech586]
 gi|270345767|gb|ACZ78532.1| DNA protecting protein DprA [Dickeya dadantii Ech586]
          Length = 377

 Score = 61.4 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 13/51 (25%), Positives = 23/51 (45%)

Query: 37  VRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
             +  ++ +    +D +    G   P V   LL+L+LAG +   P G V +
Sbjct: 314 ADVLATVGDEVTPVDVVAERAGQPVPEVVSKLLDLELAGWIAAVPGGYVRI 364


>gi|154247839|ref|YP_001418797.1| DNA protecting protein DprA [Xanthobacter autotrophicus Py2]
 gi|154161924|gb|ABS69140.1| DNA protecting protein DprA [Xanthobacter autotrophicus Py2]
          Length = 378

 Score = 61.4 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 26/79 (32%), Positives = 34/79 (43%)

Query: 9   NFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVL 68
                Q          I       +  R R+   L  VP  IDD++  +G     V +VL
Sbjct: 299 PMAGRQGPDAIEAESPIMEPAMPGEDARARVVGLLGPVPTLIDDLVRLSGCSVAEVQIVL 358

Query: 69  LELDLAGRLCHHPEGKVSL 87
           LELDLAGRL     G+V+L
Sbjct: 359 LELDLAGRLDRPGTGRVAL 377


>gi|209693701|ref|YP_002261629.1| Smf protein [Aliivibrio salmonicida LFI1238]
 gi|208007652|emb|CAQ77762.1| Smf protein [Aliivibrio salmonicida LFI1238]
          Length = 369

 Score = 61.4 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 10/49 (20%), Positives = 20/49 (40%)

Query: 38  RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
           ++  ++      +D I          + + LLEL+L G +   P G + 
Sbjct: 317 KVFATVGIEATPVDIIAERCQTPVHEIMMQLLELELQGFITAVPGGYIK 365


>gi|212219505|ref|YP_002306292.1| DNA processing protein [Coxiella burnetii CbuK_Q154]
 gi|212013767|gb|ACJ21147.1| DNA processing protein [Coxiella burnetii CbuK_Q154]
          Length = 308

 Score = 61.4 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 12/67 (17%), Positives = 28/67 (41%)

Query: 21  KNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHH 80
           +    +   +       ++ + +      ID +I  +G  A +V  +LL ++L G +   
Sbjct: 241 EATGASAPIQALDKNEHKLLECIGFEVTSIDQLIARSGFSASIVASLLLRIELQGYIKST 300

Query: 81  PEGKVSL 87
           P G + +
Sbjct: 301 PGGVIRV 307


>gi|332881647|ref|ZP_08449295.1| DNA protecting protein DprA [Capnocytophaga sp. oral taxon 329 str.
           F0087]
 gi|332680286|gb|EGJ53235.1| DNA protecting protein DprA [Capnocytophaga sp. oral taxon 329 str.
           F0087]
          Length = 373

 Score = 61.4 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 15/84 (17%), Positives = 27/84 (32%), Gaps = 1/84 (1%)

Query: 6   IEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSL-NNVPIHIDDIIHHTGIEAPVV 64
           +E   +  +S  N                E  RI   L  +  + I+ +   T +    +
Sbjct: 290 MEAMGWQPRSSENQKDKGIQGELFPDLCEEEQRIVDCLRQSECLQINTLAVATNLPVHKL 349

Query: 65  YLVLLELDLAGRLCHHPEGKVSLT 88
              L  L++ G +     G   LT
Sbjct: 350 SAFLFNLEMKGIVKLLSGGMYRLT 373


>gi|254294345|ref|YP_003060368.1| DNA protecting protein DprA [Hirschia baltica ATCC 49814]
 gi|254042876|gb|ACT59671.1| DNA protecting protein DprA [Hirschia baltica ATCC 49814]
          Length = 373

 Score = 61.4 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 16/79 (20%), Positives = 26/79 (32%)

Query: 8   QNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLV 67
           +N                    + +      +  +L+  P HID+++         V   
Sbjct: 291 ENSIPPMLAEPEAPTFETLSMIDVSLSTIQSLTMALSPTPTHIDELVRVVRAPLREVNAA 350

Query: 68  LLELDLAGRLCHHPEGKVS 86
           L EL+L G    H  G VS
Sbjct: 351 LTELELDGIAQTHAGGYVS 369


>gi|94312498|ref|YP_585708.1| DNA processing protein DprA, putative [Cupriavidus metallidurans
           CH34]
 gi|93356350|gb|ABF10439.1| DNA processing protein (DprA/Smf type) [Cupriavidus metallidurans
           CH34]
 gi|222838659|gb|EEE77024.1| predicted protein [Populus trichocarpa]
          Length = 371

 Score = 61.4 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 13/83 (15%), Positives = 28/83 (33%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVV 64
           +   + F    D     ++     P+           +L   P+  D +   +G+   + 
Sbjct: 287 ETPADVFEEFGDPGGVASVAPVPVPDSAPVPGDPFGAALAYDPVTFDALCERSGLAPHMA 346

Query: 65  YLVLLELDLAGRLCHHPEGKVSL 87
             +LLEL+L G +      +   
Sbjct: 347 AAMLLELELGGTVERMAGNRYRR 369


>gi|114462408|gb|ABI75144.1| SMF protein [Anabaena circinalis AWQC131C]
          Length = 310

 Score = 61.4 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 18/73 (24%), Positives = 28/73 (38%)

Query: 13  SQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELD 72
            Q D      +  +        E  +I   L    +  D II  TG+ A +V   LL+L+
Sbjct: 235 PQIDIETETPLVKSPPIPNLAPELQQIINILAVDALSFDFIIQKTGMNAAIVSSSLLQLE 294

Query: 73  LAGRLCHHPEGKV 85
           L G +   P  + 
Sbjct: 295 LMGLVTQLPGMRY 307


>gi|325925738|ref|ZP_08187113.1| putative Rossmann fold nucleotide-binding protein involved in DNA
           uptake [Xanthomonas perforans 91-118]
 gi|325543866|gb|EGD15274.1| putative Rossmann fold nucleotide-binding protein involved in DNA
           uptake [Xanthomonas perforans 91-118]
          Length = 264

 Score = 61.0 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 13/76 (17%), Positives = 32/76 (42%)

Query: 11  FSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLE 70
            ++ ++       +    P  +  +  R+ Q+L + P  +D ++  TG+ A  +  +LL 
Sbjct: 187 LAAPTELPSKATTSAGAGPARSDPDYQRLWQALGHDPTPMDSLVQRTGLTAAALSSMLLI 246

Query: 71  LDLAGRLCHHPEGKVS 86
           ++L G +         
Sbjct: 247 MELEGDVVTEHGRYTR 262


>gi|83589873|ref|YP_429882.1| DNA processing protein DprA, putative [Moorella thermoacetica ATCC
           39073]
 gi|83572787|gb|ABC19339.1| DNA protecting protein DprA [Moorella thermoacetica ATCC 39073]
          Length = 361

 Score = 61.0 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 13/66 (19%), Positives = 23/66 (34%)

Query: 22  NINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHP 81
               T           ++   L   P H+D I+  TG+ A  +   L+ L++   +   P
Sbjct: 295 PREETRASVTLNAIEEKVLAVLEATPSHLDVIMAATGLPAGELNTALIMLEMKQLIRRLP 354

Query: 82  EGKVSL 87
            G    
Sbjct: 355 GGFYVR 360


>gi|323179179|gb|EFZ64753.1| protein smf domain protein [Escherichia coli 1180]
          Length = 140

 Score = 61.0 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 17/71 (23%), Positives = 27/71 (38%), Gaps = 2/71 (2%)

Query: 19  HTKNINITHYPEYTQCERV--RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGR 76
                N  + P+          +  ++ +    +D +    G   P V   LLEL+LAG 
Sbjct: 57  PDAPENSFYSPDQQDVALPFPELLANVGDEVTPVDVVAERAGQPVPEVVTQLLELELAGW 116

Query: 77  LCHHPEGKVSL 87
           +   P G V L
Sbjct: 117 IAAVPGGYVRL 127


>gi|255034029|ref|YP_003084650.1| DNA protecting protein DprA [Dyadobacter fermentans DSM 18053]
 gi|254946785|gb|ACT91485.1| DNA protecting protein DprA [Dyadobacter fermentans DSM 18053]
          Length = 372

 Score = 61.0 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 16/72 (22%), Positives = 29/72 (40%), Gaps = 4/72 (5%)

Query: 20  TKNINITHYP---EYTQCERVRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLLELDLAG 75
            +++     P   E    +  ++   L  + P  ID++   TGI    +  +LL L+  G
Sbjct: 300 PESVPAEAQPVSFEGFTQDEGQVLALLKQHGPTQIDELAWQTGIHLNRLASLLLNLEFQG 359

Query: 76  RLCHHPEGKVSL 87
            +   P  K  L
Sbjct: 360 MVRSMPGKKYGL 371


>gi|325677793|ref|ZP_08157435.1| putative DNA protecting protein DprA [Ruminococcus albus 8]
 gi|324110347|gb|EGC04521.1| putative DNA protecting protein DprA [Ruminococcus albus 8]
          Length = 370

 Score = 61.0 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 14/71 (19%), Positives = 26/71 (36%), Gaps = 2/71 (2%)

Query: 20  TKNINITHYPEYT-QCERVRIKQSLN-NVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRL 77
            K       P         RI   LN +  +H+D++    G+    V   L  L++ G +
Sbjct: 300 AKRSPAKKTPAIDADSSEGRIFAELNEHGELHVDELAAKCGMGMAEVMAALTSLEIDGMV 359

Query: 78  CHHPEGKVSLT 88
              P  +  ++
Sbjct: 360 KSLPGRRYVVS 370


>gi|292489812|ref|YP_003532702.1| protein Smf [Erwinia amylovora CFBP1430]
 gi|292900854|ref|YP_003540223.1| hypothetical protein EAM_3161 [Erwinia amylovora ATCC 49946]
 gi|291200702|emb|CBJ47835.1| conserved hypothetical protein [Erwinia amylovora ATCC 49946]
 gi|291555249|emb|CBA23520.1| Protein smf [Erwinia amylovora CFBP1430]
 gi|312173995|emb|CBX82248.1| Protein smf [Erwinia amylovora ATCC BAA-2158]
          Length = 374

 Score = 61.0 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 16/79 (20%), Positives = 31/79 (39%), Gaps = 8/79 (10%)

Query: 9   NFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVL 68
              +  ++ +   N     +P+        +  ++ +    +D +    G   P +   L
Sbjct: 291 PVITPLTNNSGAGNNPPLPFPD--------VLANVGDEVTPVDVVAERAGQPVPAIVAKL 342

Query: 69  LELDLAGRLCHHPEGKVSL 87
           LEL+LAG +   P G V L
Sbjct: 343 LELELAGWIAAVPGGYVRL 361


>gi|296161361|ref|ZP_06844168.1| DNA protecting protein DprA [Burkholderia sp. Ch1-1]
 gi|295888347|gb|EFG68158.1| DNA protecting protein DprA [Burkholderia sp. Ch1-1]
          Length = 421

 Score = 61.0 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 19/89 (21%), Positives = 36/89 (40%)

Query: 2   VHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEA 61
           V P+      ++ S  +     N          E  R+  +L + P  ++ +   T +E 
Sbjct: 332 VRPKPATAQTAAASAADSATAPNPAPPRRPVDPEAERLLTALGHSPTTLEILATRTEMED 391

Query: 62  PVVYLVLLELDLAGRLCHHPEGKVSLTMH 90
             +   LL+L+LAG++   P G+     H
Sbjct: 392 AALQSTLLQLELAGQVTVLPGGRFMRASH 420


>gi|209364274|ref|YP_001425403.2| DNA processing protein [Coxiella burnetii Dugway 5J108-111]
 gi|207082207|gb|ABS77073.2| DNA processing protein [Coxiella burnetii Dugway 5J108-111]
          Length = 308

 Score = 61.0 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 12/67 (17%), Positives = 28/67 (41%)

Query: 21  KNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHH 80
           +    +   +       ++ + +      ID +I  +G  A +V  +LL ++L G +   
Sbjct: 241 EATGASAPIQALDKNEHKLLECIGFEVTSIDQLIARSGFSASIVASLLLRIELQGYIKST 300

Query: 81  PEGKVSL 87
           P G + +
Sbjct: 301 PGGVIRV 307


>gi|264668112|gb|ACY71500.1| SMF protein [Anabaena circinalis AWQC310F]
          Length = 208

 Score = 61.0 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 18/73 (24%), Positives = 28/73 (38%)

Query: 13  SQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELD 72
            Q D      +  +        E  +I   L    +  D II  TG+ A +V   LL+L+
Sbjct: 133 PQIDIETETPLVKSPPIPNLAPELQQIINILAIDALSFDFIIQKTGMNAAIVSSSLLQLE 192

Query: 73  LAGRLCHHPEGKV 85
           L G +   P  + 
Sbjct: 193 LMGLVTQLPGMRY 205


>gi|301058272|ref|ZP_07199312.1| DNA protecting protein DprA [delta proteobacterium NaphS2]
 gi|300447606|gb|EFK11331.1| DNA protecting protein DprA [delta proteobacterium NaphS2]
          Length = 369

 Score = 61.0 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 15/79 (18%), Positives = 33/79 (41%)

Query: 9   NFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVL 68
             +    +T        +    + +   +++ + + N P+HID I     ++A  V +VL
Sbjct: 290 ELWFLTHETGTIDRNQKSLPSGHMEGVELKLYEIIGNYPMHIDQIARTGDMDAGQVAMVL 349

Query: 69  LELDLAGRLCHHPEGKVSL 87
           L+++L G +   P      
Sbjct: 350 LKMELNGTVRQLPGKMYVR 368


>gi|332533675|ref|ZP_08409534.1| Rossmann fold nucleotide-binding protein Smf possibly involved in
           DNA uptake [Pseudoalteromonas haloplanktis ANT/505]
 gi|332036839|gb|EGI73300.1| Rossmann fold nucleotide-binding protein Smf possibly involved in
           DNA uptake [Pseudoalteromonas haloplanktis ANT/505]
          Length = 363

 Score = 61.0 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 11/61 (18%), Positives = 23/61 (37%)

Query: 28  YPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
                   +  +  S+      +DDI+         V   LL+L+L  ++    +G + L
Sbjct: 300 EQPIQANSQCEVLNSIGFEVTSVDDIVRRAQWPIDKVLSRLLDLELDDQIERVLDGYIKL 359

Query: 88  T 88
           +
Sbjct: 360 S 360


>gi|317494306|ref|ZP_07952720.1| DNA protecting protein DprA [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316917556|gb|EFV38901.1| DNA protecting protein DprA [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 377

 Score = 61.0 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 16/61 (26%), Positives = 25/61 (40%), Gaps = 2/61 (3%)

Query: 29  PEYTQCER--VRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
           PE    E     +  ++      +D +    G   P V + LL+L+LAG +     G V 
Sbjct: 304 PERDDVELPFADVLANVEYEVTSVDVVAERVGQPVPEVVVALLDLELAGWIKAVSGGYVR 363

Query: 87  L 87
           L
Sbjct: 364 L 364


>gi|110633709|ref|YP_673917.1| DNA protecting protein DprA [Mesorhizobium sp. BNC1]
 gi|110284693|gb|ABG62752.1| DNA protecting protein DprA [Chelativorans sp. BNC1]
          Length = 378

 Score = 61.0 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 35/75 (46%), Positives = 47/75 (62%)

Query: 13  SQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELD 72
             S  +  +  +++  P+  + ER  I Q+L   P+ +D+IIHHTG+ A  V LVLLELD
Sbjct: 299 PPSTADLEETPDLSATPDPGENERSLILQALGAAPVAVDEIIHHTGLPAAQVLLVLLELD 358

Query: 73  LAGRLCHHPEGKVSL 87
           LAGRL  H  GKVSL
Sbjct: 359 LAGRLERHAGGKVSL 373


>gi|260752380|ref|YP_003225273.1| DNA protecting protein DprA [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
 gi|258551743|gb|ACV74689.1| DNA protecting protein DprA [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
          Length = 385

 Score = 61.0 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 21/84 (25%), Positives = 42/84 (50%), Gaps = 3/84 (3%)

Query: 7   EQNFFSSQSDTNHTKNINITHYPEYTQ---CERVRIKQSLNNVPIHIDDIIHHTGIEAPV 63
           E++    +        I     P   +    +R  I+  + +  + ++++I  +G+E  +
Sbjct: 300 EKSPLEPRFSGLENGQIGYRSSPAIAEVKAKDREIIQSLIGSASVGVNELIRQSGLENAI 359

Query: 64  VYLVLLELDLAGRLCHHPEGKVSL 87
           +  +LLE++LAGRL  H  G+VSL
Sbjct: 360 IQTILLEMELAGRLESHAGGRVSL 383


>gi|299531888|ref|ZP_07045288.1| DNA protecting protein DprA [Comamonas testosteroni S44]
 gi|298720063|gb|EFI61020.1| DNA protecting protein DprA [Comamonas testosteroni S44]
          Length = 397

 Score = 61.0 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 14/82 (17%), Positives = 29/82 (35%), Gaps = 4/82 (4%)

Query: 8   QNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLV 67
           Q    + +     +                 + Q+L + P+ ++ +   TG +A  +   
Sbjct: 318 QGLKLASTRAEPAQEAAKNKASTPDNP----LLQALGHDPMTLESLSDRTGWDAAHLQAQ 373

Query: 68  LLELDLAGRLCHHPEGKVSLTM 89
           L+EL+L G +   P G      
Sbjct: 374 LMELELDGLVARLPGGLYQRLT 395


>gi|162421290|ref|YP_001605209.1| protein smf [Yersinia pestis Angola]
 gi|162354105|gb|ABX88053.1| protein smf [Yersinia pestis Angola]
          Length = 133

 Score = 60.6 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 14/68 (20%), Positives = 28/68 (41%)

Query: 20  TKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCH 79
            + + I+   E  +     +  ++ +    +D +    G     +   LLEL+LAG +  
Sbjct: 53  PEEVIISSPQEQVELPFADVLANVGDEVTPVDVVAERAGQPVQDIASKLLELELAGWIAA 112

Query: 80  HPEGKVSL 87
            P G V +
Sbjct: 113 VPGGYVRI 120


>gi|24371634|ref|NP_715676.1| DNA processing protein DprA, putative [Shewanella oneidensis MR-1]
 gi|24345393|gb|AAN53121.1|AE015455_2 DNA processing protein DprA, putative [Shewanella oneidensis MR-1]
          Length = 338

 Score = 60.6 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 14/49 (28%), Positives = 24/49 (48%)

Query: 39  IKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           +  S+      ID ++ H+G    +V   +LEL+L G +   P G V +
Sbjct: 287 LLASVGYETTAIDAVVEHSGKTIDLVLEQMLELELQGWVVAVPGGYVRV 335


>gi|126172290|ref|YP_001048439.1| DNA protecting protein DprA [Shewanella baltica OS155]
 gi|152998584|ref|YP_001364265.1| DNA protecting protein DprA [Shewanella baltica OS185]
 gi|125995495|gb|ABN59570.1| DNA protecting protein DprA [Shewanella baltica OS155]
 gi|151363202|gb|ABS06202.1| DNA protecting protein DprA [Shewanella baltica OS185]
          Length = 338

 Score = 60.6 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 14/49 (28%), Positives = 24/49 (48%)

Query: 39  IKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           +  S+      ID ++ H+G    +V   +LEL+L G +   P G V +
Sbjct: 287 LLASVGYETTSIDAVVEHSGKTIDLVLEQMLELELQGWVIAVPGGYVRV 335


>gi|161831372|ref|YP_001595979.1| DNA protecting protein DprA [Coxiella burnetii RSA 331]
 gi|161763239|gb|ABX78881.1| DNA protecting protein DprA [Coxiella burnetii RSA 331]
          Length = 296

 Score = 60.6 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 12/67 (17%), Positives = 28/67 (41%)

Query: 21  KNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHH 80
           +    +   +       ++ + +      ID +I  +G  A +V  +LL ++L G +   
Sbjct: 229 EATGASAPIQALDKNEHKLLECIGFEVTSIDQLIARSGFSASIVASLLLRIELQGYIKSR 288

Query: 81  PEGKVSL 87
           P G + +
Sbjct: 289 PGGVIRV 295


>gi|293393277|ref|ZP_06637591.1| DNA protecting protein DprA [Serratia odorifera DSM 4582]
 gi|291424187|gb|EFE97402.1| DNA protecting protein DprA [Serratia odorifera DSM 4582]
          Length = 373

 Score = 60.6 bits (146), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 14/70 (20%), Positives = 28/70 (40%)

Query: 18  NHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRL 77
              +   I+      +     +  ++ +    +D +    G   P V + LL+L+LAG +
Sbjct: 291 AMDEKTTISASEAEVELPFADVLANVGDEVTPVDVVAERAGQPVPEVVIQLLDLELAGWI 350

Query: 78  CHHPEGKVSL 87
              P G V +
Sbjct: 351 AAVPGGYVRI 360


>gi|264680867|ref|YP_003280777.1| DNA protecting protein DprA [Comamonas testosteroni CNB-2]
 gi|262211383|gb|ACY35481.1| DNA protecting protein DprA [Comamonas testosteroni CNB-2]
          Length = 397

 Score = 60.6 bits (146), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 14/82 (17%), Positives = 29/82 (35%), Gaps = 4/82 (4%)

Query: 8   QNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLV 67
           Q    + +     +                 + Q+L + P+ ++ +   TG +A  +   
Sbjct: 318 QGLKLASTRAEPAQEAAKNKASTPDNP----LLQALGHDPMTLESLSDRTGWDAAHLQAQ 373

Query: 68  LLELDLAGRLCHHPEGKVSLTM 89
           L+EL+L G +   P G      
Sbjct: 374 LMELELDGLVARLPGGLYQRLT 395


>gi|270264339|ref|ZP_06192605.1| DNA protecting protein DprA [Serratia odorifera 4Rx13]
 gi|270041475|gb|EFA14573.1| DNA protecting protein DprA [Serratia odorifera 4Rx13]
          Length = 373

 Score = 60.6 bits (146), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 13/51 (25%), Positives = 24/51 (47%)

Query: 37  VRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
             +  ++ +    +D +    G   P V + LL+L+LAG +   P G V +
Sbjct: 310 ADVLANVGDEVTPVDVVAERAGQPVPEVVIKLLDLELAGWIAAVPGGYVRI 360


>gi|227538460|ref|ZP_03968509.1| SMF family DNA processing protein [Sphingobacterium spiritivorum
           ATCC 33300]
 gi|227241646|gb|EEI91661.1| SMF family DNA processing protein [Sphingobacterium spiritivorum
           ATCC 33300]
          Length = 370

 Score = 60.6 bits (146), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 17/74 (22%), Positives = 30/74 (40%), Gaps = 1/74 (1%)

Query: 15  SDTNHTKNINITHYPEYTQCERVRIKQSLNNV-PIHIDDIIHHTGIEAPVVYLVLLELDL 73
            +     +  ++  P     E+ +I Q L    P  ID+I  H  +    + + LLEL++
Sbjct: 291 QEQQQKPSAQLSLLPPQLSEEQEKIYQFLQQQNPAPIDEIAIHCALPQSQLAISLLELEM 350

Query: 74  AGRLCHHPEGKVSL 87
            G +   P     L
Sbjct: 351 EGIILSMPGKVYKL 364


>gi|325924331|ref|ZP_08185875.1| DNA protecting protein DprA [Xanthomonas gardneri ATCC 19865]
 gi|325545196|gb|EGD16506.1| DNA protecting protein DprA [Xanthomonas gardneri ATCC 19865]
          Length = 378

 Score = 60.6 bits (146), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 12/86 (13%), Positives = 30/86 (34%)

Query: 1   MVHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIE 60
           ++  ++        +                   +  R+ Q+L + P  +D ++  TG+ 
Sbjct: 291 LLSGELADALRQRLAAPTDQARTAPKASTARPDPDYQRLWQALGHDPTPMDALVERTGLT 350

Query: 61  APVVYLVLLELDLAGRLCHHPEGKVS 86
           A  +  +LL ++L G +         
Sbjct: 351 AATLSSMLLIMELEGDVVTEHGRYTR 376


>gi|218710996|ref|YP_002418617.1| Smf protein [Vibrio splendidus LGP32]
 gi|218324015|emb|CAV20377.1| Smf protein [Vibrio splendidus LGP32]
          Length = 370

 Score = 60.6 bits (146), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 12/80 (15%), Positives = 27/80 (33%), Gaps = 11/80 (13%)

Query: 7   EQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYL 66
           + + F         + +              ++  ++      +D +   T I    V +
Sbjct: 298 QPSLFEPTPSMGENEQLPFP-----------QLLANVGLEATPVDILAQRTHIPVHEVMM 346

Query: 67  VLLELDLAGRLCHHPEGKVS 86
            LLEL+L+G +     G + 
Sbjct: 347 QLLELELSGHVVAVSGGYIR 366


>gi|167630278|ref|YP_001680777.1| DNA processing protein dpra, putative [Heliobacterium modesticaldum
           Ice1]
 gi|167593018|gb|ABZ84766.1| DNA processing protein dpra, putative [Heliobacterium modesticaldum
           Ice1]
          Length = 378

 Score = 60.6 bits (146), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 14/77 (18%), Positives = 26/77 (33%)

Query: 7   EQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYL 66
           +     S    +  + ++             RI + L+  P   D++    G+    V  
Sbjct: 297 QLTLPLSAPAHSSDEQLSENRLSSDQSEAERRILEILDWEPRSADELAARLGLSGSEVAA 356

Query: 67  VLLELDLAGRLCHHPEG 83
            L  L+L GR+     G
Sbjct: 357 ALTLLELKGRVQMERGG 373


>gi|297537403|ref|YP_003673172.1| DNA protecting protein DprA [Methylotenera sp. 301]
 gi|297256750|gb|ADI28595.1| DNA protecting protein DprA [Methylotenera sp. 301]
          Length = 371

 Score = 60.6 bits (146), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 11/49 (22%), Positives = 24/49 (48%)

Query: 37  VRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
             I   +   PI ++++++ +G+    V  +L+ L+L G +     GK 
Sbjct: 319 HAILTLMGYEPIALENLVNLSGLTVSEVSSMLMLLELEGSVASLAGGKY 367


>gi|304412737|ref|ZP_07394340.1| DNA protecting protein DprA [Shewanella baltica OS183]
 gi|307305798|ref|ZP_07585544.1| DNA protecting protein DprA [Shewanella baltica BA175]
 gi|304348947|gb|EFM13362.1| DNA protecting protein DprA [Shewanella baltica OS183]
 gi|306911291|gb|EFN41717.1| DNA protecting protein DprA [Shewanella baltica BA175]
          Length = 338

 Score = 60.6 bits (146), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 14/49 (28%), Positives = 24/49 (48%)

Query: 39  IKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           +  S+      ID ++ H+G    +V   +LEL+L G +   P G V +
Sbjct: 287 LLASVGYETTSIDAVVEHSGKTIDLVLEQMLELELQGWVIAVPGGYVRV 335


>gi|315265384|gb|ADT92237.1| DNA protecting protein DprA [Shewanella baltica OS678]
          Length = 362

 Score = 60.6 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 14/49 (28%), Positives = 24/49 (48%)

Query: 39  IKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           +  S+      ID ++ H+G    +V   +LEL+L G +   P G V +
Sbjct: 311 LLASVGYETTSIDAVVEHSGKTIDLVLEQMLELELQGWVIAVPGGYVRV 359


>gi|217971249|ref|YP_002356000.1| DNA protecting protein DprA [Shewanella baltica OS223]
 gi|217496384|gb|ACK44577.1| DNA protecting protein DprA [Shewanella baltica OS223]
          Length = 338

 Score = 60.6 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 14/49 (28%), Positives = 24/49 (48%)

Query: 39  IKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           +  S+      ID ++ H+G    +V   +LEL+L G +   P G V +
Sbjct: 287 LLASVGYETTSIDAVVEHSGKTIDLVLEQMLELELQGWVIAVPGGYVRV 335


>gi|160873159|ref|YP_001552475.1| DNA protecting protein DprA [Shewanella baltica OS195]
 gi|160858681|gb|ABX47215.1| DNA protecting protein DprA [Shewanella baltica OS195]
          Length = 338

 Score = 60.6 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 14/49 (28%), Positives = 24/49 (48%)

Query: 39  IKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           +  S+      ID ++ H+G    +V   +LEL+L G +   P G V +
Sbjct: 287 LLASVGYETTSIDAVVEHSGKTIDLVLEQMLELELQGWVIAVPGGYVRV 335


>gi|78049484|ref|YP_365659.1| DNA processing chain A [Xanthomonas campestris pv. vesicatoria str.
           85-10]
 gi|78037914|emb|CAJ25659.1| DNA processing chain A [Xanthomonas campestris pv. vesicatoria str.
           85-10]
          Length = 381

 Score = 60.6 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 12/74 (16%), Positives = 31/74 (41%)

Query: 11  FSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLE 70
            ++ ++       +    P  +  +  R+ Q+L + P  +D ++  TG+    +  +LL 
Sbjct: 304 LAAPTELPSKATTSAGAGPARSDPDYQRLWQALGHDPTPMDSLVQRTGLTVAALSSMLLI 363

Query: 71  LDLAGRLCHHPEGK 84
           ++L G +       
Sbjct: 364 MELEGDVVTEHGRY 377


>gi|89055649|ref|YP_511100.1| DNA processing protein DprA, putative [Jannaschia sp. CCS1]
 gi|88865198|gb|ABD56075.1| DNA protecting protein DprA [Jannaschia sp. CCS1]
          Length = 402

 Score = 60.6 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 14/86 (16%), Positives = 24/86 (27%)

Query: 1   MVHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIE 60
           ++                  +    T           RI   L   P+  D +I      
Sbjct: 315 VIEALGRPAQSGDAPSAVVHELQRPTPAAAKDGGLEGRILAHLGPTPVAEDQMIRDLNAT 374

Query: 61  APVVYLVLLELDLAGRLCHHPEGKVS 86
              +   L  L+++GR+     G VS
Sbjct: 375 PREMAQALAVLEMSGRVTRSAGGMVS 400


>gi|238758794|ref|ZP_04619968.1| hypothetical protein yaldo0001_32100 [Yersinia aldovae ATCC 35236]
 gi|238703091|gb|EEP95634.1| hypothetical protein yaldo0001_32100 [Yersinia aldovae ATCC 35236]
          Length = 373

 Score = 60.2 bits (145), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 13/51 (25%), Positives = 23/51 (45%)

Query: 37  VRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
             +  ++ +    +D +    G   P +   LLEL+LAG +   P G V +
Sbjct: 310 ADVLANVGDEVTPVDVVAERAGQPVPDIVSKLLELELAGWVAAVPGGYVRI 360


>gi|260575925|ref|ZP_05843920.1| DNA protecting protein DprA [Rhodobacter sp. SW2]
 gi|259021851|gb|EEW25152.1| DNA protecting protein DprA [Rhodobacter sp. SW2]
          Length = 378

 Score = 60.2 bits (145), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 16/69 (23%), Positives = 25/69 (36%)

Query: 20  TKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCH 79
              +              +I   L   P+  D +I    + A +V   LL L+L G+L  
Sbjct: 309 PGPVPAPRSLSEVAALHGQILARLGPSPLAEDQLIRDLAVPAALVVPELLSLELEGKLLR 368

Query: 80  HPEGKVSLT 88
              G +S T
Sbjct: 369 QAGGLLSRT 377


>gi|332531649|ref|ZP_08407546.1| DNA protecting protein dpra [Hylemonella gracilis ATCC 19624]
 gi|332039012|gb|EGI75441.1| DNA protecting protein dpra [Hylemonella gracilis ATCC 19624]
          Length = 416

 Score = 60.2 bits (145), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 11/72 (15%), Positives = 26/72 (36%)

Query: 20  TKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCH 79
              ++      +    +  +  +L   P+ +D +   TG     +   L+ L+L G +  
Sbjct: 345 EDAVDADEAEAHGSEPQDALLAALGADPVSLDALQARTGWPTAQLQAKLMALELNGEVAR 404

Query: 80  HPEGKVSLTMHL 91
            P G +   +  
Sbjct: 405 MPGGLLQRLVRA 416


>gi|7466920|pir||H65120 smf protein - Escherichia coli (strain K-12)
 gi|606219|gb|AAA58082.1| ORF_f102; ORF created by difference between our sequence and
          ECSMFSMG [Escherichia coli str. K-12 substr. MG1655]
          Length = 102

 Score = 60.2 bits (145), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 17/71 (23%), Positives = 27/71 (38%), Gaps = 2/71 (2%)

Query: 19 HTKNINITHYPEYTQCERV--RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGR 76
               N  + P+          +  ++ +    +D +    G   P V   LLEL+LAG 
Sbjct: 19 PDAPENSFYSPDQQDVALPFPELLANVGDEVTPVDVVAERAGQPVPEVVTQLLELELAGW 78

Query: 77 LCHHPEGKVSL 87
          +   P G V L
Sbjct: 79 IAAVPGGYVRL 89


>gi|319424443|gb|ADV52517.1| DNA protecting protein DprA [Shewanella putrefaciens 200]
          Length = 362

 Score = 60.2 bits (145), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 14/49 (28%), Positives = 24/49 (48%)

Query: 39  IKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           +  S+      ID ++ H+G    +V   +LEL+L G +   P G V +
Sbjct: 311 LLASVGYETTTIDAVVEHSGKTIDLVLEQMLELELQGWVIAVPGGYVRV 359


>gi|29655281|ref|NP_820973.1| DNA protecting protein DprA [Coxiella burnetii RSA 493]
 gi|29542553|gb|AAO91487.1| DNA processing protein [Coxiella burnetii RSA 493]
          Length = 308

 Score = 60.2 bits (145), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 12/67 (17%), Positives = 28/67 (41%)

Query: 21  KNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHH 80
           +    +   +       ++ + +      ID +I  +G  A +V  +LL ++L G +   
Sbjct: 241 EATGASAPIQALDKNEHKLLECIGFEVTSIDQLIARSGFSASIVASLLLRIELQGYIKSR 300

Query: 81  PEGKVSL 87
           P G + +
Sbjct: 301 PGGVIRV 307


>gi|296104993|ref|YP_003615139.1| DNA protecting protein DprA [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
 gi|295059452|gb|ADF64190.1| DNA protecting protein DprA [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
          Length = 379

 Score = 60.2 bits (145), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 15/49 (30%), Positives = 23/49 (46%)

Query: 39  IKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           +  ++ +    +D +    G   PV    LLEL+LAG +   P G V L
Sbjct: 318 LLANVGDEVTPVDVVAERAGQPVPVTVAQLLELELAGWIAAVPGGYVRL 366


>gi|188993327|ref|YP_001905337.1| DNA processing chain A [Xanthomonas campestris pv. campestris str.
           B100]
 gi|167735087|emb|CAP53299.1| DNA processing chain A [Xanthomonas campestris pv. campestris]
          Length = 378

 Score = 60.2 bits (145), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 15/75 (20%), Positives = 30/75 (40%), Gaps = 2/75 (2%)

Query: 14  QSDTNHTKNINITHYPEY--TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLEL 71
           Q  T  T+       P    +  +  R+  +L + P  +D ++  TG+ A  +  +LL +
Sbjct: 302 QRLTAPTEQARTVPQPTPRRSDPDYQRLWHALGHDPTPMDSLLERTGLTAAALSSMLLIM 361

Query: 72  DLAGRLCHHPEGKVS 86
           +L G +         
Sbjct: 362 ELEGDVVTEHGRYTR 376


>gi|290477160|ref|YP_003470075.1| protein smf [Xenorhabdus bovienii SS-2004]
 gi|289176508|emb|CBJ83317.1| Protein smf [Xenorhabdus bovienii SS-2004]
          Length = 358

 Score = 60.2 bits (145), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 10/52 (19%), Positives = 23/52 (44%)

Query: 37  VRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
             +  ++++    +D I   + +    V   LLEL+L G++     G + + 
Sbjct: 307 ADVLVNVSHEVTPVDVIAQRSCLPVTEVMTRLLELELMGKVAVVAGGYIRVN 358


>gi|163751678|ref|ZP_02158897.1| DNA processing protein DprA, putative [Shewanella benthica KT99]
 gi|161328417|gb|EDP99573.1| DNA processing protein DprA, putative [Shewanella benthica KT99]
          Length = 339

 Score = 60.2 bits (145), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 15/51 (29%), Positives = 25/51 (49%)

Query: 37  VRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
             +  S+      IDD++ H+G    +V   +LEL+L G +   P G + L
Sbjct: 286 ASLLASVGYETTTIDDVVEHSGKAIDLVLEQMLELELQGWVAVVPGGYIRL 336


>gi|120596859|ref|YP_961433.1| DNA protecting protein DprA [Shewanella sp. W3-18-1]
 gi|146291137|ref|YP_001181561.1| DNA protecting protein DprA [Shewanella putrefaciens CN-32]
 gi|120556952|gb|ABM22879.1| DNA protecting protein DprA [Shewanella sp. W3-18-1]
 gi|145562827|gb|ABP73762.1| DNA protecting protein DprA [Shewanella putrefaciens CN-32]
          Length = 340

 Score = 60.2 bits (145), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 14/49 (28%), Positives = 24/49 (48%)

Query: 39  IKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           +  S+      ID ++ H+G    +V   +LEL+L G +   P G V +
Sbjct: 289 LLASVGYETTTIDAVVEHSGKTIDLVLEQMLELELQGWVIAVPGGYVRV 337


>gi|182680321|ref|YP_001834467.1| DNA protecting protein DprA [Beijerinckia indica subsp. indica ATCC
           9039]
 gi|182636204|gb|ACB96978.1| DNA protecting protein DprA [Beijerinckia indica subsp. indica ATCC
           9039]
          Length = 429

 Score = 60.2 bits (145), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 18/85 (21%), Positives = 32/85 (37%), Gaps = 4/85 (4%)

Query: 7   EQNFFSSQSDTNHTKNINITHYPEYTQCERV----RIKQSLNNVPIHIDDIIHHTGIEAP 62
           E+   +  +     ++  +         ++     RI   L   P+ +D++         
Sbjct: 341 EETVPTPAAALFSDESAVLIASDGQDHPDQASLKERIIALLGPAPVSVDELARAAASPPG 400

Query: 63  VVYLVLLELDLAGRLCHHPEGKVSL 87
            +  VLL L+L GRL  H    VSL
Sbjct: 401 ELQAVLLILELEGRLTRHGASLVSL 425


>gi|149910326|ref|ZP_01898969.1| Smf protein [Moritella sp. PE36]
 gi|149806574|gb|EDM66542.1| Smf protein [Moritella sp. PE36]
          Length = 368

 Score = 60.2 bits (145), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 11/50 (22%), Positives = 17/50 (34%)

Query: 37  VRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
             I  ++       D I   +      V   L+EL+L   +   P G V 
Sbjct: 314 QTILDNVGYEVTTADLIAERSQQPVSQVLTSLMELELDNWVNAVPGGYVR 363


>gi|86137984|ref|ZP_01056560.1| DNA processing protein DprA, putative [Roseobacter sp. MED193]
 gi|85825576|gb|EAQ45775.1| DNA processing protein DprA, putative [Roseobacter sp. MED193]
          Length = 368

 Score = 60.2 bits (145), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 13/83 (15%), Positives = 24/83 (28%), Gaps = 1/83 (1%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVV 64
             + +  +                 E T      I   L   P   D ++    +     
Sbjct: 284 LDQLSALTQALAGIPAPPAEKRSLQE-TSALHQMILAGLGPSPTASDQLMRDLDLSPQAF 342

Query: 65  YLVLLELDLAGRLCHHPEGKVSL 87
              L EL+L G++   P G ++ 
Sbjct: 343 APALTELELEGKISRIPGGLLAR 365


>gi|150390497|ref|YP_001320546.1| DNA protecting protein DprA [Alkaliphilus metalliredigens QYMF]
 gi|149950359|gb|ABR48887.1| DNA protecting protein DprA [Alkaliphilus metalliredigens QYMF]
          Length = 365

 Score = 60.2 bits (145), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 14/88 (15%), Positives = 31/88 (35%), Gaps = 2/88 (2%)

Query: 3   HPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIK--QSLNNVPIHIDDIIHHTGIE 60
            P +E +      +  +      T            I   + +   P+ ID +I+ TGI 
Sbjct: 277 KPLLEISNIIEDLEKIYRLESPQTAEQLERDLSEKEILVYKVIEENPVSIDAVINRTGIH 336

Query: 61  APVVYLVLLELDLAGRLCHHPEGKVSLT 88
              +  +L  L++ G +        +++
Sbjct: 337 ISELSALLTILEIKGFITQLSGNTFTVS 364


>gi|226942058|ref|YP_002797132.1| Rossmann fold nucleotide-binding protein involved in DNA uptake
           [Laribacter hongkongensis HLHK9]
 gi|226716986|gb|ACO76124.1| Predicted Rossmann fold nucleotide-binding protein involved in DNA
           uptake [Laribacter hongkongensis HLHK9]
          Length = 383

 Score = 60.2 bits (145), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 14/77 (18%), Positives = 30/77 (38%)

Query: 11  FSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLE 70
             S+     +  +  T      Q     +  +L    + +D ++  TG+    +  +LL 
Sbjct: 305 ILSELPPVLSPPVEETRSQAVPQAIEDAVLAALGAEILTLDSLVERTGLTVDTLLGMLLA 364

Query: 71  LDLAGRLCHHPEGKVSL 87
            +LAG++   P G+   
Sbjct: 365 HELAGQVVGLPGGRYQR 381


>gi|21233179|ref|NP_639096.1| DNA processing chain A [Xanthomonas campestris pv. campestris str.
           ATCC 33913]
 gi|66770119|ref|YP_244881.1| DNA processing chain A [Xanthomonas campestris pv. campestris str.
           8004]
 gi|21115029|gb|AAM43008.1| DNA processing chain A [Xanthomonas campestris pv. campestris str.
           ATCC 33913]
 gi|66575451|gb|AAY50861.1| DNA processing chain A [Xanthomonas campestris pv. campestris str.
           8004]
          Length = 378

 Score = 60.2 bits (145), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 15/75 (20%), Positives = 30/75 (40%), Gaps = 2/75 (2%)

Query: 14  QSDTNHTKNINITHYPEY--TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLEL 71
           Q  T  T+       P    +  +  R+  +L + P  +D ++  TG+ A  +  +LL +
Sbjct: 302 QRLTAPTEQARTVPQPTPRRSDPDYQRLWHALGHDPTPMDSLLERTGLTAAALSSMLLIM 361

Query: 72  DLAGRLCHHPEGKVS 86
           +L G +         
Sbjct: 362 ELEGDVVTEHGRYTR 376


>gi|113968377|ref|YP_732170.1| DNA protecting protein DprA [Shewanella sp. MR-4]
 gi|113883061|gb|ABI37113.1| DNA protecting protein DprA [Shewanella sp. MR-4]
          Length = 338

 Score = 60.2 bits (145), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 14/49 (28%), Positives = 24/49 (48%)

Query: 39  IKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           +  S+      ID ++ H+G    +V   +LEL+L G +   P G V +
Sbjct: 287 LLASVGYETTTIDAVVEHSGKTIDLVLEQMLELELQGWVVAVPGGYVRV 335


>gi|117918496|ref|YP_867688.1| DNA protecting protein DprA [Shewanella sp. ANA-3]
 gi|117610828|gb|ABK46282.1| DNA protecting protein DprA [Shewanella sp. ANA-3]
          Length = 338

 Score = 60.2 bits (145), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 14/49 (28%), Positives = 24/49 (48%)

Query: 39  IKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           +  S+      ID ++ H+G    +V   +LEL+L G +   P G V +
Sbjct: 287 LLASVGYETTTIDAVVEHSGKTIDLVLEQMLELELQGWVVAVPGGYVRV 335


>gi|262040755|ref|ZP_06013986.1| DNA protecting protein DprA [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|259041899|gb|EEW42939.1| DNA protecting protein DprA [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 379

 Score = 60.2 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 15/50 (30%), Positives = 23/50 (46%)

Query: 38  RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
            +  ++ +    +D +    G   PV    LLEL+LAG +   P G V L
Sbjct: 317 ELLANVGDEVTPVDVVAERAGQSVPVTVAQLLELELAGWIAAVPGGYVRL 366


>gi|86147127|ref|ZP_01065443.1| Smf protein [Vibrio sp. MED222]
 gi|85835011|gb|EAQ53153.1| Smf protein [Vibrio sp. MED222]
          Length = 370

 Score = 60.2 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 14/71 (19%), Positives = 26/71 (36%)

Query: 16  DTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAG 75
           D   +         E  Q    ++  ++      +D +   T I    V + LLEL+L+G
Sbjct: 296 DQQPSLFEPTPSMGENEQLPFPQLLANVGLEATPVDILAQRTHIPVHEVMMQLLELELSG 355

Query: 76  RLCHHPEGKVS 86
            +     G + 
Sbjct: 356 HVVAVSGGYIR 366


>gi|56459131|ref|YP_154412.1| DNA uptake Rossmann fold nucleotide-binding protein [Idiomarina
           loihiensis L2TR]
 gi|56178141|gb|AAV80863.1| Predicted Rossmann fold nucleotide-binding protein involved in DNA
           uptake [Idiomarina loihiensis L2TR]
          Length = 336

 Score = 60.2 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 15/50 (30%), Positives = 28/50 (56%)

Query: 38  RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           R+  SL++ P  IDD++  +G+E   V   ++ L+L G +   P G + +
Sbjct: 284 RLFASLSSEPRTIDDMVQLSGLEVAEVMEKVVLLELEGLVAAVPGGYIKV 333


>gi|53803082|ref|YP_115235.1| DNA processing protein DprA [Methylococcus capsulatus str. Bath]
 gi|53756843|gb|AAU91134.1| putative DNA processing protein DprA [Methylococcus capsulatus str.
           Bath]
          Length = 364

 Score = 60.2 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 13/68 (19%), Positives = 23/68 (33%)

Query: 20  TKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCH 79
                          E  RI   +   P  +D ++  TG  A ++   L+ L++ G +  
Sbjct: 295 VDRQERLPVVPPADAEAARILAHIAYAPTSVDTLVAATGYTANLIASKLVLLEMEGHVAA 354

Query: 80  HPEGKVSL 87
            P G    
Sbjct: 355 APGGGYCR 362


>gi|157372743|ref|YP_001480732.1| DNA protecting protein DprA [Serratia proteamaculans 568]
 gi|157324507|gb|ABV43604.1| DNA protecting protein DprA [Serratia proteamaculans 568]
          Length = 373

 Score = 59.9 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 13/51 (25%), Positives = 24/51 (47%)

Query: 37  VRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
             +  ++ +    +D +    G   P V + LL+L+LAG +   P G V +
Sbjct: 310 ADVLANVGDEVTPVDVVAERAGQPVPEVVIKLLDLELAGWIAAVPGGYVRI 360


>gi|114045542|ref|YP_736092.1| DNA protecting protein DprA [Shewanella sp. MR-7]
 gi|113886984|gb|ABI41035.1| DNA protecting protein DprA [Shewanella sp. MR-7]
          Length = 338

 Score = 59.9 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 14/49 (28%), Positives = 24/49 (48%)

Query: 39  IKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           +  S+      ID ++ H+G    +V   +LEL+L G +   P G V +
Sbjct: 287 LLASVGYETTTIDAVVEHSGKTIDLVLEQMLELELQGWVVAVPGGYVRV 335


>gi|146278352|ref|YP_001168511.1| DNA protecting protein DprA [Rhodobacter sphaeroides ATCC 17025]
 gi|145556593|gb|ABP71206.1| DNA protecting protein DprA [Rhodobacter sphaeroides ATCC 17025]
          Length = 369

 Score = 59.9 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/54 (31%), Positives = 23/54 (42%)

Query: 34  CERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
                I   L  VP+  D +I    + A  V   L+ L+L GR+   P G VS 
Sbjct: 314 PVHSLILDRLGPVPVPEDQLIRDLSLPAGRVAQELVALELEGRIQRDPGGLVSR 367


>gi|254524568|ref|ZP_05136623.1| DNA processing chain A [Stenotrophomonas sp. SKA14]
 gi|219722159|gb|EED40684.1| DNA processing chain A [Stenotrophomonas sp. SKA14]
          Length = 375

 Score = 59.9 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 19/87 (21%), Positives = 36/87 (41%), Gaps = 3/87 (3%)

Query: 1   MVHPQIEQNFFSSQSD-TNHTKNINITHYPE--YTQCERVRIKQSLNNVPIHIDDIIHHT 57
           ++ P + Q     QS     T+       P       +   + ++L++ P  +D +I   
Sbjct: 285 LLAPALRQQLPGLQSRLGTPTEQAPPALLPARWADDPDYQCLWRALDHNPSGMDSLITRC 344

Query: 58  GIEAPVVYLVLLELDLAGRLCHHPEGK 84
           G+ AP V  +LL ++LAG +       
Sbjct: 345 GLTAPQVSSMLLAMELAGIVVCVHGRY 371


>gi|294138836|ref|YP_003554814.1| DNA processing protein DprA [Shewanella violacea DSS12]
 gi|293325305|dbj|BAJ00036.1| DNA processing protein DprA, putative [Shewanella violacea DSS12]
          Length = 339

 Score = 59.9 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 15/51 (29%), Positives = 25/51 (49%)

Query: 37  VRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
             +  S+      IDD++ H+G    +V   +LEL+L G +   P G + L
Sbjct: 286 ASLLASVGYETTTIDDVVEHSGKAIDLVLEQMLELELQGWVAVVPGGYIRL 336


>gi|238896782|ref|YP_002921527.1| DNA protecting protein DprA [Klebsiella pneumoniae NTUH-K2044]
 gi|238549109|dbj|BAH65460.1| putative competence protein [Klebsiella pneumoniae subsp.
           pneumoniae NTUH-K2044]
          Length = 374

 Score = 59.9 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 15/50 (30%), Positives = 23/50 (46%)

Query: 38  RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
            +  ++ +    +D +    G   PV    LLEL+LAG +   P G V L
Sbjct: 312 ELLANVGDEVTPVDVVAERAGQSVPVTVAQLLELELAGWIAAVPGGYVRL 361


>gi|166713740|ref|ZP_02244947.1| DNA processing chain A [Xanthomonas oryzae pv. oryzicola BLS256]
          Length = 380

 Score = 59.9 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 15/76 (19%), Positives = 30/76 (39%), Gaps = 2/76 (2%)

Query: 11  FSSQSDTNHTKNINITHY--PEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVL 68
              +           T    P  +  +  R+ Q+L + PI +D ++  TG+ A  +  +L
Sbjct: 301 LRERLAAPTELPRKTTAGAGPARSDPDYQRLWQALGHDPIPMDSLVQRTGLTAAALSSML 360

Query: 69  LELDLAGRLCHHPEGK 84
           L ++L G +       
Sbjct: 361 LIMELEGDVVTEHGRY 376


>gi|152972194|ref|YP_001337340.1| DNA protecting protein DprA [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|330002242|ref|ZP_08304253.1| DNA protecting protein DprA [Klebsiella sp. MS 92-3]
 gi|150957043|gb|ABR79073.1| putative competence protein [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|328537381|gb|EGF63630.1| DNA protecting protein DprA [Klebsiella sp. MS 92-3]
          Length = 374

 Score = 59.9 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 15/50 (30%), Positives = 23/50 (46%)

Query: 38  RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
            +  ++ +    +D +    G   PV    LLEL+LAG +   P G V L
Sbjct: 312 ELLANVGDEVTPVDVVAERAGQSVPVTVAQLLELELAGWIAAVPGGYVRL 361


>gi|300854485|ref|YP_003779469.1| putative Smf protein [Clostridium ljungdahlii DSM 13528]
 gi|300434600|gb|ADK14367.1| predicted Smf protein [Clostridium ljungdahlii DSM 13528]
          Length = 366

 Score = 59.9 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 13/50 (26%), Positives = 24/50 (48%)

Query: 36  RVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
             +I   + ++P+HID+I   T ++   +Y +L EL L G +        
Sbjct: 306 EEKICNVIGHIPMHIDEISRITNVDIKRLYELLFELQLKGEIMCLAGNYY 355


>gi|269966997|ref|ZP_06181067.1| Smf protein [Vibrio alginolyticus 40B]
 gi|269828391|gb|EEZ82655.1| Smf protein [Vibrio alginolyticus 40B]
          Length = 369

 Score = 59.9 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 11/49 (22%), Positives = 24/49 (48%)

Query: 38  RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
           ++  ++ +    +D + + T I    V + LLEL+L+G +     G + 
Sbjct: 317 QLLANVGSEATPVDILANRTNIPVQEVMMQLLELELSGHVVAVSGGYIR 365


>gi|153834329|ref|ZP_01986996.1| protein smf [Vibrio harveyi HY01]
 gi|148869337|gb|EDL68351.1| protein smf [Vibrio harveyi HY01]
          Length = 369

 Score = 59.9 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 13/60 (21%), Positives = 25/60 (41%), Gaps = 3/60 (5%)

Query: 30  EYTQCERV---RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
                E +   ++  ++ N    +D +   T I    V + LLEL+L+G +     G + 
Sbjct: 306 APIDEEELPFPQLLANVGNEATPVDILASRTNIPVQEVMMQLLELELSGHVVAVSGGYIR 365


>gi|182416693|ref|ZP_02948094.1| DNA uptake protein [Clostridium butyricum 5521]
 gi|237667207|ref|ZP_04527191.1| DNA protecting protein DprA [Clostridium butyricum E4 str. BoNT E
           BL5262]
 gi|182379455|gb|EDT76948.1| DNA uptake protein [Clostridium butyricum 5521]
 gi|237655555|gb|EEP53111.1| DNA protecting protein DprA [Clostridium butyricum E4 str. BoNT E
           BL5262]
          Length = 353

 Score = 59.9 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 28/62 (45%)

Query: 24  NITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEG 83
           NI   P     ++ RI   L +VP+HIDD+   T  E   +Y +L E+ +   +   P  
Sbjct: 288 NIEIRPMIKSPDKRRILNCLTDVPMHIDDVFRKTNFERGALYALLFEMQIKDEIICLPGN 347

Query: 84  KV 85
             
Sbjct: 348 YY 349


>gi|89902621|ref|YP_525092.1| DNA processing protein DprA [Rhodoferax ferrireducens T118]
 gi|89347358|gb|ABD71561.1| DNA processing protein DprA, putative [Rhodoferax ferrireducens
           T118]
          Length = 409

 Score = 59.9 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 11/52 (21%), Positives = 22/52 (42%)

Query: 36  RVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           +  +  ++   P+ +D +    GI+   +   L+ L+L G L   P G    
Sbjct: 354 QAVLLDAIGFDPVGLDALQARCGIDTAGLQAQLMTLELDGLLVRLPGGLFQR 405


>gi|221069821|ref|ZP_03545926.1| DNA protecting protein DprA [Comamonas testosteroni KF-1]
 gi|220714844|gb|EED70212.1| DNA protecting protein DprA [Comamonas testosteroni KF-1]
          Length = 397

 Score = 59.9 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 14/85 (16%), Positives = 27/85 (31%), Gaps = 3/85 (3%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVV 64
             E                   +    T      + Q+L + P+ ++ +   TG +A  +
Sbjct: 314 LEELQGLEPAPIQAEQAQEATGNK---TSISEHPLLQALGHDPMTLESLSDRTGWDAAHL 370

Query: 65  YLVLLELDLAGRLCHHPEGKVSLTM 89
              L+EL+  G +   P G      
Sbjct: 371 QAQLMELEFDGLVARLPGGLYQRLT 395


>gi|330997315|ref|ZP_08321168.1| DNA protecting protein DprA [Paraprevotella xylaniphila YIT 11841]
 gi|329571110|gb|EGG52817.1| DNA protecting protein DprA [Paraprevotella xylaniphila YIT 11841]
          Length = 373

 Score = 59.9 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 11/60 (18%), Positives = 20/60 (33%), Gaps = 1/60 (1%)

Query: 30  EYTQCERVRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
                E  RI   L  +  + I+ +   T +    +   L  L++ G +     G   L 
Sbjct: 314 PDLCEEEQRIVDCLRQSECLQINALAVATNLPVHKLSAFLFNLEMKGVVRLLSGGMYRLA 373


>gi|260427296|ref|ZP_05781275.1| protein smf [Citreicella sp. SE45]
 gi|260421788|gb|EEX15039.1| protein smf [Citreicella sp. SE45]
          Length = 398

 Score = 59.9 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 19/91 (20%), Positives = 29/91 (31%), Gaps = 6/91 (6%)

Query: 3   HPQIEQNFFSSQSDTNHTKNINITHYPEY------TQCERVRIKQSLNNVPIHIDDIIHH 56
            P  +        D        +   P        T      I   L  VP+  D +I  
Sbjct: 306 RPPAQAQLPLDLDDAVIDDTPVVPIAPPERRSLRETAALHAEILSRLGPVPVAEDQLIRD 365

Query: 57  TGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
               +  V  VL +L+L GR+   P G ++ 
Sbjct: 366 LAEPSDTVSPVLTDLELDGRIQRRPGGLLTR 396


>gi|119471683|ref|ZP_01614068.1| hypothetical protein ATW7_16423 [Alteromonadales bacterium TW-7]
 gi|119445462|gb|EAW26749.1| hypothetical protein ATW7_16423 [Alteromonadales bacterium TW-7]
          Length = 363

 Score = 59.9 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 12/57 (21%), Positives = 24/57 (42%)

Query: 33  QCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTM 89
           Q     +  S+      +DDI+         V   LL+L+L  ++    +G + L++
Sbjct: 305 QSSDCEVLNSIGFEVTTVDDIVRRVQWPIDKVLARLLDLELDDQIERILDGYIRLSV 361


>gi|91226305|ref|ZP_01261145.1| Smf protein [Vibrio alginolyticus 12G01]
 gi|91189316|gb|EAS75595.1| Smf protein [Vibrio alginolyticus 12G01]
          Length = 369

 Score = 59.9 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 11/49 (22%), Positives = 24/49 (48%)

Query: 38  RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
           ++  ++ +    +D + + T I    V + LLEL+L+G +     G + 
Sbjct: 317 QLLANVGSEATPVDILANRTNIPVQEVMMQLLELELSGHVVAVSGGYIR 365


>gi|84393443|ref|ZP_00992200.1| Smf protein [Vibrio splendidus 12B01]
 gi|84375959|gb|EAP92849.1| Smf protein [Vibrio splendidus 12B01]
          Length = 370

 Score = 59.9 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 14/71 (19%), Positives = 26/71 (36%)

Query: 16  DTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAG 75
           D   +         E  Q    ++  ++      +D +   T I    V + LLEL+L+G
Sbjct: 296 DQQPSLFEPTPSMGENEQLPFPQLLANVGLEATPVDILAQRTHIPVHEVMMQLLELELSG 355

Query: 76  RLCHHPEGKVS 86
            +     G + 
Sbjct: 356 HVVAVSGGYIR 366


>gi|94263095|ref|ZP_01286914.1| SMF protein [delta proteobacterium MLMS-1]
 gi|93456638|gb|EAT06746.1| SMF protein [delta proteobacterium MLMS-1]
          Length = 381

 Score = 59.9 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/88 (19%), Positives = 33/88 (37%)

Query: 1   MVHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIE 60
           +  P   +   +  +  +       T        E   +  +L+  P  I++II    + 
Sbjct: 293 LASPLTARFLPAKPATASSAAAPTTTPEATPANAEEQALLATLDGYPRDIEEIIAACRLP 352

Query: 61  APVVYLVLLELDLAGRLCHHPEGKVSLT 88
           AP V  +LLEL++ G +   P  +    
Sbjct: 353 APKVNALLLELEIRGLVESAPGPQYRRA 380


>gi|197119085|ref|YP_002139512.1| DNA uptake/processing protein SMF [Geobacter bemidjiensis Bem]
 gi|197088445|gb|ACH39716.1| DNA uptake/processing protein SMF [Geobacter bemidjiensis Bem]
          Length = 359

 Score = 59.9 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 12/81 (14%), Positives = 26/81 (32%)

Query: 8   QNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLV 67
           ++                         +   +   +    + IDDII  + + A  V   
Sbjct: 279 EDILEELGLEPQANLPLPKPSSFELNPQEAELYALICQGALQIDDIIVQSALTASEVSAT 338

Query: 68  LLELDLAGRLCHHPEGKVSLT 88
           LL L++ G +   P  + ++ 
Sbjct: 339 LLRLEMKGAIVQLPGKRFAVA 359


>gi|22298974|ref|NP_682221.1| SMF protein [Thermosynechococcus elongatus BP-1]
 gi|22295155|dbj|BAC08983.1| SMF protein [Thermosynechococcus elongatus BP-1]
          Length = 355

 Score = 59.9 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 12/75 (16%), Positives = 27/75 (36%), Gaps = 5/75 (6%)

Query: 17  TNHTKNINITHYPEYTQCERVRIKQSL-----NNVPIHIDDIIHHTGIEAPVVYLVLLEL 71
           T        +         + +I +++      +  +  DDI+    ++  VV   L+ L
Sbjct: 277 TPPLDPTPFSAPSPTLSLPQQQILEAIQQLSQGSQSVAFDDIVQRVCLDTGVVMAELIHL 336

Query: 72  DLAGRLCHHPEGKVS 86
           +L G +   P  +  
Sbjct: 337 ELMGYVEQQPGNRYR 351


>gi|332285820|ref|YP_004417731.1| hypothetical protein PT7_2567 [Pusillimonas sp. T7-7]
 gi|330429773|gb|AEC21107.1| hypothetical protein PT7_2567 [Pusillimonas sp. T7-7]
          Length = 389

 Score = 59.5 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 14/76 (18%), Positives = 27/76 (35%), Gaps = 3/76 (3%)

Query: 10  FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLL 69
                  T    +      PE       RI +++   P+ +D +   T +    +   LL
Sbjct: 308 LAGPPKSTAAAASSQPEASPEPNS---QRILEAMGYDPVDLDTLQRRTQLNLSTLNSSLL 364

Query: 70  ELDLAGRLCHHPEGKV 85
            L+LA  +    +G+ 
Sbjct: 365 MLELAETIARQDDGRF 380


>gi|294625232|ref|ZP_06703872.1| DNA processing chain A [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 11122]
 gi|292600460|gb|EFF44557.1| DNA processing chain A [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 11122]
          Length = 381

 Score = 59.5 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 13/74 (17%), Positives = 31/74 (41%)

Query: 11  FSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLE 70
            ++ ++            P  +  +  R+ Q+L + P  +D ++  TG+ A  +  +LL 
Sbjct: 304 LAAPTELPGKATTGAGPGPARSDPDYQRLWQALGHDPTPMDSLVQRTGLTAATLSSMLLI 363

Query: 71  LDLAGRLCHHPEGK 84
           ++L G +       
Sbjct: 364 MELEGDVVTEHGRY 377


>gi|186682634|ref|YP_001865830.1| DNA protecting protein DprA [Nostoc punctiforme PCC 73102]
 gi|186465086|gb|ACC80887.1| DNA protecting protein DprA [Nostoc punctiforme PCC 73102]
          Length = 371

 Score = 59.5 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/73 (23%), Positives = 27/73 (36%), Gaps = 1/73 (1%)

Query: 13  SQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELD 72
            Q D   T        P     E   +  +  +  +  D I+  TG+ A  V   LL+L+
Sbjct: 297 PQIDRVETSTAPEQLMP-TLSPELQTVMDAFTSDALPFDFIVEQTGMAAGSVSGALLQLE 355

Query: 73  LAGRLCHHPEGKV 85
           L G +   P  + 
Sbjct: 356 LMGLVLQLPGMRY 368


>gi|282600504|ref|ZP_05974544.2| DNA protecting protein DprA [Providencia rustigianii DSM 4541]
 gi|282564967|gb|EFB70502.1| DNA protecting protein DprA [Providencia rustigianii DSM 4541]
          Length = 373

 Score = 59.5 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 14/70 (20%), Positives = 27/70 (38%), Gaps = 1/70 (1%)

Query: 19  HTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLC 78
              +I  T   E+   E  RI   +      +D I     +    V  +L EL+++G + 
Sbjct: 305 PELSIESTPNSEFNLTE-NRILGMVGYQVTPVDVIAGQLQLPISRVISILTELEISGDIL 363

Query: 79  HHPEGKVSLT 88
               G + ++
Sbjct: 364 STAGGYIRVS 373


>gi|83943948|ref|ZP_00956405.1| DNA processing protein DprA, putative [Sulfitobacter sp. EE-36]
 gi|83845195|gb|EAP83075.1| DNA processing protein DprA, putative [Sulfitobacter sp. EE-36]
          Length = 365

 Score = 59.5 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 14/55 (25%), Positives = 22/55 (40%)

Query: 34  CERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
                I   L   P+  D ++    +   +   VL+EL+L G +  H  G VS  
Sbjct: 310 ALHTDILSRLGPSPVAEDQLLRDLAVAPGIATPVLVELELNGHILRHAGGLVSRA 364


>gi|87199818|ref|YP_497075.1| DNA processing protein DprA, putative [Novosphingobium
           aromaticivorans DSM 12444]
 gi|87135499|gb|ABD26241.1| DNA protecting protein DprA [Novosphingobium aromaticivorans DSM
           12444]
          Length = 375

 Score = 59.5 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 21/54 (38%), Positives = 31/54 (57%)

Query: 34  CERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
            E+  +   L   PI +D++I  +   A  V + L+EL+LAGRL  H  G+VSL
Sbjct: 320 DEQADVADLLTTAPIGVDELIRQSRASAGAVQMALIELELAGRLLRHAAGRVSL 373


>gi|126737264|ref|ZP_01752999.1| DNA processing protein DprA, putative [Roseobacter sp. SK209-2-6]
 gi|126721849|gb|EBA18552.1| DNA processing protein DprA, putative [Roseobacter sp. SK209-2-6]
          Length = 423

 Score = 59.5 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 16/83 (19%), Positives = 28/83 (33%)

Query: 3   HPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAP 62
            P    N  + Q  ++           + T     +I   L   P+  D ++       P
Sbjct: 330 SPAGPSNAEARQLLSSLPVPPPEKRNLQETNALHQQILNRLGTTPVPADLLMRDLNATPP 389

Query: 63  VVYLVLLELDLAGRLCHHPEGKV 85
                L +L+L GR+   P G +
Sbjct: 390 QFGSALTDLELDGRIERLPGGLL 412


>gi|282879050|ref|ZP_06287810.1| DNA protecting protein DprA [Prevotella buccalis ATCC 35310]
 gi|281298784|gb|EFA91193.1| DNA protecting protein DprA [Prevotella buccalis ATCC 35310]
          Length = 379

 Score = 59.5 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/78 (21%), Positives = 32/78 (41%), Gaps = 2/78 (2%)

Query: 13  SQSDTNHTKNINITHYPEYTQCERVRIKQSLN-NVPIHIDDIIHHTGIEAPVVYLVLLEL 71
           ++    H + I    +P+    E +++   L  N  + I+ +    GI    +  +L  L
Sbjct: 302 ARLSRAHHEGIERQLFPD-LSAEELQVVGVLGKNNDLQINMLSVQAGIPIAKLSAILFTL 360

Query: 72  DLAGRLCHHPEGKVSLTM 89
           ++ G L   P G   L M
Sbjct: 361 EMKGVLKALPGGIYHLLM 378


>gi|304309701|ref|YP_003809299.1| SMF protein [gamma proteobacterium HdN1]
 gi|301795434|emb|CBL43632.1| SMF protein [gamma proteobacterium HdN1]
          Length = 419

 Score = 59.5 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 15/75 (20%), Positives = 27/75 (36%)

Query: 8   QNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLV 67
           ++ F++            T   E       RI   L   P  +DD++  T +    +   
Sbjct: 339 EDLFTTAEAHTPKGLQATTKPSENHDTPEGRILALLYAEPHSVDDLVERTELGTAEINAT 398

Query: 68  LLELDLAGRLCHHPE 82
           L+ L+L GR+     
Sbjct: 399 LMMLELEGRIVQMSG 413


>gi|238921408|ref|YP_002934923.1| protein smf [Edwardsiella ictaluri 93-146]
 gi|238870977|gb|ACR70688.1| protein smf [Edwardsiella ictaluri 93-146]
          Length = 370

 Score = 59.5 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 18/76 (23%), Positives = 30/76 (39%)

Query: 12  SSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLEL 71
           SS          NI+   +  Q     +  ++ +    +D +    G   P V + LLEL
Sbjct: 282 SSLHWLAPLTEGNISAGEDDAQLPFAEVLANVGDEVTTVDAVAERIGRSVPDVAVALLEL 341

Query: 72  DLAGRLCHHPEGKVSL 87
           +LAG +     G V +
Sbjct: 342 ELAGWIKVVSGGYVRV 357


>gi|15837526|ref|NP_298214.1| DNA processing chain A [Xylella fastidiosa 9a5c]
 gi|9105845|gb|AAF83734.1|AE003931_11 DNA processing chain A [Xylella fastidiosa 9a5c]
          Length = 387

 Score = 59.5 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 16/84 (19%), Positives = 31/84 (36%), Gaps = 2/84 (2%)

Query: 1   MVHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIE 60
           +  P         + D            P     +   + Q+L + P+ +D +I  TG+ 
Sbjct: 302 LAAPLAHT--LRERLDAPSWPVAPSLSTPNSNDPKYHTLWQALAHDPMSMDSLIERTGLT 359

Query: 61  APVVYLVLLELDLAGRLCHHPEGK 84
           A  +  +LL L+L G++       
Sbjct: 360 AATLSSMLLTLELEGKVVVEHGRY 383


>gi|268317536|ref|YP_003291255.1| DNA protecting protein DprA [Rhodothermus marinus DSM 4252]
 gi|262335070|gb|ACY48867.1| DNA protecting protein DprA [Rhodothermus marinus DSM 4252]
          Length = 385

 Score = 59.5 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 12/54 (22%), Positives = 23/54 (42%)

Query: 32  TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
                 ++  +L   PIHID +   TG++     + LL+L+  G +      + 
Sbjct: 328 LSGLERQLYDALEPEPIHIDVLCERTGLDPSTALVYLLQLEFKGLVRQLAGKQF 381


>gi|269925224|ref|YP_003321847.1| DNA protecting protein DprA [Thermobaculum terrenum ATCC BAA-798]
 gi|269788884|gb|ACZ41025.1| DNA protecting protein DprA [Thermobaculum terrenum ATCC BAA-798]
          Length = 365

 Score = 59.5 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 13/58 (22%), Positives = 21/58 (36%), Gaps = 1/58 (1%)

Query: 32  TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTM 89
                  +   L   P HIDDI   + +   VV   L  +++ G +  +     SL  
Sbjct: 309 DDPTEQALLDVLGTEPKHIDDIAFESNMPIAVVSATLTMMEIKGIVRSN-GMFYSLAT 365


>gi|148654174|ref|YP_001281267.1| DNA protecting protein DprA [Psychrobacter sp. PRwf-1]
 gi|148573258|gb|ABQ95317.1| DNA protecting protein DprA [Psychrobacter sp. PRwf-1]
          Length = 421

 Score = 59.5 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 17/88 (19%), Positives = 32/88 (36%), Gaps = 4/88 (4%)

Query: 3   HPQIEQNFFSSQSDTNHTKNINITHYPE---YTQCERVRIKQSLNNVPIHIDDIIHHTGI 59
           HP    N  SS +      N+N     +           +   +   P  +D +I+ T +
Sbjct: 334 HPTKHPNAVSSDTTATPKDNVNPILKAQKSVTISEHLQPLWVHIQFEPQDLDALINKTQL 393

Query: 60  EAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           +   +   L+EL+L G +     G+   
Sbjct: 394 DTATLLSQLMELELMGAVAEV-GGRYQR 420


>gi|77359007|ref|YP_338582.1| hypothetical protein PSHAa0025 [Pseudoalteromonas haloplanktis
           TAC125]
 gi|76873918|emb|CAI85139.1| conserved protein of unknown function ; Smf protein
           [Pseudoalteromonas haloplanktis TAC125]
          Length = 362

 Score = 59.5 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 10/54 (18%), Positives = 22/54 (40%)

Query: 34  CERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
             +  +  S+      +DDI+         V   LL+L+L  ++    +G + +
Sbjct: 308 DSQCEVLNSIGFEVTSVDDIVRRAQWPIDKVQARLLDLELDDQIERVLDGYIRV 361


>gi|290512103|ref|ZP_06551471.1| DNA processing protein [Klebsiella sp. 1_1_55]
 gi|289775893|gb|EFD83893.1| DNA processing protein [Klebsiella sp. 1_1_55]
          Length = 374

 Score = 59.5 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 15/50 (30%), Positives = 23/50 (46%)

Query: 38  RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
            +  ++ +    +D +    G   PV    LLEL+LAG +   P G V L
Sbjct: 312 ELLANVGDEVTPVDVVAERAGQSVPVTVAQLLELELAGWIAAVPGGYVRL 361


>gi|269140539|ref|YP_003297240.1| hypothetical protein ETAE_3198 [Edwardsiella tarda EIB202]
 gi|267986200|gb|ACY86029.1| hypothetical protein ETAE_3198 [Edwardsiella tarda EIB202]
 gi|304560324|gb|ADM42988.1| hypothetical protein ETAF_2886 [Edwardsiella tarda FL6-60]
          Length = 370

 Score = 59.5 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 18/76 (23%), Positives = 30/76 (39%)

Query: 12  SSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLEL 71
           SS          NI+   +  Q     +  ++ +    +D +    G   P V + LLEL
Sbjct: 282 SSLHWLAPLTEGNISAGEDDAQLPFAEVLANVGDEVTTVDAVAERIGRSVPDVAVALLEL 341

Query: 72  DLAGRLCHHPEGKVSL 87
           +LAG +     G V +
Sbjct: 342 ELAGWIKVVSGGYVRV 357


>gi|294638019|ref|ZP_06716279.1| DNA protecting protein DprA [Edwardsiella tarda ATCC 23685]
 gi|291088811|gb|EFE21372.1| DNA protecting protein DprA [Edwardsiella tarda ATCC 23685]
          Length = 370

 Score = 59.5 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 18/75 (24%), Positives = 28/75 (37%)

Query: 13  SQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELD 72
           S          NI+H     Q     +  ++ +    ID +    G   P   + LLEL+
Sbjct: 283 SLHWLPPPAADNISHCEGDAQLPFAEVLANVGDEVTTIDAVAERIGRSVPDAAVALLELE 342

Query: 73  LAGRLCHHPEGKVSL 87
           LAG +     G V +
Sbjct: 343 LAGWIKAVSGGYVRV 357


>gi|288933301|ref|YP_003437360.1| DNA protecting protein DprA [Klebsiella variicola At-22]
 gi|288888030|gb|ADC56348.1| DNA protecting protein DprA [Klebsiella variicola At-22]
          Length = 374

 Score = 59.5 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 15/50 (30%), Positives = 23/50 (46%)

Query: 38  RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
            +  ++ +    +D +    G   PV    LLEL+LAG +   P G V L
Sbjct: 312 ELLANVGDEVTPVDVVAERAGQSVPVTVAQLLELELAGWIAAVPGGYVRL 361


>gi|84516624|ref|ZP_01003983.1| DNA processing protein DprA, putative [Loktanella vestfoldensis
           SKA53]
 gi|84509660|gb|EAQ06118.1| DNA processing protein DprA, putative [Loktanella vestfoldensis
           SKA53]
          Length = 336

 Score = 59.5 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 12/75 (16%), Positives = 26/75 (34%)

Query: 15  SDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLA 74
           +     +                 I Q L   P+  D ++    + A  V   L++L+L 
Sbjct: 262 TTPVPRQAPQARPALRNIAALHAMILQRLGPAPVAEDQLLRDLAVSATDVGPALVDLELD 321

Query: 75  GRLCHHPEGKVSLTM 89
           G++     G ++  +
Sbjct: 322 GKITRQAGGLLARAV 336


>gi|254230001|ref|ZP_04923402.1| DNA protecting protein DprA, putative [Vibrio sp. Ex25]
 gi|262392833|ref|YP_003284687.1| DNA uptake Rossmann fold nucleotide-binding protein [Vibrio sp.
           Ex25]
 gi|151937503|gb|EDN56360.1| DNA protecting protein DprA, putative [Vibrio sp. Ex25]
 gi|262336427|gb|ACY50222.1| rossmann fold nucleotide-binding protein Smf possibly involved in
           DNA uptake [Vibrio sp. Ex25]
          Length = 369

 Score = 59.5 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 11/49 (22%), Positives = 24/49 (48%)

Query: 38  RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
           ++  ++ +    +D + + T I    V + LLEL+L+G +     G + 
Sbjct: 317 QLLANVGSEATPVDILANRTNIPVQEVMMQLLELELSGHVVAVSGGYIR 365


>gi|156972724|ref|YP_001443631.1| nucleotide-binding protein [Vibrio harveyi ATCC BAA-1116]
 gi|156524318|gb|ABU69404.1| hypothetical protein VIBHAR_00389 [Vibrio harveyi ATCC BAA-1116]
          Length = 369

 Score = 59.5 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 13/60 (21%), Positives = 25/60 (41%), Gaps = 3/60 (5%)

Query: 30  EYTQCERV---RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
                E +   ++  ++ N    +D +   T I    V + LLEL+L+G +     G + 
Sbjct: 306 APIDEEELPFPQLLANVGNEATPVDILASRTNIPVQEVMMQLLELELSGHVVAVSGGYIR 365


>gi|332799163|ref|YP_004460662.1| DNA protecting protein DprA [Tepidanaerobacter sp. Re1]
 gi|332696898|gb|AEE91355.1| DNA protecting protein DprA [Tepidanaerobacter sp. Re1]
          Length = 364

 Score = 59.1 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 17/80 (21%), Positives = 29/80 (36%)

Query: 9   NFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVL 68
           +    +S  N   N   +            I + ++  PI I+ II+ +   +  V  VL
Sbjct: 285 DELYLESPKNSNTNTADSVNLPNLSETEKSILEVIDYQPIQIEQIINLSHRNSQEVNAVL 344

Query: 69  LELDLAGRLCHHPEGKVSLT 88
             L+L G +   P G     
Sbjct: 345 TCLELKGYISALPGGYFVRN 364


>gi|325913840|ref|ZP_08176199.1| DNA protecting protein DprA [Xanthomonas vesicatoria ATCC 35937]
 gi|325539915|gb|EGD11552.1| DNA protecting protein DprA [Xanthomonas vesicatoria ATCC 35937]
          Length = 378

 Score = 59.1 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 12/84 (14%), Positives = 30/84 (35%)

Query: 1   MVHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIE 60
           ++  ++        +                   +  R+ Q+L + P  +D ++  TG+ 
Sbjct: 291 LLSGELANALRERLAAPTQVPRTTRAITSTRPDPDYQRLWQALGHDPTPMDSLVERTGLT 350

Query: 61  APVVYLVLLELDLAGRLCHHPEGK 84
           A  +  +LL ++L G +       
Sbjct: 351 AAALSSMLLIMELEGDVVTEHGRY 374


>gi|238754206|ref|ZP_04615564.1| hypothetical protein yruck0001_28090 [Yersinia ruckeri ATCC 29473]
 gi|238707702|gb|EEQ00062.1| hypothetical protein yruck0001_28090 [Yersinia ruckeri ATCC 29473]
          Length = 373

 Score = 59.1 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 17/78 (21%), Positives = 31/78 (39%), Gaps = 5/78 (6%)

Query: 10  FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLL 69
            + S SD N   +        ++      +  ++      +D +    G   P + + LL
Sbjct: 288 QWLSLSDENIISSSEAQLELPFSD-----VLANVEYEVTPVDVVAERAGHSVPDIVVKLL 342

Query: 70  ELDLAGRLCHHPEGKVSL 87
           EL+LAG +   P G V +
Sbjct: 343 ELELAGWIAAVPGGYVRI 360


>gi|258517114|ref|YP_003193336.1| Mg chelatase, subunit ChlI [Desulfotomaculum acetoxidans DSM 771]
 gi|257780819|gb|ACV64713.1| Mg chelatase, subunit ChlI [Desulfotomaculum acetoxidans DSM 771]
          Length = 748

 Score = 59.1 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 9/76 (11%), Positives = 24/76 (31%)

Query: 12  SSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLEL 71
             + ++N        +           I   L+ +P  ++ +    G     +  +L  +
Sbjct: 672 EQRINSNEAHRNKRVNEIPPLSQIEKEIYDHLSPIPQSVEQLAGILGSNPSALLRILCVM 731

Query: 72  DLAGRLCHHPEGKVSL 87
           +L G++     G    
Sbjct: 732 ELEGKIELFAGGMARR 747


>gi|85708361|ref|ZP_01039427.1| DNA processing chain A [Erythrobacter sp. NAP1]
 gi|85689895|gb|EAQ29898.1| DNA processing chain A [Erythrobacter sp. NAP1]
          Length = 384

 Score = 59.1 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 19/55 (34%), Positives = 29/55 (52%)

Query: 34  CERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
            E   I + L   PI +D++I  +G +   V++ LLEL+L G +     G V LT
Sbjct: 330 DEGEAITRLLTTAPIGVDELIRQSGADPAAVHMTLLELELGGEVERGDGGMVRLT 384


>gi|254440562|ref|ZP_05054056.1| DNA protecting protein DprA, putative [Octadecabacter antarcticus
           307]
 gi|198256008|gb|EDY80322.1| DNA protecting protein DprA, putative [Octadecabacter antarcticus
           307]
          Length = 344

 Score = 59.1 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 12/84 (14%), Positives = 30/84 (35%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVV 64
             +    ++ +     + +        T      I   L+  P+  D +I   G     +
Sbjct: 260 LDQLGEPTTVAPELPLEPVPQPRGLRETALLHADILDRLSPAPMAEDQLIRSLGGAPTAI 319

Query: 65  YLVLLELDLAGRLCHHPEGKVSLT 88
             +L++L+L G++     G ++  
Sbjct: 320 APLLMDLELDGKVIRQAGGILARA 343


>gi|110637848|ref|YP_678055.1| DNA processing protein [Cytophaga hutchinsonii ATCC 33406]
 gi|110280529|gb|ABG58715.1| DNA processing protein [Cytophaga hutchinsonii ATCC 33406]
          Length = 364

 Score = 59.1 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 15/71 (21%), Positives = 30/71 (42%), Gaps = 1/71 (1%)

Query: 18  NHTKNINITHYPEYTQCERVRIKQSLNN-VPIHIDDIIHHTGIEAPVVYLVLLELDLAGR 76
             ++  +        + + + I   L +   IHID++   + +    +  VLLE++  G 
Sbjct: 293 TPSQQAHKHIILADLEEDELMIYAVLTDNEGIHIDELSWKSQLSMQKISSVLLEMEFKGI 352

Query: 77  LCHHPEGKVSL 87
           +   P  K SL
Sbjct: 353 VKALPGKKFSL 363


>gi|269962642|ref|ZP_06176987.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
 gi|269832565|gb|EEZ86679.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
          Length = 369

 Score = 59.1 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 13/60 (21%), Positives = 25/60 (41%), Gaps = 3/60 (5%)

Query: 30  EYTQCERV---RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
                E +   ++  ++ N    +D +   T I    V + LLEL+L+G +     G + 
Sbjct: 306 APIDEEELPFPQLLANVGNEATPVDILASRTNIPVQEVMMQLLELELSGHVVAVSGGYIR 365


>gi|209515835|ref|ZP_03264697.1| DNA protecting protein DprA [Burkholderia sp. H160]
 gi|209503683|gb|EEA03677.1| DNA protecting protein DprA [Burkholderia sp. H160]
          Length = 409

 Score = 59.1 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 15/58 (25%), Positives = 28/58 (48%)

Query: 34  CERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHL 91
            +  R+  +L + P  ++ +   T +E   ++ VLL L+LAG +   P G+     H 
Sbjct: 352 SDTERLLAALGHSPTTLEILAARTEMEDAALHAVLLRLELAGEVTLLPGGRFMRAHHD 409


>gi|157373178|ref|YP_001471778.1| DNA protecting protein DprA [Shewanella sediminis HAW-EB3]
 gi|157315552|gb|ABV34650.1| DNA protecting protein DprA [Shewanella sediminis HAW-EB3]
          Length = 368

 Score = 59.1 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 15/49 (30%), Positives = 24/49 (48%)

Query: 39  IKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           +  S+      ID ++ H+G    +V   +LEL+L G +   P G V L
Sbjct: 317 LLASVGYETTPIDVVVEHSGKAIELVLEQMLELELQGWVAVVPGGYVRL 365


>gi|71277761|ref|YP_266804.1| putative DNA processing protein DprA [Colwellia psychrerythraea
           34H]
 gi|71143501|gb|AAZ23974.1| putative DNA processing protein DprA [Colwellia psychrerythraea
           34H]
          Length = 383

 Score = 59.1 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 9/50 (18%), Positives = 19/50 (38%)

Query: 37  VRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
             +  S+      +D ++  + +    V   L  L+L G +   P G + 
Sbjct: 332 DALLDSVGFEITPVDKVVLRSELPVEEVLTRLTMLELNGLVSAVPGGYIR 381


>gi|304415446|ref|ZP_07396095.1| hypothetical protein REG_1635 [Candidatus Regiella insecticola
           LSR1]
 gi|304282710|gb|EFL91224.1| hypothetical protein REG_1635 [Candidatus Regiella insecticola
           LSR1]
          Length = 361

 Score = 59.1 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 13/69 (18%), Positives = 23/69 (33%)

Query: 20  TKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCH 79
             +   +   E        +   +      +D I          + + LLEL+LAG +  
Sbjct: 291 PPSEKPSLPKEQMTLPFADVLAHIEYDVTPVDIIAERVDQSVSELVIKLLELELAGWITA 350

Query: 80  HPEGKVSLT 88
            P G   +T
Sbjct: 351 VPGGYGRVT 359


>gi|77918023|ref|YP_355838.1| Rossmann-fold nucleotide-binding protein [Pelobacter carbinolicus
           DSM 2380]
 gi|77544106|gb|ABA87668.1| DNA protecting protein DprA [Pelobacter carbinolicus DSM 2380]
          Length = 366

 Score = 59.1 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 12/54 (22%), Positives = 24/54 (44%)

Query: 38  RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHL 91
           ++ Q+L + P+H+D++    G+    V  +LL L+L       P  +       
Sbjct: 313 KVYQALQDTPLHVDELARKCGLTPMEVSAILLHLELEDGAIQLPGMRFVRKRST 366


>gi|170724410|ref|YP_001758436.1| DNA protecting protein DprA [Shewanella woodyi ATCC 51908]
 gi|169809757|gb|ACA84341.1| DNA protecting protein DprA [Shewanella woodyi ATCC 51908]
          Length = 331

 Score = 59.1 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 14/51 (27%), Positives = 24/51 (47%)

Query: 37  VRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
             +  S+      ID ++ H+G    +V   +LEL+L G +   P G V +
Sbjct: 278 ASLLASVGYETTPIDVVVEHSGKAIELVLEQMLELELQGWVAVVPGGYVRI 328


>gi|156932269|ref|YP_001436185.1| DNA protecting protein DprA [Cronobacter sakazakii ATCC BAA-894]
 gi|156530523|gb|ABU75349.1| hypothetical protein ESA_00040 [Cronobacter sakazakii ATCC BAA-894]
          Length = 370

 Score = 59.1 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 17/80 (21%), Positives = 31/80 (38%), Gaps = 6/80 (7%)

Query: 8   QNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLV 67
           QN     +  N++ +      P         +  ++ +    +D +    G   P+    
Sbjct: 284 QNELPWLTTANYSPDQEEGALPFP------ELLANVGDEVTPVDVVAERAGQPVPLTVAQ 337

Query: 68  LLELDLAGRLCHHPEGKVSL 87
           LLEL+LAG +   P G V +
Sbjct: 338 LLELELAGWIAAVPGGYVRV 357


>gi|28899814|ref|NP_799419.1| Smf protein [Vibrio parahaemolyticus RIMD 2210633]
 gi|153837670|ref|ZP_01990337.1| protein smf [Vibrio parahaemolyticus AQ3810]
 gi|260362020|ref|ZP_05775025.1| DNA-processing protein Smf [Vibrio parahaemolyticus K5030]
 gi|260876493|ref|ZP_05888848.1| DNA-processing protein Smf [Vibrio parahaemolyticus AN-5034]
 gi|260897450|ref|ZP_05905946.1| DNA-processing protein Smf [Vibrio parahaemolyticus Peru-466]
 gi|260901341|ref|ZP_05909736.1| DNA-processing protein Smf [Vibrio parahaemolyticus AQ4037]
 gi|28808066|dbj|BAC61303.1| Smf protein [Vibrio parahaemolyticus RIMD 2210633]
 gi|149748960|gb|EDM59787.1| protein smf [Vibrio parahaemolyticus AQ3810]
 gi|308087925|gb|EFO37620.1| DNA-processing protein Smf [Vibrio parahaemolyticus Peru-466]
 gi|308090386|gb|EFO40081.1| DNA-processing protein Smf [Vibrio parahaemolyticus AN-5034]
 gi|308109879|gb|EFO47419.1| DNA-processing protein Smf [Vibrio parahaemolyticus AQ4037]
 gi|308114175|gb|EFO51715.1| DNA-processing protein Smf [Vibrio parahaemolyticus K5030]
          Length = 370

 Score = 59.1 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 11/49 (22%), Positives = 24/49 (48%)

Query: 38  RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
           ++  ++ +    +D + + T I    V + LLEL+L+G +     G + 
Sbjct: 318 QLLANVGSEATPVDILANRTNIPVQEVMMQLLELELSGHVVAVSGGYIR 366


>gi|253997552|ref|YP_003049616.1| DNA protecting protein DprA [Methylotenera mobilis JLW8]
 gi|253984231|gb|ACT49089.1| DNA protecting protein DprA [Methylotenera mobilis JLW8]
          Length = 370

 Score = 59.1 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 11/77 (14%), Positives = 27/77 (35%)

Query: 9   NFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVL 68
                Q  +N   +                +  ++   P  ++ ++  TG+    V  +L
Sbjct: 290 EELKLQPRSNTLISKASASQDREIASSEQLLLDTMGFDPAPLERLVTLTGLTVAEVSSML 349

Query: 69  LELDLAGRLCHHPEGKV 85
           + L+L G++     G+ 
Sbjct: 350 MLLELDGKVASLTGGQY 366


>gi|187476713|ref|YP_784736.1| Smf protein [Bordetella avium 197N]
 gi|115421299|emb|CAJ47804.1| Smf protein [Bordetella avium 197N]
          Length = 373

 Score = 59.1 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 16/79 (20%), Positives = 31/79 (39%), Gaps = 3/79 (3%)

Query: 9   NFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVL 68
           +  SS      +        P         +  +L + P H D +   +G++A  +   L
Sbjct: 295 DELSSPRQPAPSPPAQPRAEPPPGT---QALLTALGHDPQHADSLAAASGLDAATLGAQL 351

Query: 69  LELDLAGRLCHHPEGKVSL 87
            EL++AG +    +G+  L
Sbjct: 352 TELEVAGWIARLDDGRYQL 370


>gi|260221948|emb|CBA31022.1| Protein smf [Curvibacter putative symbiont of Hydra magnipapillata]
          Length = 392

 Score = 59.1 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 10/76 (13%), Positives = 28/76 (36%)

Query: 12  SSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLEL 71
            + S + +                   +  +L   P  ++ + + +G++   +  +L+ L
Sbjct: 313 RAPSTSTNGTGEVSPSAATSLSWLESGLLDALGFEPTSLEVLQNRSGMDTATLQALLMGL 372

Query: 72  DLAGRLCHHPEGKVSL 87
           +L+G +   P  K   
Sbjct: 373 ELSGFVARLPGSKFQR 388


>gi|119387028|ref|YP_918083.1| DNA protecting protein DprA [Paracoccus denitrificans PD1222]
 gi|119377623|gb|ABL72387.1| DNA protecting protein DprA [Paracoccus denitrificans PD1222]
          Length = 418

 Score = 59.1 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 16/53 (30%), Positives = 26/53 (49%)

Query: 36  RVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
             RI   L   P   + +I   G+ A V+   +L L+L+GR+     GK++L 
Sbjct: 364 EGRILARLGPSPTEENMLIRDLGVPAAVLAPAILALELSGRVQRIAGGKLALN 416


>gi|254449997|ref|ZP_05063434.1| DNA protecting protein DprA [Octadecabacter antarcticus 238]
 gi|198264403|gb|EDY88673.1| DNA protecting protein DprA [Octadecabacter antarcticus 238]
          Length = 336

 Score = 59.1 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 12/70 (17%), Positives = 26/70 (37%)

Query: 19  HTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLC 78
             + +        T      I   L+  P+  D +I   G     +  +L++L+L G++ 
Sbjct: 266 PLEPVPQPRGLRETALLHADILDRLSPAPMAEDQLIRSLGAAPTAIAPLLMDLELDGKVI 325

Query: 79  HHPEGKVSLT 88
               G ++  
Sbjct: 326 RQAGGILARA 335


>gi|315125139|ref|YP_004067142.1| hypothetical protein PSM_A0028 [Pseudoalteromonas sp. SM9913]
 gi|315013652|gb|ADT66990.1| hypothetical protein PSM_A0028 [Pseudoalteromonas sp. SM9913]
          Length = 363

 Score = 58.7 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 11/51 (21%), Positives = 22/51 (43%)

Query: 38  RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
            +  S+      +DDI+         V   LL+L+L  ++    +G + L+
Sbjct: 310 EVLNSIGFEVTSVDDIMRRVQWPIDKVQARLLDLELDDQIERVLDGYIKLS 360


>gi|289664811|ref|ZP_06486392.1| DNA processing chain A [Xanthomonas campestris pv. vasculorum
           NCPPB702]
          Length = 254

 Score = 58.7 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 12/54 (22%), Positives = 25/54 (46%)

Query: 33  QCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
             +  R+ Q+L + P  +D ++  TG+ A  +  +LL ++L G +         
Sbjct: 199 DPDYQRLWQALGHDPTSMDSLVQRTGLTAAALSSMLLIMELEGDVVTEHGRYTR 252


>gi|255020220|ref|ZP_05292289.1| Rossmann fold nucleotide-binding protein Smf possibly involved in
           DNA uptake [Acidithiobacillus caldus ATCC 51756]
 gi|254970362|gb|EET27855.1| Rossmann fold nucleotide-binding protein Smf possibly involved in
           DNA uptake [Acidithiobacillus caldus ATCC 51756]
          Length = 364

 Score = 58.7 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 8/79 (10%), Positives = 26/79 (32%)

Query: 9   NFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVL 68
                          +          +   +  +L+   + +++I   +G+    +  +L
Sbjct: 281 EELGPLFHARRELQRDTAAPKAPEDPQERMVWNALHEDTLSLEEISERSGLTLSALSAIL 340

Query: 69  LELDLAGRLCHHPEGKVSL 87
           L +++ G +   P G+   
Sbjct: 341 LSMEIHGFIAPCPGGRFCR 359


>gi|288575793|ref|ZP_06393973.1| putative DNA processing protein DprA [Neisseria mucosa ATCC
          25996]
 gi|288567000|gb|EFC88560.1| putative DNA processing protein DprA [Neisseria mucosa ATCC
          25996]
          Length = 48

 Score = 58.7 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 14/45 (31%), Positives = 20/45 (44%)

Query: 43 LNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
          +   P+H D +   T   A  VY  LLE +L G +   P G+   
Sbjct: 1  MGYDPVHPDILAQQTAWAAADVYARLLEYELDGIVAALPGGRYQR 45


>gi|91203661|emb|CAJ71314.1| strongly similar to competence protein DprA [Candidatus Kuenenia
           stuttgartiensis]
          Length = 367

 Score = 58.7 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 12/54 (22%), Positives = 25/54 (46%)

Query: 32  TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
                 +I   L++ PI+ID+II  T + + +V   L+ L++   +      + 
Sbjct: 311 LNSHEKKIFSLLSSAPIYIDEIIQSTKLPSSIVSSTLMILEIKKLVKQLSGKRF 364


>gi|332139432|ref|YP_004425170.1| DNA protecting protein DprA [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|327549454|gb|AEA96172.1| DNA protecting protein DprA [Alteromonas macleodii str. 'Deep
           ecotype']
          Length = 369

 Score = 58.7 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 13/51 (25%), Positives = 19/51 (37%)

Query: 37  VRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
            ++  S+      ID I     +        LLE +L G +   P G V L
Sbjct: 316 DKLLASVEYDITAIDVIAQRNALSVSQAMASLLEYELRGLVAAVPGGYVKL 366


>gi|260775016|ref|ZP_05883916.1| rossmann fold nucleotide-binding protein Smf possibly involved in
           DNA uptake [Vibrio coralliilyticus ATCC BAA-450]
 gi|260609106|gb|EEX35265.1| rossmann fold nucleotide-binding protein Smf possibly involved in
           DNA uptake [Vibrio coralliilyticus ATCC BAA-450]
          Length = 371

 Score = 58.7 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 11/49 (22%), Positives = 23/49 (46%)

Query: 38  RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
           ++  ++ +    +D +   T I    V + LLEL+L+G +     G + 
Sbjct: 319 QLLANVGSKATPVDILASRTNIPVHEVMMQLLELELSGHVVAVSGGYIR 367


>gi|237724431|ref|ZP_04554912.1| smf protein DNA processing chain A [Bacteroides sp. D4]
 gi|229437300|gb|EEO47377.1| smf protein DNA processing chain A [Bacteroides dorei 5_1_36/D4]
          Length = 371

 Score = 58.7 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 16/87 (18%), Positives = 29/87 (33%), Gaps = 4/87 (4%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYP--EYTQCERVRIKQSLNNVP--IHIDDIIHHTGIE 60
              ++        N+++               E   I   L  VP  + I+ +I  T I 
Sbjct: 283 TSAEDLVKGMGWENNSRTEKTIQRELFPDLNEEETAIVTLLQKVPDGLQINTLIVETNIP 342

Query: 61  APVVYLVLLELDLAGRLCHHPEGKVSL 87
              +  +L EL++ G +     G   L
Sbjct: 343 VHKMSALLFELEMKGVIRTLAGGVYRL 369


>gi|160872061|ref|ZP_02062193.1| protein smf (DNA-processing chain A) [Rickettsiella grylli]
 gi|159120860|gb|EDP46198.1| protein smf (DNA-processing chain A) [Rickettsiella grylli]
          Length = 384

 Score = 58.7 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 12/69 (17%), Positives = 22/69 (31%)

Query: 18  NHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRL 77
             +      +       +  ++ + L      ID ++  T +    V   L  L L G +
Sbjct: 315 PRSPLTPQKNQRSSLDSQDKKLVECLGFETTSIDSVLARTKLPITTVLDRLSILQLQGYI 374

Query: 78  CHHPEGKVS 86
              P G V 
Sbjct: 375 DKVPGGYVR 383


>gi|189426316|ref|YP_001953493.1| DNA protecting protein DprA [Geobacter lovleyi SZ]
 gi|189422575|gb|ACD96973.1| DNA protecting protein DprA [Geobacter lovleyi SZ]
          Length = 364

 Score = 58.7 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 16/74 (21%), Positives = 27/74 (36%), Gaps = 3/74 (4%)

Query: 17  TNHTKNINITHYPE---YTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDL 73
           + H   +   H P            + + +   P H+D+I     +    V  ++L L+L
Sbjct: 290 SEHALPLLDRHAPPLRCSLTPREAAVYELVAQGPRHLDEITQALELTPGEVSAMVLGLEL 349

Query: 74  AGRLCHHPEGKVSL 87
            G L   P    SL
Sbjct: 350 KGMLQQLPGSYYSL 363


>gi|169830783|ref|YP_001716765.1| DNA protecting protein DprA [Candidatus Desulforudis audaxviator
           MP104C]
 gi|169637627|gb|ACA59133.1| DNA protecting protein DprA [Candidatus Desulforudis audaxviator
           MP104C]
          Length = 394

 Score = 58.7 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 14/67 (20%), Positives = 22/67 (32%)

Query: 19  HTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLC 78
                           E  R+ + L    +    +I  TG+ AP    VL  L++ G + 
Sbjct: 318 PETESGEAEAVAQLSGEEKRVLEILQGQSLSDQALIRLTGLAAPQTAAVLAYLEIKGFVR 377

Query: 79  HHPEGKV 85
             P G  
Sbjct: 378 RAPGGLY 384


>gi|260599605|ref|YP_003212176.1| hypothetical protein CTU_38130 [Cronobacter turicensis z3032]
 gi|260218782|emb|CBA34130.1| Protein smf [Cronobacter turicensis z3032]
          Length = 381

 Score = 58.7 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 17/80 (21%), Positives = 30/80 (37%), Gaps = 6/80 (7%)

Query: 8   QNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLV 67
           QN        N++ +      P         +  ++ +    +D +    G   P+    
Sbjct: 295 QNELPWLKTVNYSPDQEEGALPFP------ELLANVGDEVTPVDVVAERAGQPVPLTVAQ 348

Query: 68  LLELDLAGRLCHHPEGKVSL 87
           LLEL+LAG +   P G V +
Sbjct: 349 LLELELAGWIAAVPGGYVRV 368


>gi|254507278|ref|ZP_05119414.1| Smf protein [Vibrio parahaemolyticus 16]
 gi|219549738|gb|EED26727.1| Smf protein [Vibrio parahaemolyticus 16]
          Length = 373

 Score = 58.7 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 13/67 (19%), Positives = 28/67 (41%), Gaps = 3/67 (4%)

Query: 23  INITHYPEYTQCERV---RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCH 79
           +    +P     E +   ++  ++ +    +D +   T I    V + LLEL+L+G +  
Sbjct: 301 VQQEIFPLEDSKEELPFPQLLANVGSRATPVDILASRTNIPVQEVMMQLLELELSGHVVA 360

Query: 80  HPEGKVS 86
              G + 
Sbjct: 361 VSGGYIR 367


>gi|30249915|ref|NP_841985.1| SMF family protein [Nitrosomonas europaea ATCC 19718]
 gi|30180952|emb|CAD85879.1| SMF family [Nitrosomonas europaea ATCC 19718]
          Length = 371

 Score = 58.3 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 13/55 (23%), Positives = 23/55 (41%)

Query: 33  QCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           + +   +    +     ID +   +G+    V  +LL L+L GR+   P GK   
Sbjct: 315 EGDDTGLLMYFSYDSTDIDTLCARSGLTVETVSAMLLGLELEGRIGSLPGGKYQR 369


>gi|163803313|ref|ZP_02197191.1| Smf protein [Vibrio sp. AND4]
 gi|159172883|gb|EDP57722.1| Smf protein [Vibrio sp. AND4]
          Length = 369

 Score = 58.3 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 12/49 (24%), Positives = 23/49 (46%)

Query: 38  RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
           ++  ++ N    +D +   T I    V + LLEL+L+G +     G + 
Sbjct: 317 QLLANVGNEATPVDILASRTNIPVQEVMMQLLELELSGHVVAVSGGYIR 365


>gi|58616939|ref|YP_196138.1| Smf protein (DNA processing chain A) [Ehrlichia ruminantium str.
           Gardel]
 gi|58416551|emb|CAI27664.1| Smf protein (DNA processing chain A) [Ehrlichia ruminantium str.
           Gardel]
          Length = 375

 Score = 58.3 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 14/55 (25%), Positives = 27/55 (49%)

Query: 33  QCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
              +  I Q + + P+ I++II  T +      + L+EL+ + ++   P  KV L
Sbjct: 318 DNAKNLILQHITHSPVEIEEIITSTNLSISTTLIALMELETSHKIERLPNNKVML 372


>gi|308047747|ref|YP_003911313.1| DNA protecting protein DprA [Ferrimonas balearica DSM 9799]
 gi|307629937|gb|ADN74239.1| DNA protecting protein DprA [Ferrimonas balearica DSM 9799]
          Length = 366

 Score = 58.3 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 13/50 (26%), Positives = 24/50 (48%)

Query: 38  RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
            +  S++     ID+++  + +   VV   L E++L G +   P G V L
Sbjct: 314 ALLDSVDYDATPIDNVVARSQLPVEVVLEQLTEMELDGWVAAVPGGYVRL 363


>gi|189218918|ref|YP_001939559.1| DNA uptake Rossmann fold nucleotide-binding protein
           [Methylacidiphilum infernorum V4]
 gi|189185776|gb|ACD82961.1| Rossmann fold nucleotide-binding protein involved in DNA uptake
           [Methylacidiphilum infernorum V4]
          Length = 380

 Score = 58.3 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 9/63 (14%), Positives = 28/63 (44%)

Query: 24  NITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEG 83
           + T        +   + ++LN+  + +D++   T +   V+  +L+ L++   +   P  
Sbjct: 316 DQTPIAIELSKDERLVYEALNDQEMSLDELAEKTDLAVSVLCPLLIRLEMKKIVQQLPGN 375

Query: 84  KVS 86
           + +
Sbjct: 376 RYA 378


>gi|253564628|ref|ZP_04842085.1| smf protein DNA processing chain A [Bacteroides sp. 3_2_5]
 gi|251948404|gb|EES88686.1| smf protein DNA processing chain A [Bacteroides sp. 3_2_5]
 gi|301165345|emb|CBW24917.1| putative DNA processing Smf-like protein [Bacteroides fragilis
           638R]
          Length = 373

 Score = 58.3 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 12/59 (20%), Positives = 22/59 (37%), Gaps = 1/59 (1%)

Query: 30  EYTQCERVRIKQSLNN-VPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
                E +RI   L     + I+ ++    I    +  +L EL++ G +     G   L
Sbjct: 313 PDLSAEELRIVDILGKLGDLQINALMVQADIPINKISAILFELEMKGVIRVLAGGVYQL 371


>gi|183600718|ref|ZP_02962211.1| hypothetical protein PROSTU_04314 [Providencia stuartii ATCC 25827]
 gi|188019698|gb|EDU57738.1| hypothetical protein PROSTU_04314 [Providencia stuartii ATCC 25827]
          Length = 359

 Score = 58.3 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 12/70 (17%), Positives = 21/70 (30%)

Query: 19  HTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLC 78
             + +              +I   +   P   D I          V  VL EL++ G + 
Sbjct: 290 PVEPLEEETLNAEFNLTENKILSMVEYHPTPADVIAERVQQPITEVIAVLTELEIDGAIA 349

Query: 79  HHPEGKVSLT 88
               G + L+
Sbjct: 350 SVTGGYIKLS 359


>gi|221135273|ref|ZP_03561576.1| hypothetical protein GHTCC_10125 [Glaciecola sp. HTCC2999]
          Length = 370

 Score = 58.3 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 14/49 (28%), Positives = 24/49 (48%)

Query: 39  IKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           +  S+      I++I  H+ +  P V   LLE +L+G++     G V L
Sbjct: 318 LLDSVGYEITAIENIAAHSSLPLPQVLAQLLEFELSGKVAAVAGGYVKL 366


>gi|92114982|ref|YP_574910.1| DNA processing protein DprA, putative [Chromohalobacter salexigens
           DSM 3043]
 gi|91798072|gb|ABE60211.1| DNA protecting protein DprA [Chromohalobacter salexigens DSM 3043]
          Length = 371

 Score = 58.3 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 13/86 (15%), Positives = 29/86 (33%), Gaps = 4/86 (4%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVV 64
             +   + +      + +                +   L+  P  +D ++  + ++    
Sbjct: 290 LEQLGQWQAPQAVVASTDDMTEAANAPADP----LLALLDTAPTPLDVLVERSELDVGGC 345

Query: 65  YLVLLELDLAGRLCHHPEGKVSLTMH 90
            + LLEL+LAG+      G V    H
Sbjct: 346 QMRLLELELAGQAAQVSGGWVRRATH 371


>gi|300721399|ref|YP_003710670.1| protein smf [Xenorhabdus nematophila ATCC 19061]
 gi|297627887|emb|CBJ88433.1| Protein smf [Xenorhabdus nematophila ATCC 19061]
          Length = 362

 Score = 58.3 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 15/56 (26%), Positives = 25/56 (44%)

Query: 30  EYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
           E T+     +  +++N    ID I   + +    V   LLEL+L G++     G V
Sbjct: 304 EQTELPFADVLVNVSNEVTPIDVIAQRSSLPVAEVMTKLLELELMGKVAVTAGGYV 359


>gi|289667881|ref|ZP_06488956.1| DNA processing chain A [Xanthomonas campestris pv. musacearum
           NCPPB4381]
          Length = 251

 Score = 58.3 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 12/54 (22%), Positives = 25/54 (46%)

Query: 33  QCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
             +  R+ Q+L + P  +D ++  TG+ A  +  +LL ++L G +         
Sbjct: 196 DPDYQRLWQALGHDPTSMDSLVQRTGLTAAALSSMLLIMELEGDVVTEHGRYTR 249


>gi|312882740|ref|ZP_07742475.1| nucleotide-binding protein [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309369598|gb|EFP97115.1| nucleotide-binding protein [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 372

 Score = 58.3 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 11/50 (22%), Positives = 23/50 (46%)

Query: 37  VRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
             +  ++ +  + +D +   T I    V + LLEL+L+G +     G + 
Sbjct: 319 AELLANVGSKAVPVDILASRTHIPVQEVMMQLLELELSGHIVAVSGGYIR 368


>gi|60683760|ref|YP_213904.1| putative DNA processing Smf-like protein [Bacteroides fragilis NCTC
           9343]
 gi|60495194|emb|CAH10015.1| putative DNA processing Smf-like protein [Bacteroides fragilis NCTC
           9343]
          Length = 373

 Score = 58.3 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 12/59 (20%), Positives = 22/59 (37%), Gaps = 1/59 (1%)

Query: 30  EYTQCERVRIKQSLNN-VPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
                E +RI   L     + I+ ++    I    +  +L EL++ G +     G   L
Sbjct: 313 PDLSAEELRIVDILGKLGDLQINALMVQADIPINKISAILFELEMKGVIRVLAGGVYQL 371


>gi|53715841|ref|YP_101833.1| Smf protein DNA processing chain A [Bacteroides fragilis YCH46]
 gi|265764708|ref|ZP_06092983.1| smf protein DNA processing chain A [Bacteroides sp. 2_1_16]
 gi|52218706|dbj|BAD51299.1| Smf protein DNA processing chain A [Bacteroides fragilis YCH46]
 gi|263254092|gb|EEZ25526.1| smf protein DNA processing chain A [Bacteroides sp. 2_1_16]
          Length = 373

 Score = 58.3 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 12/59 (20%), Positives = 22/59 (37%), Gaps = 1/59 (1%)

Query: 30  EYTQCERVRIKQSLNN-VPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
                E +RI   L     + I+ ++    I    +  +L EL++ G +     G   L
Sbjct: 313 PDLSAEELRIVDILGKLGDLQINALMVQADIPINKISAILFELEMKGVIRVLAGGVYQL 371


>gi|188574931|ref|YP_001911860.1| DNA protecting protein DprA [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|188519383|gb|ACD57328.1| DNA protecting protein DprA [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 311

 Score = 58.3 bits (140), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 13/78 (16%), Positives = 28/78 (35%), Gaps = 2/78 (2%)

Query: 11  FSSQSDTNHTKNINITHY--PEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVL 68
              +           T    P  +  +  R+ Q+L + P  +D ++  T + A  +  +L
Sbjct: 232 LRERLAAPTELPRKTTAGAGPARSDPDYQRLWQALGHDPTPMDSLVQRTELTAAALSSML 291

Query: 69  LELDLAGRLCHHPEGKVS 86
           L ++L G +         
Sbjct: 292 LIMELEGDVVTEHGRYTR 309


>gi|294664415|ref|ZP_06729772.1| DNA processing chain A [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 10535]
 gi|292605821|gb|EFF49115.1| DNA processing chain A [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 10535]
          Length = 138

 Score = 58.3 bits (140), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 13/76 (17%), Positives = 31/76 (40%)

Query: 11  FSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLE 70
            ++ ++            P  +  +  R+ Q+L + P  +D ++  TG+ A  +  +LL 
Sbjct: 61  LAAPTELPGKATTGAGPGPARSDPDYQRLWQALGHDPTPMDSLVQRTGLTAATLSSMLLI 120

Query: 71  LDLAGRLCHHPEGKVS 86
           ++L G +         
Sbjct: 121 MELEGDVVTEHGRYTR 136


>gi|154489877|ref|ZP_02030138.1| hypothetical protein PARMER_00106 [Parabacteroides merdae ATCC
           43184]
 gi|154089319|gb|EDN88363.1| hypothetical protein PARMER_00106 [Parabacteroides merdae ATCC
           43184]
          Length = 371

 Score = 58.3 bits (140), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 13/76 (17%), Positives = 29/76 (38%), Gaps = 1/76 (1%)

Query: 14  QSDTNHTKNINITHYPEYTQCERVRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLLELD 72
           Q+     +        E    E+  +   +     IHI+++     I    + ++L EL+
Sbjct: 296 QAGATPVQTELFFAEAETFTSEQNPVLAIMRTRNEIHINELASVLEIPVHQLSMLLFELE 355

Query: 73  LAGRLCHHPEGKVSLT 88
           + G++   P     L+
Sbjct: 356 INGKVKALPGNLYKLS 371


>gi|124009967|ref|ZP_01694631.1| Smf protein DNA processing chain A [Microscilla marina ATCC 23134]
 gi|123983989|gb|EAY24372.1| Smf protein DNA processing chain A [Microscilla marina ATCC 23134]
          Length = 371

 Score = 58.3 bits (140), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 15/60 (25%), Positives = 22/60 (36%), Gaps = 3/60 (5%)

Query: 31  YTQCERVRIKQSLNNVP---IHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
               E   I   L   P   + +D+I     +    V   LL L++ G L   P  K +L
Sbjct: 311 PENAEEKEIVVLLQKQPKKTLSLDEISWQLKMPLSKVSACLLNLEIQGYLKSLPGKKFTL 370


>gi|85859218|ref|YP_461420.1| SMF family protein involved in DNA uptake [Syntrophus
           aciditrophicus SB]
 gi|85722309|gb|ABC77252.1| SMF family protein involved in DNA uptake [Syntrophus
           aciditrophicus SB]
          Length = 394

 Score = 58.3 bits (140), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 13/58 (22%), Positives = 19/58 (32%)

Query: 30  EYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
                    I   L + P+ ID II  +G+        LL L+L   +   P      
Sbjct: 329 PSFSENEALIFNLLTDKPVDIDLIIEKSGLNINETLNCLLNLELYEAILQLPGKLYKR 386


>gi|149279365|ref|ZP_01885496.1| putative DNA processing Smf-like protein [Pedobacter sp. BAL39]
 gi|149229891|gb|EDM35279.1| putative DNA processing Smf-like protein [Pedobacter sp. BAL39]
          Length = 365

 Score = 57.9 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 13/76 (17%), Positives = 24/76 (31%)

Query: 13  SQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELD 72
             + +           P     E   +   L   P+ ID I     +    + L LL L+
Sbjct: 290 QPTRSVEKAKATQVQLPLDLLPEEQSLMGCLAKGPLDIDQIALKIALPQSKIVLHLLNLE 349

Query: 73  LAGRLCHHPEGKVSLT 88
           + G +   P     ++
Sbjct: 350 MNGLITALPGKSYRIS 365


>gi|119773187|ref|YP_925927.1| DNA processing protein DprA [Shewanella amazonensis SB2B]
 gi|119765687|gb|ABL98257.1| DNA processing protein DprA, putative [Shewanella amazonensis SB2B]
          Length = 338

 Score = 57.9 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 14/50 (28%), Positives = 24/50 (48%)

Query: 38  RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
            +  S+      ID ++ H+G    +V   +LEL+L G +   P G V +
Sbjct: 286 ELLASVEYETTPIDRLVEHSGKPIDLVLEQILELELQGWVAAVPGGYVRV 335


>gi|21244527|ref|NP_644109.1| DNA processing chain A [Xanthomonas axonopodis pv. citri str. 306]
 gi|21110199|gb|AAM38645.1| DNA processing chain A [Xanthomonas axonopodis pv. citri str. 306]
          Length = 381

 Score = 57.9 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 13/74 (17%), Positives = 33/74 (44%)

Query: 11  FSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLE 70
            ++ ++       +    P  +  +  R+ Q+L++ P  +D ++  TG+ A  +  +LL 
Sbjct: 304 LAAPTELPGKATTSAGPGPARSDPDYQRLWQALDHDPTPMDSLVQRTGLTAAALSSMLLI 363

Query: 71  LDLAGRLCHHPEGK 84
           ++L G +       
Sbjct: 364 MELEGDVVTEHGRY 377


>gi|21673094|ref|NP_661159.1| DprA/SMF protein, putative DNA processing factor [Chlorobium
           tepidum TLS]
 gi|21646166|gb|AAM71501.1| DprA/SMF protein, putative DNA processing factor [Chlorobium
           tepidum TLS]
          Length = 399

 Score = 57.9 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 16/82 (19%), Positives = 27/82 (32%), Gaps = 1/82 (1%)

Query: 6   IEQNFFSSQSDTNHTKNI-NITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVV 64
            E          +           P     E   I ++L +  +HID I   TG++   +
Sbjct: 314 AEDILAELNPAQHPALKTHPEASEPFDLNIEESCIVEALQSGAMHIDLIAEKTGLKIDAL 373

Query: 65  YLVLLELDLAGRLCHHPEGKVS 86
            + L EL+L   +   P     
Sbjct: 374 LVHLFELELKRIIEQEPGQIFR 395


>gi|189502567|ref|YP_001958284.1| hypothetical protein Aasi_1230 [Candidatus Amoebophilus asiaticus
           5a2]
 gi|189498008|gb|ACE06555.1| hypothetical protein Aasi_1230 [Candidatus Amoebophilus asiaticus
           5a2]
          Length = 374

 Score = 57.9 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 12/50 (24%), Positives = 22/50 (44%), Gaps = 1/50 (2%)

Query: 38  RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           ++ + L     +ID+I     +    V  +LL+L+L   +   P  K  L
Sbjct: 323 QVLKLLQKEA-YIDEISQQIQLSPSQVSSMLLQLELKNIVECLPGNKFKL 371


>gi|320154886|ref|YP_004187265.1| Rossmann fold nucleotide-binding protein Smf possibly involved in
           DNA uptake [Vibrio vulnificus MO6-24/O]
 gi|319930198|gb|ADV85062.1| Rossmann fold nucleotide-binding protein Smf possibly involved in
           DNA uptake [Vibrio vulnificus MO6-24/O]
          Length = 367

 Score = 57.9 bits (139), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 12/50 (24%), Positives = 24/50 (48%)

Query: 38  RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           ++  ++ N    +D + + T I    V + LLEL+L+G +     G +  
Sbjct: 315 QLLANVGNEATPVDILANRTNIPVQEVMMQLLELELSGHVVAVNGGYIRR 364


>gi|27364482|ref|NP_760010.1| DNA protecting protein DprA [Vibrio vulnificus CMCP6]
 gi|27360601|gb|AAO09537.1| DNA protecting protein DprA [Vibrio vulnificus CMCP6]
          Length = 367

 Score = 57.9 bits (139), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 12/50 (24%), Positives = 24/50 (48%)

Query: 38  RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           ++  ++ N    +D + + T I    V + LLEL+L+G +     G +  
Sbjct: 315 QLLANVGNEATPVDILANRTNIPVQEVMMQLLELELSGHVVAVNGGYIRR 364


>gi|283778858|ref|YP_003369613.1| DNA protecting protein DprA [Pirellula staleyi DSM 6068]
 gi|283437311|gb|ADB15753.1| DNA protecting protein DprA [Pirellula staleyi DSM 6068]
          Length = 401

 Score = 57.9 bits (139), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 13/83 (15%), Positives = 29/83 (34%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVV 64
             +++  S  S  +      +   P     E  +I + L+  P+ ID +   + +    V
Sbjct: 318 AKQRSLPSDSSSDSAAAPPKLAPIPADLSAEERKIVELLSAEPMLIDQVTVRSKLPISRV 377

Query: 65  YLVLLELDLAGRLCHHPEGKVSL 87
              L  L++   +      +V  
Sbjct: 378 LSTLSVLEMKRLISRVGGNQVMR 400


>gi|317131315|ref|YP_004090629.1| DNA protecting protein DprA [Ethanoligenens harbinense YUAN-3]
 gi|315469294|gb|ADU25898.1| DNA protecting protein DprA [Ethanoligenens harbinense YUAN-3]
          Length = 387

 Score = 57.9 bits (139), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 12/87 (13%), Positives = 27/87 (31%), Gaps = 6/87 (6%)

Query: 6   IEQNFFSSQSDTNHTK------NINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGI 59
            +Q+ F   +     +              +     +  +   L+  P H+D++     +
Sbjct: 299 AQQSLFPPAAVPPRPEPVPEKPATPARRPVQGLDDVQRAVLALLDASPRHVDELAVRASL 358

Query: 60  EAPVVYLVLLELDLAGRLCHHPEGKVS 86
               V  VL  L++ G     P  +  
Sbjct: 359 PPGQVLAVLTVLEIQGLARSEPGRRFC 385


>gi|328471165|gb|EGF42067.1| Smf protein [Vibrio parahaemolyticus 10329]
          Length = 370

 Score = 57.5 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 11/48 (22%), Positives = 24/48 (50%)

Query: 38  RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
           ++  ++ +    +D + + T I    V + LLEL+L+G +     G +
Sbjct: 318 QLLANVGSEATPVDILANRTNIPVREVMMQLLELELSGHVVAVSGGYI 365


>gi|300871631|ref|YP_003786504.1| DNA protecting protein DprA [Brachyspira pilosicoli 95/1000]
 gi|300689332|gb|ADK32003.1| DNA protecting protein, DprA [Brachyspira pilosicoli 95/1000]
          Length = 401

 Score = 57.5 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 15/59 (25%), Positives = 27/59 (45%), Gaps = 1/59 (1%)

Query: 30  EYTQCERVRIKQSLNN-VPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
              Q +   I   ++    IHIDDII  T ++   V  +L++L++ G +        S+
Sbjct: 341 PDLQDDEAFIYDIISKVEKIHIDDIIEKTNMKVQSVTSLLMQLEINGFIKQLSGKYYSI 399


>gi|196233436|ref|ZP_03132280.1| DNA protecting protein DprA [Chthoniobacter flavus Ellin428]
 gi|196222576|gb|EDY17102.1| DNA protecting protein DprA [Chthoniobacter flavus Ellin428]
          Length = 362

 Score = 57.5 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 14/69 (20%), Positives = 26/69 (37%)

Query: 17  TNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGR 76
               + ++          E   I  S++N    ID I+  +G+  P V   LL L++   
Sbjct: 291 APEPRKMSTPVSAIPLSTEEQSILASVDNAETPIDLIVTKSGLPMPKVASTLLALEMKRL 350

Query: 77  LCHHPEGKV 85
           +   P  + 
Sbjct: 351 VKQLPGQQF 359


>gi|328675504|gb|AEB28179.1| Rossmann fold nucleotide-binding protein Smf possibly involved in
           DNA uptake [Francisella cf. novicida 3523]
          Length = 368

 Score = 57.5 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 13/55 (23%), Positives = 21/55 (38%)

Query: 31  YTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
                   I  S++     ID II  + +    V  +L EL+L   +   P G +
Sbjct: 311 SLNESEKTILDSIDKELTTIDKIIIKSKLPYNQVTSILFELELKSLIESIPGGYI 365


>gi|254463787|ref|ZP_05077198.1| DNA protecting protein DprA [Rhodobacterales bacterium Y4I]
 gi|206684695|gb|EDZ45177.1| DNA protecting protein DprA [Rhodobacterales bacterium Y4I]
          Length = 365

 Score = 57.5 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 10/57 (17%), Positives = 20/57 (35%)

Query: 30  EYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
             T     +I   L   P    +++    +    +   L +L+L G +   P G + 
Sbjct: 301 AQTHALHQQILGRLGPSPTSETELMRGLALPPHELAPALTDLELEGAILRQPGGLLC 357


>gi|167753798|ref|ZP_02425925.1| hypothetical protein ALIPUT_02083 [Alistipes putredinis DSM 17216]
 gi|167658423|gb|EDS02553.1| hypothetical protein ALIPUT_02083 [Alistipes putredinis DSM 17216]
          Length = 370

 Score = 57.5 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 11/64 (17%), Positives = 25/64 (39%), Gaps = 1/64 (1%)

Query: 23  INITHYPEYTQCERVRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHP 81
              T  P     +   +      + PI  +++   +G+    +  +LL L++AG +   P
Sbjct: 303 DRPTAAPAALTRDEEGLLGCFRTDDPISAEELCELSGLGFGELSALLLGLEMAGAVRQLP 362

Query: 82  EGKV 85
             + 
Sbjct: 363 GNRY 366


>gi|166363019|ref|YP_001655292.1| SMF family DNA processing protein [Microcystis aeruginosa NIES-843]
 gi|166085392|dbj|BAG00100.1| SMF family DNA processing protein [Microcystis aeruginosa NIES-843]
          Length = 382

 Score = 57.5 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 15/84 (17%), Positives = 30/84 (35%), Gaps = 2/84 (2%)

Query: 4   PQIEQNFFSSQSDTNHTKNINITHYPEY--TQCERVRIKQSLNNVPIHIDDIIHHTGIEA 61
           P   Q+   + S +   +     +       +    ++ Q  +   +  D I+    I  
Sbjct: 296 PTTNQSAPVNLSPSLPLETSPAFNPAPPVNLEPRLAQVYQLFDRDALLFDIIVEKMQIPT 355

Query: 62  PVVYLVLLELDLAGRLCHHPEGKV 85
             V  +LLEL+L G +   P  + 
Sbjct: 356 SEVAGILLELELMGLVTQLPGMRY 379


>gi|291327311|ref|ZP_06127796.2| DNA protecting protein DprA [Providencia rettgeri DSM 1131]
 gi|291310852|gb|EFE51305.1| DNA protecting protein DprA [Providencia rettgeri DSM 1131]
          Length = 361

 Score = 57.5 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 12/67 (17%), Positives = 23/67 (34%)

Query: 22  NINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHP 81
            + I   P        +I   +      +D I   T I    +  +L E+++ G +    
Sbjct: 295 ELPIEQAPLEFNVVENKILGMVGYQATPVDVIAEQTQIPVTQIITILTEMEINGVVSSGA 354

Query: 82  EGKVSLT 88
            G   +T
Sbjct: 355 GGYTRVT 361


>gi|57238947|ref|YP_180083.1| Smf protein (DNA processing chain A) [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58578880|ref|YP_197092.1| Smf protein (DNA processing chain A) [Ehrlichia ruminantium str.
           Welgevonden]
 gi|57161026|emb|CAH57932.1| putative DNA processing protein chain A [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58417506|emb|CAI26710.1| Smf protein (DNA processing chain A) [Ehrlichia ruminantium str.
           Welgevonden]
          Length = 375

 Score = 57.5 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 14/55 (25%), Positives = 27/55 (49%)

Query: 33  QCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
              +  I Q + + P+ I++II  T +      + L+EL+ + ++   P  KV L
Sbjct: 318 DNAKNLILQHITHSPVKIEEIITSTNLSISTTLIALMELETSHKIERLPNNKVML 372


>gi|212709013|ref|ZP_03317141.1| hypothetical protein PROVALCAL_00045 [Providencia alcalifaciens DSM
           30120]
 gi|212688379|gb|EEB47907.1| hypothetical protein PROVALCAL_00045 [Providencia alcalifaciens DSM
           30120]
          Length = 369

 Score = 57.5 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 10/53 (18%), Positives = 20/53 (37%)

Query: 36  RVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
             RI   +      +D I     +    +  VL EL++ G +     G + ++
Sbjct: 317 ESRILGMVGYQSTPVDIIAAQLQLPITQIISVLTELEINGVISSAAGGYIKVS 369


>gi|58580206|ref|YP_199222.1| DNA processing chain A [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84622201|ref|YP_449573.1| DNA processing chain A [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|58424800|gb|AAW73837.1| DNA processing chain A [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|84366141|dbj|BAE67299.1| DNA processing chain A [Xanthomonas oryzae pv. oryzae MAFF 311018]
          Length = 380

 Score = 57.5 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 13/78 (16%), Positives = 28/78 (35%), Gaps = 2/78 (2%)

Query: 11  FSSQSDTNHTKNINITHY--PEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVL 68
              +           T    P  +  +  R+ Q+L + P  +D ++  T + A  +  +L
Sbjct: 301 LRERLAAPTELPRKTTAGAGPARSDPDYQRLWQALGHDPTPMDSLVQRTELTAAALSSML 360

Query: 69  LELDLAGRLCHHPEGKVS 86
           L ++L G +         
Sbjct: 361 LIMELEGDVVTEHGRYTR 378


>gi|303237995|ref|ZP_07324538.1| putative DNA protecting protein DprA [Prevotella disiens
           FB035-09AN]
 gi|302481785|gb|EFL44837.1| putative DNA protecting protein DprA [Prevotella disiens
           FB035-09AN]
          Length = 375

 Score = 57.5 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 15/74 (20%), Positives = 30/74 (40%), Gaps = 2/74 (2%)

Query: 15  SDTNHTKNINITHYPEYTQCERVRIKQSLN-NVPIHIDDIIHHTGIEAPVVYLVLLELDL 73
            +  H   I  T +P     E  +I ++L  +  + I+ +   T +    +  +L EL++
Sbjct: 301 LEKAHQNGIERTLFP-TLTEEEKQIVEALQTHNDLQINMLSVQTNLPIARLTALLFELEM 359

Query: 74  AGRLCHHPEGKVSL 87
            G +     G   L
Sbjct: 360 KGIIRTMAGGCYHL 373


>gi|189183183|ref|YP_001936968.1| DNA processing protein Smf [Orientia tsutsugamushi str. Ikeda]
 gi|189179954|dbj|BAG39734.1| DNA processing protein Smf [Orientia tsutsugamushi str. Ikeda]
          Length = 386

 Score = 57.2 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 17/56 (30%), Positives = 34/56 (60%)

Query: 32  TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           T  +R  +K  L++VP+ I+ I++ T +   +V +++LEL+LAG +      K+ +
Sbjct: 324 TDDQRTIVKNILSSVPLDIEVIVNQTKLPMNIVNVIILELELAGIVARCLGNKIVI 379


>gi|148284625|ref|YP_001248715.1| DNA processing protein [Orientia tsutsugamushi str. Boryong]
 gi|146740064|emb|CAM80189.1| DNA processing protein [Orientia tsutsugamushi str. Boryong]
          Length = 386

 Score = 57.2 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 17/56 (30%), Positives = 34/56 (60%)

Query: 32  TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           T  +R  +K  L++VP+ I+ I++ T +   +V +++LEL+LAG +      K+ +
Sbjct: 324 TDDQRTIVKNILSSVPLDIEVIVNQTKLPMNIVNVIILELELAGIVARCLGNKIVI 379


>gi|187935056|ref|YP_001885453.1| DNA uptake protein [Clostridium botulinum B str. Eklund 17B]
 gi|187723209|gb|ACD24430.1| DNA uptake protein [Clostridium botulinum B str. Eklund 17B]
          Length = 352

 Score = 57.2 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 13/52 (25%), Positives = 24/52 (46%)

Query: 34  CERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
            E+  I   + + PIHIDDI   + ++   +Y +L E+ +   +   P    
Sbjct: 297 PEKREILDMITDAPIHIDDIFKKSCVDRGALYALLFEMQIKNEIICLPGNYY 348


>gi|241667272|ref|ZP_04754850.1| DNA processing protein DprA [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254875823|ref|ZP_05248533.1| DNA processing protein dprA [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254841844|gb|EET20258.1| DNA processing protein dprA [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
          Length = 366

 Score = 57.2 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 10/54 (18%), Positives = 19/54 (35%)

Query: 32  TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
                  I   +      ID I+  + +    +  +L EL+L   +   P G +
Sbjct: 310 LSNSEKVILDIIGQGLTTIDKIVTESKLPYMEITPILFELELKSLIESVPGGYI 363


>gi|167626698|ref|YP_001677198.1| DNA processing protein DprA [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
 gi|167596699|gb|ABZ86697.1| DNA processing protein DprA [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
          Length = 288

 Score = 57.2 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 10/54 (18%), Positives = 19/54 (35%)

Query: 32  TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
                  I   +      ID I+  + +    +  +L EL+L   +   P G +
Sbjct: 232 LSNSEKVILDIIGQGLTTIDKIVTESKLPYMEITPILFELELKSLIESVPGGYI 285


>gi|71898891|ref|ZP_00681058.1| SMF protein [Xylella fastidiosa Ann-1]
 gi|71731303|gb|EAO33367.1| SMF protein [Xylella fastidiosa Ann-1]
          Length = 381

 Score = 57.2 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 16/86 (18%), Positives = 32/86 (37%), Gaps = 2/86 (2%)

Query: 1   MVHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIE 60
           +  P         + D        +   P     +   + Q+L + P+ +D +I  TG+ 
Sbjct: 296 LAAPLAHT--LRERLDAPSWPGAPLLSTPNSKDPKYHTLWQALAHDPMSMDSLIDRTGLT 353

Query: 61  APVVYLVLLELDLAGRLCHHPEGKVS 86
           A  +  +LL L+L G++         
Sbjct: 354 AATLSSMLLTLELEGKVVVEHGRYTR 379


>gi|288800404|ref|ZP_06405862.1| DNA processing protein DprA [Prevotella sp. oral taxon 299 str.
           F0039]
 gi|288332617|gb|EFC71097.1| DNA processing protein DprA [Prevotella sp. oral taxon 299 str.
           F0039]
          Length = 378

 Score = 57.2 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 15/78 (19%), Positives = 30/78 (38%), Gaps = 2/78 (2%)

Query: 13  SQSDTNHTKNINITHYPEYTQCERVRIKQSLN-NVPIHIDDIIHHTGIEAPVVYLVLLEL 71
           S  +    K I    +P     +  ++   L  +  + I+ ++  T +    +  VL EL
Sbjct: 301 SLLNKAKEKGIERELFP-TLNADEQKVVDILKKHNNLQINILLAQTDLSIGKLSAVLFEL 359

Query: 72  DLAGRLCHHPEGKVSLTM 89
           ++ G +     G   L M
Sbjct: 360 EMKGIVRAMAGGSYHLLM 377


>gi|323493840|ref|ZP_08098958.1| Smf protein [Vibrio brasiliensis LMG 20546]
 gi|323311974|gb|EGA65120.1| Smf protein [Vibrio brasiliensis LMG 20546]
          Length = 372

 Score = 57.2 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 12/48 (25%), Positives = 25/48 (52%)

Query: 38  RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
           ++  ++ +  I +D + + T I    V + LLEL+L+G +     G +
Sbjct: 320 QLLANVGSKAIPVDILANRTNIPVQEVMMQLLELELSGHVVAVSGGYI 367


>gi|206579194|ref|YP_002236312.1| DNA protecting protein DprA [Klebsiella pneumoniae 342]
 gi|206568252|gb|ACI10028.1| DNA protecting protein DprA [Klebsiella pneumoniae 342]
          Length = 360

 Score = 57.2 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 14/49 (28%), Positives = 22/49 (44%)

Query: 38  RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
            +  ++ +    +D +    G   PV    LLEL+LAG +   P G V 
Sbjct: 312 ELLANVGDEVTPVDVVAERAGQSVPVTVAQLLELELAGWIAAVPGGYVR 360


>gi|251779444|ref|ZP_04822364.1| DNA protecting protein DprA [Clostridium botulinum E1 str. 'BoNT E
           Beluga']
 gi|243083759|gb|EES49649.1| DNA protecting protein DprA [Clostridium botulinum E1 str. 'BoNT E
           Beluga']
          Length = 352

 Score = 57.2 bits (137), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 12/52 (23%), Positives = 23/52 (44%)

Query: 34  CERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
            E+  I   + + P HIDDI   + ++   +Y +L E+ +   +   P    
Sbjct: 297 PEKREILDMITDAPTHIDDIFKKSCVDRGALYALLFEMQIKNEIICLPGNYY 348


>gi|188589719|ref|YP_001920600.1| DNA protecting protein DprA [Clostridium botulinum E3 str. Alaska
           E43]
 gi|188500000|gb|ACD53136.1| DNA protecting protein DprA [Clostridium botulinum E3 str. Alaska
           E43]
          Length = 352

 Score = 57.2 bits (137), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 12/52 (23%), Positives = 23/52 (44%)

Query: 34  CERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
            E+  I   + + P HIDDI   + ++   +Y +L E+ +   +   P    
Sbjct: 297 PEKREILDMITDAPTHIDDIFKKSCVDRGALYALLFEMQIKNEIICLPGNYY 348


>gi|94970368|ref|YP_592416.1| DNA processing protein DprA, putative [Candidatus Koribacter
           versatilis Ellin345]
 gi|94552418|gb|ABF42342.1| DNA protecting protein DprA [Candidatus Koribacter versatilis
           Ellin345]
          Length = 385

 Score = 57.2 bits (137), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 13/87 (14%), Positives = 31/87 (35%), Gaps = 3/87 (3%)

Query: 6   IEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSL-NNVPIHIDDIIHHTG--IEAP 62
           I       ++    T              +  ++   L  +  +HID++I      + + 
Sbjct: 299 IRLQIPPPEALATETPQAASLFDQHEMPAQERKVYALLRADESMHIDELIEKLDGRLSSA 358

Query: 63  VVYLVLLELDLAGRLCHHPEGKVSLTM 89
            ++  L EL++A ++   P      +M
Sbjct: 359 EIFSALFELEMASKIRQMPGKYYVRSM 385


>gi|34540135|ref|NP_904614.1| DNA processing protein DprA [Porphyromonas gingivalis W83]
 gi|34396447|gb|AAQ65513.1| DNA processing protein DprA, putative [Porphyromonas gingivalis
           W83]
          Length = 374

 Score = 57.2 bits (137), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 14/83 (16%), Positives = 28/83 (33%), Gaps = 1/83 (1%)

Query: 6   IEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSL-NNVPIHIDDIIHHTGIEAPVV 64
             Q+  +    ++       T            + + L       +D++   TG+    V
Sbjct: 291 SAQDVLTLLDWSSTIDAKPQTLNFRPDSWPDTPVAECLLRAGTASVDELTRATGLPINDV 350

Query: 65  YLVLLELDLAGRLCHHPEGKVSL 87
              L +L+L G +   P G  S+
Sbjct: 351 SAQLFDLELDGLVQSQPGGIYSV 373


>gi|114330415|ref|YP_746637.1| DNA protecting protein DprA [Nitrosomonas eutropha C91]
 gi|114307429|gb|ABI58672.1| DNA protecting protein DprA [Nitrosomonas eutropha C91]
          Length = 373

 Score = 57.2 bits (137), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 13/80 (16%), Positives = 28/80 (35%), Gaps = 2/80 (2%)

Query: 10  FFSSQSDTNHTKNINITHYPEYTQC--ERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLV 67
               Q +     +       + +    +   +    +   I ID +   +G+    V  +
Sbjct: 292 QPIQQIEAAPVNHNETGGLVDASSDCIDDTGLLIYFDYDSIDIDTLCIRSGLTVEAVSAM 351

Query: 68  LLELDLAGRLCHHPEGKVSL 87
           LL L+L G++   P G+   
Sbjct: 352 LLILELEGKIGSLPGGRYQR 371


>gi|160939767|ref|ZP_02087114.1| hypothetical protein CLOBOL_04658 [Clostridium bolteae ATCC
           BAA-613]
 gi|158437201|gb|EDP14966.1| hypothetical protein CLOBOL_04658 [Clostridium bolteae ATCC
           BAA-613]
          Length = 390

 Score = 56.8 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 13/47 (27%), Positives = 21/47 (44%)

Query: 36  RVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPE 82
              +   L++ P H++ I+  TG+ A      LLEL+L G       
Sbjct: 336 EKMVYSCLDSEPRHLEQIMVQTGLSAGRCMSALLELELEGFAVRTSG 382


>gi|285019620|ref|YP_003377331.1| DNA processing chain a protein [Xanthomonas albilineans GPE PC73]
 gi|283474838|emb|CBA17337.1| putative dna processing chain a protein [Xanthomonas albilineans]
          Length = 384

 Score = 56.8 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 15/85 (17%), Positives = 34/85 (40%)

Query: 2   VHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEA 61
           +  Q+     +  S       +     P++   +   + Q+L + P+ +D +I  +G+ A
Sbjct: 298 LAAQLADALRTRLSPPTQGTTVERRTTPDFPNPDYQNLWQALGHDPLCMDSLITRSGLTA 357

Query: 62  PVVYLVLLELDLAGRLCHHPEGKVS 86
             V  +LL ++L G +         
Sbjct: 358 AAVSSMLLTMELDGYVAVERGRYTR 382


>gi|297180812|gb|ADI17018.1| predicted rossmann fold nucleotide-binding protein involved in DNA
           uptake [uncultured Vibrionales bacterium HF0010_22E23]
          Length = 366

 Score = 56.8 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 11/48 (22%), Positives = 20/48 (41%)

Query: 39  IKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
           +  ++ N    +D +          + + LLEL+L G +   P G V 
Sbjct: 315 LLANVGNEATCVDVLAEICDQPVHEIMMQLLELELQGFVSAVPGGYVR 362


>gi|293602355|ref|ZP_06684801.1| DNA protecting protein DprA [Achromobacter piechaudii ATCC 43553]
 gi|292819117|gb|EFF78152.1| DNA protecting protein DprA [Achromobacter piechaudii ATCC 43553]
          Length = 370

 Score = 56.8 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 14/51 (27%), Positives = 25/51 (49%)

Query: 37  VRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
             +  ++   P+H+D I   +GI    +   L+EL+L GRL    +G+   
Sbjct: 318 HPVLDAMGYDPLHLDAIFARSGIAIDALQAQLVELELQGRLARLDDGRYQR 368


>gi|37681407|ref|NP_936016.1| Smf protein [Vibrio vulnificus YJ016]
 gi|37200159|dbj|BAC95987.1| Smf protein [Vibrio vulnificus YJ016]
          Length = 367

 Score = 56.8 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 12/49 (24%), Positives = 23/49 (46%)

Query: 39  IKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           +  ++ N    +D + + T I    V + LLEL+L+G +     G +  
Sbjct: 316 LLANVGNEATPVDILANRTNIPVQEVMMQLLELELSGHVVAVNGGYIRR 364


>gi|99082178|ref|YP_614332.1| DNA processing protein DprA, putative [Ruegeria sp. TM1040]
 gi|99038458|gb|ABF65070.1| DNA processing protein DprA putative [Ruegeria sp. TM1040]
          Length = 382

 Score = 56.8 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 17/84 (20%), Positives = 26/84 (30%)

Query: 2   VHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEA 61
           + P          S  +             T     +I   L   P     +I   G  A
Sbjct: 295 LPPLNAHRPPQRPSVQDLPSPPPERRNLRQTAALHQQILDRLAAAPTPEGQLIKDLGSPA 354

Query: 62  PVVYLVLLELDLAGRLCHHPEGKV 85
             V  VL +L+L+G +   P G +
Sbjct: 355 RKVRTVLTDLELSGEIGREPGGVI 378


>gi|149197252|ref|ZP_01874304.1| SMF family protein involved in DNA uptake [Lentisphaera araneosa
           HTCC2155]
 gi|149139798|gb|EDM28199.1| SMF family protein involved in DNA uptake [Lentisphaera araneosa
           HTCC2155]
          Length = 380

 Score = 56.8 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 15/69 (21%), Positives = 25/69 (36%)

Query: 20  TKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCH 79
           T+      +         RI + L +  +H+D I   + +    V   LL L+    +  
Sbjct: 306 TEKQENREFDLQLDENERRIMEILKSGELHVDKICELSELNVGQVLATLLGLETHKLIRL 365

Query: 80  HPEGKVSLT 88
            P  K  LT
Sbjct: 366 LPGKKYELT 374


>gi|108804233|ref|YP_644170.1| DNA processing protein DprA [Rubrobacter xylanophilus DSM 9941]
 gi|108765476|gb|ABG04358.1| DNA processing protein DprA, putative [Rubrobacter xylanophilus DSM
           9941]
          Length = 368

 Score = 56.8 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 10/47 (21%), Positives = 17/47 (36%)

Query: 37  VRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEG 83
             +  +L   P   D++    G+    V   L  L+L G +     G
Sbjct: 314 AAVLGALGFEPAPADEVAQRCGLAMGQVLSALSMLELKGYVVRDAGG 360


>gi|28199636|ref|NP_779950.1| DNA processing chain A [Xylella fastidiosa Temecula1]
 gi|182682381|ref|YP_001830541.1| DNA protecting protein DprA [Xylella fastidiosa M23]
 gi|28057751|gb|AAO29599.1| DNA processing chain A [Xylella fastidiosa Temecula1]
 gi|182632491|gb|ACB93267.1| DNA protecting protein DprA [Xylella fastidiosa M23]
 gi|307578663|gb|ADN62632.1| DNA protecting protein DprA [Xylella fastidiosa subsp. fastidiosa
           GB514]
          Length = 381

 Score = 56.8 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 16/84 (19%), Positives = 32/84 (38%), Gaps = 2/84 (2%)

Query: 1   MVHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIE 60
           +  P         + D        +   P     +   + Q+L + P+ +D +I  TG+ 
Sbjct: 296 LAAPLAHT--LRERLDAPSWPVAPLLSTPNSKDPKYHTLWQALAHDPMSMDSLIDRTGLT 353

Query: 61  APVVYLVLLELDLAGRLCHHPEGK 84
           A  +  +LL L+L G++       
Sbjct: 354 AATLSSMLLTLELEGKVVVEHGRY 377


>gi|297570259|ref|YP_003691603.1| DNA protecting protein DprA [Desulfurivibrio alkaliphilus AHT2]
 gi|296926174|gb|ADH86984.1| DNA protecting protein DprA [Desulfurivibrio alkaliphilus AHT2]
          Length = 381

 Score = 56.8 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 17/57 (29%), Positives = 26/57 (45%)

Query: 30  EYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
                E   +   L++ P  I++II   G+ A  V  VLLEL+L G +   P  +  
Sbjct: 323 PPLTNEAATVLAVLDDYPKAIEEIITQAGMAARQVNAVLLELELQGLIESEPGPQYR 379


>gi|220923237|ref|YP_002498539.1| DNA protecting protein DprA [Methylobacterium nodulans ORS 2060]
 gi|219947844|gb|ACL58236.1| DNA protecting protein DprA [Methylobacterium nodulans ORS 2060]
          Length = 391

 Score = 56.8 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 23/81 (28%), Positives = 33/81 (40%)

Query: 7   EQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYL 66
           E +FF   +                   +R R+   L   P+ ID +    G+ A  V  
Sbjct: 310 ETDFFGDGAAPAPVPLGFEEAEAPIPGSDRARLLALLGPAPVAIDALARQAGLPARAVQG 369

Query: 67  VLLELDLAGRLCHHPEGKVSL 87
           +LLEL+L G +  H  G VSL
Sbjct: 370 LLLELELDGLVARHGGGTVSL 390


>gi|262089745|gb|ACY24839.1| Smf protein [uncultured organism]
          Length = 382

 Score = 56.8 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 11/53 (20%), Positives = 24/53 (45%)

Query: 32  TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGK 84
                 ++  ++   P++IDD++  TGI    V   ++ L++ G +     G 
Sbjct: 327 LSPAEQQLIYAMGYDPVNIDDLVERTGIAVGSVAAQMIGLEIKGYVQQIGAGY 379


>gi|150016069|ref|YP_001308323.1| DNA protecting protein DprA [Clostridium beijerinckii NCIMB 8052]
 gi|149902534|gb|ABR33367.1| DNA protecting protein DprA [Clostridium beijerinckii NCIMB 8052]
          Length = 351

 Score = 56.4 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 14/52 (26%), Positives = 26/52 (50%)

Query: 34  CERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
            E+  I + + + PIHIDDI  +T ++   +Y +L E+ +   +   P    
Sbjct: 296 PEKSEILELITDSPIHIDDIFKNTSVDRGALYALLFEMQIKSEIICLPGNYY 347


>gi|295696103|ref|YP_003589341.1| DNA protecting protein DprA [Bacillus tusciae DSM 2912]
 gi|295411705|gb|ADG06197.1| DNA protecting protein DprA [Bacillus tusciae DSM 2912]
          Length = 384

 Score = 56.4 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 17/81 (20%), Positives = 28/81 (34%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVV 64
             E   + +    +    I           +  R+  +L       D I   TG+    +
Sbjct: 296 AAEYPHWPAALAASADGEIENQVPRRTVDSDSRRVLAALEEGCRTPDLIAGRTGLRLEHI 355

Query: 65  YLVLLELDLAGRLCHHPEGKV 85
             VL +L+LAGR+   P G  
Sbjct: 356 SRVLTDLELAGRIYREPGGLY 376


>gi|255012004|ref|ZP_05284130.1| putative DNA processing Smf-like protein [Bacteroides fragilis
           3_1_12]
 gi|313149841|ref|ZP_07812034.1| conserved hypothetical protein [Bacteroides fragilis 3_1_12]
 gi|313138608|gb|EFR55968.1| conserved hypothetical protein [Bacteroides fragilis 3_1_12]
          Length = 373

 Score = 56.4 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 12/59 (20%), Positives = 23/59 (38%), Gaps = 1/59 (1%)

Query: 30  EYTQCERVRIKQSLNN-VPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
                E +RI   L     + I+ ++    I    + ++L EL++ G +     G   L
Sbjct: 313 PDLSAEELRIVDILGRLGDLQINALMVQADIPINKISVILFELEMKGVIRVLAGGVYQL 371


>gi|114799220|ref|YP_760845.1| DNA protecting protein DprA [Hyphomonas neptunium ATCC 15444]
 gi|114739394|gb|ABI77519.1| DNA protecting protein DprA [Hyphomonas neptunium ATCC 15444]
          Length = 371

 Score = 56.4 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 15/89 (16%), Positives = 33/89 (37%)

Query: 1   MVHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIE 60
           ++            +      +            E  R++++L+   + +D+I    G+ 
Sbjct: 283 VLEVLSALPLLRVSAPPAELYDAAHGGGEAIPPSELARVREALSPHAMPLDEIARAAGVS 342

Query: 61  APVVYLVLLELDLAGRLCHHPEGKVSLTM 89
           A     +L+EL+LAG     P G  +  +
Sbjct: 343 AARAGAILMELELAGEAITFPGGMAARAV 371


>gi|71276451|ref|ZP_00652727.1| SMF protein [Xylella fastidiosa Dixon]
 gi|71901276|ref|ZP_00683375.1| SMF protein [Xylella fastidiosa Ann-1]
 gi|170731002|ref|YP_001776435.1| DNA processing chain A [Xylella fastidiosa M12]
 gi|71162767|gb|EAO12493.1| SMF protein [Xylella fastidiosa Dixon]
 gi|71728967|gb|EAO31099.1| SMF protein [Xylella fastidiosa Ann-1]
 gi|167965795|gb|ACA12805.1| DNA processing chain A [Xylella fastidiosa M12]
          Length = 381

 Score = 56.4 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 16/86 (18%), Positives = 32/86 (37%), Gaps = 2/86 (2%)

Query: 1   MVHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIE 60
           +  P         + D        +   P     +   + Q+L + P+ +D +I  TG+ 
Sbjct: 296 LAAPLAHT--LRERLDAPSWPVAPLLSTPNSKDPKYHTLWQALAHDPMSMDSLIGRTGLT 353

Query: 61  APVVYLVLLELDLAGRLCHHPEGKVS 86
           A  +  +LL L+L G++         
Sbjct: 354 AATLSSMLLTLELEGKVVVEHGRYTR 379


>gi|170756418|ref|YP_001781981.1| DNA protecting protein DprA [Clostridium botulinum B1 str. Okra]
 gi|169121630|gb|ACA45466.1| DNA protecting protein DprA [Clostridium botulinum B1 str. Okra]
          Length = 361

 Score = 56.4 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 13/53 (24%), Positives = 23/53 (43%)

Query: 33  QCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
              + ++   L++ P HIDD++    I+   +Y VL EL L   +        
Sbjct: 306 DSLQAKVYNVLSHEPKHIDDLLKLMDIDIKHLYEVLFELQLKKEVICLAGNYY 358


>gi|153940771|ref|YP_001391736.1| DNA protecting protein DprA [Clostridium botulinum F str.
           Langeland]
 gi|152936667|gb|ABS42165.1| DNA protecting protein DprA [Clostridium botulinum F str.
           Langeland]
 gi|295319762|gb|ADG00140.1| DNA protecting protein DprA [Clostridium botulinum F str. 230613]
          Length = 361

 Score = 56.4 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 13/53 (24%), Positives = 23/53 (43%)

Query: 33  QCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
              + ++   L++ P HIDD++    I+   +Y VL EL L   +        
Sbjct: 306 DSLQAKVYNVLSHEPKHIDDLLKLMDIDIKHLYEVLFELQLKKEVICLAGNYY 358


>gi|148269810|ref|YP_001244270.1| DNA protecting protein DprA [Thermotoga petrophila RKU-1]
 gi|147735354|gb|ABQ46694.1| DNA protecting protein DprA [Thermotoga petrophila RKU-1]
          Length = 337

 Score = 56.4 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 12/60 (20%), Positives = 24/60 (40%), Gaps = 1/60 (1%)

Query: 28  YPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
                  ++ +I   L + P  +D+++   G     V  V+ E++L G +     G   L
Sbjct: 277 ASPSLDDDKKKIYDLLRSSPKTVDELVEELGWSVSEVLRVISEMELMGMIW-FDGGAYRL 335


>gi|309791245|ref|ZP_07685776.1| DNA protecting protein DprA [Oscillochloris trichoides DG6]
 gi|308226671|gb|EFO80368.1| DNA protecting protein DprA [Oscillochloris trichoides DG6]
          Length = 361

 Score = 56.4 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 12/69 (17%), Positives = 21/69 (30%)

Query: 11  FSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLE 70
                +               +     ++   L+  P  ID+I    G+ A  V   L  
Sbjct: 284 ILESLNLTTAAVQQEARSELPSDPTEAKLLDLLSYEPQAIDEIGRAMGMRAGEVAATLAV 343

Query: 71  LDLAGRLCH 79
           L+L G +  
Sbjct: 344 LELKGLVRQ 352


>gi|328676429|gb|AEB27299.1| Rossmann fold nucleotide-binding protein Smf possibly involved in
           DNA uptake [Francisella cf. novicida Fx1]
          Length = 368

 Score = 56.4 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 13/55 (23%), Positives = 21/55 (38%)

Query: 31  YTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
                   I  S++     ID II  + +    V  +L EL+L   +   P G +
Sbjct: 311 SLNESERIILGSIDKELTTIDKIIIKSKLPYNQVTSILFELELKSLIESIPGGYI 365


>gi|284037272|ref|YP_003387202.1| DNA protecting protein DprA [Spirosoma linguale DSM 74]
 gi|283816565|gb|ADB38403.1| DNA protecting protein DprA [Spirosoma linguale DSM 74]
          Length = 370

 Score = 56.4 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 15/75 (20%), Positives = 31/75 (41%), Gaps = 1/75 (1%)

Query: 14  QSDTNHTKNINITHYPEYTQCERVRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLLELD 72
           QS  + ++   +   P     E  +I   L     +H+D++   + I    +  +LL L+
Sbjct: 293 QSSGSASRTKTLPALPVSITEEESQILALLRQVTDLHVDELSWKSQIPMGRLASLLLTLE 352

Query: 73  LAGRLCHHPEGKVSL 87
             G +   P  K ++
Sbjct: 353 FQGFIRSLPGKKYAV 367


>gi|281424761|ref|ZP_06255674.1| DNA protecting protein DprA [Prevotella oris F0302]
 gi|281401131|gb|EFB31962.1| DNA protecting protein DprA [Prevotella oris F0302]
          Length = 375

 Score = 56.4 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 14/74 (18%), Positives = 27/74 (36%), Gaps = 2/74 (2%)

Query: 15  SDTNHTKNINITHYPEYTQCERVRIKQSLNNV-PIHIDDIIHHTGIEAPVVYLVLLELDL 73
            +    + I    +PE    E  +I   L     + I+ +   T +    +  +L  L++
Sbjct: 301 LNRARNEGIERQLFPE-LSSEEQQIVTVLQRENDLQINLLTLKTNLPIARLTALLFTLEM 359

Query: 74  AGRLCHHPEGKVSL 87
            G +   P G   L
Sbjct: 360 KGVVKALPGGSYHL 373


>gi|282880522|ref|ZP_06289229.1| DNA protecting protein DprA [Prevotella timonensis CRIS 5C-B1]
 gi|281305625|gb|EFA97678.1| DNA protecting protein DprA [Prevotella timonensis CRIS 5C-B1]
          Length = 377

 Score = 56.4 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 12/61 (19%), Positives = 23/61 (37%), Gaps = 1/61 (1%)

Query: 30  EYTQCERVRIKQSLN-NVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
                E  ++  +L  +  + I+ +     I    +  +L  L++ G L   P G   L 
Sbjct: 316 PDLSAEERQVVSALKKHNDLQINMLSVQADIPIAHLTAILFSLEMKGVLKALPGGMYHLL 375

Query: 89  M 89
           M
Sbjct: 376 M 376


>gi|188995531|ref|YP_001929783.1| putative DNA processing Smf-like protein [Porphyromonas gingivalis
           ATCC 33277]
 gi|188595211|dbj|BAG34186.1| putative DNA processing Smf-like protein [Porphyromonas gingivalis
           ATCC 33277]
          Length = 374

 Score = 56.4 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 14/83 (16%), Positives = 28/83 (33%), Gaps = 1/83 (1%)

Query: 6   IEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSL-NNVPIHIDDIIHHTGIEAPVV 64
             Q+  +    ++       T            + + L       +D++   TG+    V
Sbjct: 291 SAQDVLTLLDWSSTIDAKPQTLNFRPDSWPDTPVAECLLRAGTASVDELTRATGLPINDV 350

Query: 65  YLVLLELDLAGRLCHHPEGKVSL 87
              L +L+L G +   P G  S+
Sbjct: 351 SSQLFDLELDGLVQSQPGGIYSV 373


>gi|157827244|ref|YP_001496308.1| putative DNA processing protein DprA [Rickettsia bellii OSU 85-389]
 gi|157802548|gb|ABV79271.1| Putative DNA processing protein DprA [Rickettsia bellii OSU 85-389]
          Length = 223

 Score = 56.4 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 24/67 (35%), Positives = 38/67 (56%), Gaps = 2/67 (2%)

Query: 21  KNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHH 80
           K +N     E ++ ER    + L+ VPI  D +   T +  P++Y ++LEL+LAG+   H
Sbjct: 153 KRLNTIQVKEPSEKERA--IELLSAVPIDFDYLQKMTELPLPIIYTIILELELAGKAMRH 210

Query: 81  PEGKVSL 87
           P  K+SL
Sbjct: 211 PSNKISL 217


>gi|281412306|ref|YP_003346385.1| DNA protecting protein DprA [Thermotoga naphthophila RKU-10]
 gi|281373409|gb|ADA66971.1| DNA protecting protein DprA [Thermotoga naphthophila RKU-10]
          Length = 337

 Score = 56.4 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 12/60 (20%), Positives = 24/60 (40%), Gaps = 1/60 (1%)

Query: 28  YPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
                  ++ +I   L + P  +D+++   G     V  V+ E++L G +     G   L
Sbjct: 277 ASPSLDDDKKKIYDLLRSSPKTVDELVEELGWSVSEVLRVISEMELMGMIW-FDGGAYRL 335


>gi|325281443|ref|YP_004253985.1| DNA protecting protein DprA [Odoribacter splanchnicus DSM 20712]
 gi|324313252|gb|ADY33805.1| DNA protecting protein DprA [Odoribacter splanchnicus DSM 20712]
          Length = 383

 Score = 56.4 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 18/66 (27%), Positives = 33/66 (50%), Gaps = 2/66 (3%)

Query: 24  NITHYPEYTQCER-VRIKQSLN-NVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHP 81
             T  P ++  E+   + Q L+ N  +HID++   T   +  +  +LL+L+L G++    
Sbjct: 317 QQTILPNFSDDEQGNTLIQLLSENGALHIDELCQLTQRPSSELAAILLQLELEGKIIGLA 376

Query: 82  EGKVSL 87
             K SL
Sbjct: 377 GKKYSL 382


>gi|168700980|ref|ZP_02733257.1| DNA protecting protein DprA [Gemmata obscuriglobus UQM 2246]
          Length = 396

 Score = 56.4 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 12/77 (15%), Positives = 27/77 (35%), Gaps = 2/77 (2%)

Query: 12  SSQSDTNHTKNINITHYPEY-TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLE 70
              + T      ++   P       + R+  +L +   H D++    G+    +  +L++
Sbjct: 320 QEDAVTGRAVREDVPRPPAPILDVTQQRVFDALADK-RHADELARELGVAVGELSRILMQ 378

Query: 71  LDLAGRLCHHPEGKVSL 87
           L+L   L   P      
Sbjct: 379 LELKKVLRRLPGNFYER 395


>gi|295690151|ref|YP_003593844.1| DNA protecting protein DprA [Caulobacter segnis ATCC 21756]
 gi|295432054|gb|ADG11226.1| DNA protecting protein DprA [Caulobacter segnis ATCC 21756]
          Length = 365

 Score = 56.0 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 18/86 (20%), Positives = 31/86 (36%), Gaps = 5/86 (5%)

Query: 7   EQNFFSSQSDTNHTKNINITHYPEYT-----QCERVRIKQSLNNVPIHIDDIIHHTGIEA 61
            ++   S +     +  +  +  E          R R+   L+  P+  +D+I       
Sbjct: 279 AEDVLRSLAGEARLRERDRAYEAEPPSDLDPDALRERVAALLSPTPVPRNDLIRAVAAPT 338

Query: 62  PVVYLVLLELDLAGRLCHHPEGKVSL 87
             V   L+EL LAGR      G V+ 
Sbjct: 339 SAVMAALVELSLAGRAEFLDGGLVAR 364


>gi|208780407|ref|ZP_03247748.1| DNA protecting protein DprA, putative [Francisella novicida FTG]
 gi|208743775|gb|EDZ90078.1| DNA protecting protein DprA, putative [Francisella novicida FTG]
          Length = 368

 Score = 56.0 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 13/55 (23%), Positives = 21/55 (38%)

Query: 31  YTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
                   I  S++     ID II  + +    V  +L EL+L   +   P G +
Sbjct: 311 SLNESERIILGSIDRELTTIDKIIIKSKLPYNQVTSILFELELKSLIESIPGGYI 365


>gi|290954217|ref|ZP_06558838.1| DNA processing protein DprA [Francisella tularensis subsp.
           holarctica URFT1]
 gi|295312381|ref|ZP_06803163.1| DNA processing protein DprA [Francisella tularensis subsp.
           holarctica URFT1]
          Length = 268

 Score = 56.0 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 13/55 (23%), Positives = 21/55 (38%)

Query: 31  YTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
                   I  S++     ID II  + +    V  +L EL+L   +   P G +
Sbjct: 211 SLNESERIILGSIDRELTTIDKIIIKSKLPYNQVTSILFELELKSLIESIPGGYI 265


>gi|254373799|ref|ZP_04989282.1| DNA processing protein DprA [Francisella novicida GA99-3548]
 gi|151571520|gb|EDN37174.1| DNA processing protein DprA [Francisella novicida GA99-3548]
          Length = 368

 Score = 56.0 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 13/55 (23%), Positives = 21/55 (38%)

Query: 31  YTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
                   I  S++     ID II  + +    V  +L EL+L   +   P G +
Sbjct: 311 SLNESERIILGSIDRELTTIDKIIIKSKLPYNQVTSILFELELKSLIESIPGGYI 365


>gi|254372325|ref|ZP_04987816.1| DNA uptake protein [Francisella tularensis subsp. novicida
           GA99-3549]
 gi|151570054|gb|EDN35708.1| DNA uptake protein [Francisella novicida GA99-3549]
          Length = 368

 Score = 56.0 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 13/55 (23%), Positives = 21/55 (38%)

Query: 31  YTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
                   I  S++     ID II  + +    V  +L EL+L   +   P G +
Sbjct: 311 SLNESERIILGSIDRELTTIDKIIIKSKLPYNQVTSILFELELKSLIESIPGGYI 365


>gi|118496955|ref|YP_898005.1| SMF family DNA uptake protein [Francisella tularensis subsp.
           novicida U112]
 gi|194324184|ref|ZP_03057958.1| DNA protecting protein DprA, putative [Francisella tularensis
           subsp. novicida FTE]
 gi|118422861|gb|ABK89251.1| DNA uptake protein, SMF family [Francisella novicida U112]
 gi|194321631|gb|EDX19115.1| DNA protecting protein DprA, putative [Francisella tularensis
           subsp. novicida FTE]
          Length = 368

 Score = 56.0 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 13/55 (23%), Positives = 21/55 (38%)

Query: 31  YTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
                   I  S++     ID II  + +    V  +L EL+L   +   P G +
Sbjct: 311 SLNESERIILGSIDRELTTIDKIIIKSKLPYNQVTSILFELELKSLIESIPGGYI 365


>gi|134302268|ref|YP_001122237.1| DNA processing protein DprA [Francisella tularensis subsp.
           tularensis WY96-3418]
 gi|134050045|gb|ABO47116.1| DNA processing protein DprA [Francisella tularensis subsp.
           tularensis WY96-3418]
          Length = 368

 Score = 56.0 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 13/55 (23%), Positives = 21/55 (38%)

Query: 31  YTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
                   I  S++     ID II  + +    V  +L EL+L   +   P G +
Sbjct: 311 SLNKSERIILGSIDRELTTIDKIIIKSKLPYNQVTSILFELELKSLIESIPGGYI 365


>gi|323697641|ref|ZP_08109553.1| DNA protecting protein DprA [Desulfovibrio sp. ND132]
 gi|323457573|gb|EGB13438.1| DNA protecting protein DprA [Desulfovibrio desulfuricans ND132]
          Length = 418

 Score = 56.0 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 15/63 (23%), Positives = 25/63 (39%), Gaps = 1/63 (1%)

Query: 32  TQCERVRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMH 90
              +  R+   L     +HID +    G ++P V  VLL L++ G +   P         
Sbjct: 349 LNGDEKRVLDLLDGADKMHIDALGRELGWDSPTVSRVLLLLEMRGAVRQLPGMWYLARED 408

Query: 91  LPS 93
            P+
Sbjct: 409 EPA 411


>gi|294675097|ref|YP_003575713.1| DNA protecting protein DprA [Prevotella ruminicola 23]
 gi|294472375|gb|ADE81764.1| DNA protecting protein DprA [Prevotella ruminicola 23]
          Length = 374

 Score = 56.0 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 14/72 (19%), Positives = 25/72 (34%), Gaps = 2/72 (2%)

Query: 17  TNHTKNINITHYPEYTQCERVRIKQSLNNV-PIHIDDIIHHTGIEAPVVYLVLLELDLAG 75
                 I    +PE    E  +I   L     + I+ +  H  +    V  +L +L++ G
Sbjct: 302 QALAGGIERQLFPE-LSAEEQKIVSLLQQTNDLQINVLSVHANLSISQVTALLFQLEMKG 360

Query: 76  RLCHHPEGKVSL 87
            +     G   L
Sbjct: 361 VVKAMAGGTYHL 372


>gi|15643022|ref|NP_228064.1| DNA processing chain A [Thermotoga maritima MSB8]
 gi|170288496|ref|YP_001738734.1| DNA protecting protein DprA [Thermotoga sp. RQ2]
 gi|4980749|gb|AAD35341.1|AE001708_9 DNA processing chain A [Thermotoga maritima MSB8]
 gi|170175999|gb|ACB09051.1| DNA protecting protein DprA [Thermotoga sp. RQ2]
          Length = 337

 Score = 56.0 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 12/60 (20%), Positives = 24/60 (40%), Gaps = 1/60 (1%)

Query: 28  YPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
                  ++ +I   L + P  +D+++   G     V  V+ E++L G +     G   L
Sbjct: 277 ASPSLDDDKKKIYDLLRSSPKTVDELVEELGWSVSEVLRVISEMELMGMIW-FDGGAYRL 335


>gi|315178585|gb|ADT85499.1| Smf protein [Vibrio furnissii NCTC 11218]
          Length = 371

 Score = 56.0 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 11/49 (22%), Positives = 22/49 (44%)

Query: 38  RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
            +  ++      +D + + T I    V + LLEL+L+G +     G + 
Sbjct: 319 ELLANVGEEATPVDILANRTHIPVQDVMMQLLELELSGHVVAVSGGYIR 367


>gi|300087797|ref|YP_003758319.1| DNA protecting protein DprA [Dehalogenimonas lykanthroporepellens
           BL-DC-9]
 gi|299527530|gb|ADJ25998.1| DNA protecting protein DprA [Dehalogenimonas lykanthroporepellens
           BL-DC-9]
          Length = 362

 Score = 56.0 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 14/56 (25%), Positives = 21/56 (37%), Gaps = 1/56 (1%)

Query: 32  TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPE-GKVS 86
                 RI   LN    H+D+I   TG     V  +L  ++L G +        +S
Sbjct: 306 ETEAERRIMGILNGQSKHVDEICRTTGETVATVSSLLAIMELKGLVKQLGGMNYIS 361


>gi|260771090|ref|ZP_05880018.1| rossmann fold nucleotide-binding protein Smf possibly involved in
           DNA uptake [Vibrio furnissii CIP 102972]
 gi|260613979|gb|EEX39170.1| rossmann fold nucleotide-binding protein Smf possibly involved in
           DNA uptake [Vibrio furnissii CIP 102972]
          Length = 371

 Score = 56.0 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 11/49 (22%), Positives = 22/49 (44%)

Query: 38  RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
            +  ++      +D + + T I    V + LLEL+L+G +     G + 
Sbjct: 319 ELLANVGEEATPVDILANRTHIPVQDVMMQLLELELSGHVVAVSGGYIR 367


>gi|314987079|gb|EFT31171.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL005PA2]
 gi|314990721|gb|EFT34812.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL005PA3]
          Length = 253

 Score = 55.6 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 15/60 (25%), Positives = 26/60 (43%), Gaps = 1/60 (1%)

Query: 36 RVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMH-LPSP 94
          +  I  SL   P  +D ++  TG     +   L +L+  G+L     G V++ +   P P
Sbjct: 7  QKMIINSLGTSPTSVDTLVELTGASPATIRRDLTDLEGHGQLRKVHGGAVAVNLRGTPMP 66


>gi|149174899|ref|ZP_01853523.1| DNA processing chain A [Planctomyces maris DSM 8797]
 gi|148846236|gb|EDL60575.1| DNA processing chain A [Planctomyces maris DSM 8797]
          Length = 376

 Score = 55.6 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 12/81 (14%), Positives = 26/81 (32%), Gaps = 2/81 (2%)

Query: 11  FSSQSDTNHTKNINITHYPEYTQCER--VRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVL 68
                    T      H P           I   +   P H+++I+  + +++  +   L
Sbjct: 295 LGPAKTPVMTAKNREVHTPRELSLSEFERDILNLVTLEPQHLNEIVQSSNLDSSRILSTL 354

Query: 69  LELDLAGRLCHHPEGKVSLTM 89
             L++   +   P G +   M
Sbjct: 355 TILEMRKVVKRLPGGYLVRAM 375


>gi|81299514|ref|YP_399722.1| DNA processing protein DprA, putative [Synechococcus elongatus PCC
           7942]
 gi|81168395|gb|ABB56735.1| DNA processing protein DprA, putative [Synechococcus elongatus PCC
           7942]
          Length = 402

 Score = 55.6 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 14/80 (17%), Positives = 31/80 (38%)

Query: 2   VHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEA 61
           +      +  S     +   +  +         E+ ++   L++ PI  DDI+  +G++ 
Sbjct: 316 LRQLPPLDPQSPPLMPSAVPSQEVEEAIADLSPEQAQVYALLSDQPISKDDIVEQSGLDF 375

Query: 62  PVVYLVLLELDLAGRLCHHP 81
             V + L  L++ G     P
Sbjct: 376 HQVQIHLTHLEILGLAEVLP 395


>gi|56750836|ref|YP_171537.1| DNA processing protein [Synechococcus elongatus PCC 6301]
 gi|56685795|dbj|BAD79017.1| DNA processing protein [Synechococcus elongatus PCC 6301]
          Length = 406

 Score = 55.6 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 14/80 (17%), Positives = 31/80 (38%)

Query: 2   VHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEA 61
           +      +  S     +   +  +         E+ ++   L++ PI  DDI+  +G++ 
Sbjct: 320 LRQLPPLDPQSPPLMPSAVPSQEVEEAIADLSPEQAQVYALLSDQPISKDDIVEQSGLDF 379

Query: 62  PVVYLVLLELDLAGRLCHHP 81
             V + L  L++ G     P
Sbjct: 380 HQVQIHLTHLEILGLAEVLP 399


>gi|313764990|gb|EFS36354.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL013PA1]
 gi|313815450|gb|EFS53164.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL059PA1]
 gi|314916245|gb|EFS80076.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL005PA4]
 gi|314917515|gb|EFS81346.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL050PA1]
 gi|314921849|gb|EFS85680.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL050PA3]
 gi|314930888|gb|EFS94719.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL067PA1]
 gi|314955318|gb|EFS99723.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL027PA1]
 gi|314959190|gb|EFT03292.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL002PA1]
 gi|315099311|gb|EFT71287.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL059PA2]
 gi|315102351|gb|EFT74327.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL046PA1]
 gi|327454283|gb|EGF00938.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL087PA3]
 gi|327456348|gb|EGF03003.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL083PA2]
 gi|328756041|gb|EGF69657.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL087PA1]
 gi|328758887|gb|EGF72503.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL025PA2]
          Length = 252

 Score = 55.6 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 15/60 (25%), Positives = 26/60 (43%), Gaps = 1/60 (1%)

Query: 36 RVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMH-LPSP 94
          +  I  SL   P  +D ++  TG     +   L +L+  G+L     G V++ +   P P
Sbjct: 7  QKMIINSLGTSPTSVDTLVELTGASPATIRRDLTDLEGHGQLRKVHGGAVAVNLRGTPMP 66


>gi|298291505|ref|YP_003693444.1| DNA protecting protein DprA [Starkeya novella DSM 506]
 gi|296928016|gb|ADH88825.1| DNA protecting protein DprA [Starkeya novella DSM 506]
          Length = 369

 Score = 55.6 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 24/68 (35%), Positives = 38/68 (55%)

Query: 20  TKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCH 79
            +  +    PE ++  R  +   L  VP+ +DD++  +G     + ++LLEL+LAGRL  
Sbjct: 301 EEEADAMDAPEPSEDARTHVLALLGPVPLPVDDLVVLSGASVGEIQILLLELELAGRLER 360

Query: 80  HPEGKVSL 87
           HP G VSL
Sbjct: 361 HPGGAVSL 368


>gi|296108241|ref|YP_003619942.1| DNA processing enzyme DprA (SMF family) [Legionella pneumophila
           2300/99 Alcoy]
 gi|295650143|gb|ADG25990.1| DNA processing enzyme DprA (SMF family) [Legionella pneumophila
           2300/99 Alcoy]
          Length = 361

 Score = 55.6 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 13/48 (27%), Positives = 20/48 (41%)

Query: 39  IKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
           + + +      ID II  +G     V   L EL+L G +   P G + 
Sbjct: 309 LVKFIGFETTTIDQIIGRSGYSMEQVTSGLAELELKGAVMAVPGGYIR 356


>gi|153954039|ref|YP_001394804.1| Smf protein [Clostridium kluyveri DSM 555]
 gi|219854652|ref|YP_002471774.1| hypothetical protein CKR_1309 [Clostridium kluyveri NBRC 12016]
 gi|146346920|gb|EDK33456.1| Predicted Smf protein [Clostridium kluyveri DSM 555]
 gi|219568376|dbj|BAH06360.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 366

 Score = 55.6 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 12/50 (24%), Positives = 23/50 (46%)

Query: 36  RVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
             +I + +  +P +ID+I   T I+   +Y +L EL L  ++        
Sbjct: 306 EEKILKIIGQIPRNIDEICRITNIDIKQLYELLFELQLKNKIICLSGNYY 355


>gi|289424388|ref|ZP_06426171.1| transcriptional regulator, DeoR family [Propionibacterium acnes
          SK187]
 gi|289155085|gb|EFD03767.1| transcriptional regulator, DeoR family [Propionibacterium acnes
          SK187]
 gi|313771172|gb|EFS37138.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL074PA1]
 gi|313792536|gb|EFS40622.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL110PA1]
 gi|313803537|gb|EFS44719.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL110PA2]
 gi|313811802|gb|EFS49516.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL083PA1]
 gi|313829015|gb|EFS66729.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL063PA2]
 gi|313832338|gb|EFS70052.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL007PA1]
 gi|313832797|gb|EFS70511.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL056PA1]
 gi|313839656|gb|EFS77370.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL086PA1]
 gi|314964247|gb|EFT08347.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL082PA1]
 gi|314975230|gb|EFT19325.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL053PA1]
 gi|314977645|gb|EFT21740.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL045PA1]
 gi|314985170|gb|EFT29262.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL005PA1]
 gi|315081613|gb|EFT53589.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL078PA1]
 gi|315097130|gb|EFT69106.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL038PA1]
 gi|315109833|gb|EFT81809.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL030PA2]
 gi|327332534|gb|EGE74269.1| transcriptional regulator [Propionibacterium acnes HL096PA2]
 gi|327334592|gb|EGE76303.1| transcriptional regulator [Propionibacterium acnes HL097PA1]
 gi|327446688|gb|EGE93342.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL043PA2]
 gi|327448870|gb|EGE95524.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL043PA1]
 gi|327457380|gb|EGF04035.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL092PA1]
 gi|328759732|gb|EGF73328.1| transcriptional regulator [Propionibacterium acnes HL099PA1]
          Length = 252

 Score = 55.6 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 15/60 (25%), Positives = 26/60 (43%), Gaps = 1/60 (1%)

Query: 36 RVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMH-LPSP 94
          +  I  SL   P  +D ++  TG     +   L +L+  G+L     G V++ +   P P
Sbjct: 7  QKMIINSLGTSPTSVDTLVELTGASPATIRRDLTDLEGHGQLRKVHGGAVAVNLRGTPMP 66


>gi|315606821|ref|ZP_07881830.1| DNA processing protein DprA [Prevotella buccae ATCC 33574]
 gi|315251486|gb|EFU31466.1| DNA processing protein DprA [Prevotella buccae ATCC 33574]
          Length = 375

 Score = 55.6 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 15/73 (20%), Positives = 28/73 (38%), Gaps = 2/73 (2%)

Query: 18  NHTKNINITHYPEYTQCERVRIKQSLN-NVPIHIDDIIHHTGIEAPVVYLVLLELDLAGR 76
            H K I    +P     E   +   L  N  + I+ +   +G+    +  +L +L++ G 
Sbjct: 304 AHRKGIERQLFP-SLSPEEQAVVDVLQRNNDLQINMLSVQSGLTISRLTALLFQLEMKGV 362

Query: 77  LCHHPEGKVSLTM 89
           +     G   L M
Sbjct: 363 IKPLAGGMYHLLM 375


>gi|153931310|ref|YP_001384613.1| DNA protecting protein DprA [Clostridium botulinum A str. ATCC
           19397]
 gi|153936174|ref|YP_001388130.1| DNA protecting protein DprA [Clostridium botulinum A str. Hall]
 gi|168180681|ref|ZP_02615345.1| DNA protecting protein DprA [Clostridium botulinum NCTC 2916]
 gi|226949791|ref|YP_002804882.1| DNA protecting protein DprA [Clostridium botulinum A2 str. Kyoto]
 gi|152927354|gb|ABS32854.1| DNA protecting protein DprA [Clostridium botulinum A str. ATCC
           19397]
 gi|152932088|gb|ABS37587.1| DNA protecting protein DprA [Clostridium botulinum A str. Hall]
 gi|182668507|gb|EDT80486.1| DNA protecting protein DprA [Clostridium botulinum NCTC 2916]
 gi|226843761|gb|ACO86427.1| DNA protecting protein DprA [Clostridium botulinum A2 str. Kyoto]
 gi|322806704|emb|CBZ04273.1| crossmann fold nucleotide-binding protein Smf possibly involved in
           DNA uptake [Clostridium botulinum H04402 065]
          Length = 361

 Score = 55.6 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 13/53 (24%), Positives = 23/53 (43%)

Query: 33  QCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
              + ++   L++ P HIDD++    I+   +Y VL EL L   +        
Sbjct: 306 DSLQAKVYNVLSDEPKHIDDLLKLMDIDIKHLYEVLFELQLKKEIICLAGNYY 358


>gi|148380396|ref|YP_001254937.1| DNA protecting protein DprA [Clostridium botulinum A str. ATCC
           3502]
 gi|148289880|emb|CAL83988.1| SMF family protein [Clostridium botulinum A str. ATCC 3502]
          Length = 361

 Score = 55.6 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 13/53 (24%), Positives = 23/53 (43%)

Query: 33  QCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
              + ++   L++ P HIDD++    I+   +Y VL EL L   +        
Sbjct: 306 DSLQAKVYNVLSDEPKHIDDLLKLMDIDIKHLYEVLFELQLKKEIICLAGNYY 358


>gi|295129562|ref|YP_003580225.1| transcriptional regulator, DeoR family [Propionibacterium acnes
          SK137]
 gi|291375552|gb|ADD99406.1| transcriptional regulator, DeoR family [Propionibacterium acnes
          SK137]
          Length = 252

 Score = 55.6 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 15/60 (25%), Positives = 26/60 (43%), Gaps = 1/60 (1%)

Query: 36 RVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMH-LPSP 94
          +  I  SL   P  +D ++  TG     +   L +L+  G+L     G V++ +   P P
Sbjct: 7  QKMIINSLGTSPTSVDTLVELTGASPATIRRDLTDLEGHGQLRKVHGGAVAVNLRGTPMP 66


>gi|148358669|ref|YP_001249876.1| DNA processing enzyme DprA [Legionella pneumophila str. Corby]
 gi|148280442|gb|ABQ54530.1| DNA processing enzyme DprA (SMF family) [Legionella pneumophila
           str. Corby]
          Length = 361

 Score = 55.6 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 13/48 (27%), Positives = 20/48 (41%)

Query: 39  IKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
           + + +      ID II  +G     V   L EL+L G +   P G + 
Sbjct: 309 LVKFIGFETTTIDQIIGRSGYSMEQVTSGLAELELKGAVMAVPGGYIR 356


>gi|315083115|gb|EFT55091.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL027PA2]
 gi|328757941|gb|EGF71557.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL020PA1]
          Length = 253

 Score = 55.6 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 15/60 (25%), Positives = 26/60 (43%), Gaps = 1/60 (1%)

Query: 36 RVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMH-LPSP 94
          +  I  SL   P  +D ++  TG     +   L +L+  G+L     G V++ +   P P
Sbjct: 7  QKMIINSLGTSPTSVDTLVELTGASPATIRRDLTDLEGHGQLRKVHGGAVAVNLRGTPMP 66


>gi|289427481|ref|ZP_06429194.1| transcriptional regulator, DeoR family [Propionibacterium acnes
          J165]
 gi|289159411|gb|EFD07602.1| transcriptional regulator, DeoR family [Propionibacterium acnes
          J165]
 gi|313806890|gb|EFS45388.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL087PA2]
 gi|313814189|gb|EFS51903.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL025PA1]
 gi|314980223|gb|EFT24317.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL072PA2]
 gi|315088047|gb|EFT60023.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL072PA1]
 gi|327333707|gb|EGE75424.1| transcriptional regulator [Propionibacterium acnes HL096PA3]
 gi|327444434|gb|EGE91088.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL013PA2]
          Length = 252

 Score = 55.6 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 15/60 (25%), Positives = 26/60 (43%), Gaps = 1/60 (1%)

Query: 36 RVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMH-LPSP 94
          +  I  SL   P  +D ++  TG     +   L +L+  G+L     G V++ +   P P
Sbjct: 7  QKMIINSLGTSPTSVDTLVELTGASPATIRRDLTDLEGHGQLRKVHGGAVAVNLRGTPMP 66


>gi|291514827|emb|CBK64037.1| DNA protecting protein DprA [Alistipes shahii WAL 8301]
          Length = 366

 Score = 55.2 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 12/70 (17%), Positives = 26/70 (37%), Gaps = 2/70 (2%)

Query: 17  TNHTKNINITHYPEYTQCERVRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLLELDLAG 75
            N          PE    +   +      + P+ ++ +   TG+    +  +L+ L+LAG
Sbjct: 295 ENPATLRAKPPTPE-LTPDEAGLLGCFRTDDPLSVEALGELTGLNPGELATLLVGLELAG 353

Query: 76  RLCHHPEGKV 85
            +   P  + 
Sbjct: 354 AVRQLPGNRY 363


>gi|331269644|ref|YP_004396136.1| DNA uptake protein [Clostridium botulinum BKT015925]
 gi|329126194|gb|AEB76139.1| DNA uptake protein [Clostridium botulinum BKT015925]
          Length = 359

 Score = 55.2 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 15/57 (26%), Positives = 26/57 (45%)

Query: 32  TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
              E  ++ + +N+VPIH D+++  T I+   +Y VL EL L   +           
Sbjct: 299 MSIEETKVYKHINSVPIHFDEVLRLTNIDIKQLYEVLFELQLKDEIMCLSGNYYVRN 355


>gi|170758557|ref|YP_001787750.1| DNA protecting protein DprA [Clostridium botulinum A3 str. Loch
           Maree]
 gi|169405546|gb|ACA53957.1| DNA protecting protein DprA [Clostridium botulinum A3 str. Loch
           Maree]
          Length = 361

 Score = 55.2 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 13/53 (24%), Positives = 23/53 (43%)

Query: 33  QCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
              + ++   L++ P HIDD++    I+   +Y VL EL L   +        
Sbjct: 306 DSLQGKVYNVLSHEPKHIDDLLKLMDIDIKHLYEVLFELQLKKEVICLAGNYY 358


>gi|288925389|ref|ZP_06419323.1| DNA processing protein DprA [Prevotella buccae D17]
 gi|288337860|gb|EFC76212.1| DNA processing protein DprA [Prevotella buccae D17]
          Length = 375

 Score = 55.2 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 15/73 (20%), Positives = 28/73 (38%), Gaps = 2/73 (2%)

Query: 18  NHTKNINITHYPEYTQCERVRIKQSLN-NVPIHIDDIIHHTGIEAPVVYLVLLELDLAGR 76
            H K I    +P     E   +   L  N  + I+ +   +G+    +  +L +L++ G 
Sbjct: 304 AHRKGIERQLFP-SLSPEEQAVVDVLQRNNDLQINMLSVQSGLTISRLTALLFQLEMKGV 362

Query: 77  LCHHPEGKVSLTM 89
           +     G   L M
Sbjct: 363 IKPLAGGMYHLLM 375


>gi|256823829|ref|YP_003147792.1| DNA protecting protein DprA [Kangiella koreensis DSM 16069]
 gi|256797368|gb|ACV28024.1| DNA protecting protein DprA [Kangiella koreensis DSM 16069]
          Length = 363

 Score = 55.2 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 16/53 (30%), Positives = 25/53 (47%)

Query: 32  TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGK 84
            + E   I Q +++     D II  +G+E  VV  +LL L+L   +   P G 
Sbjct: 307 LEKEYQEILQYVDDSTTSADTIIQRSGLEIEVVSHMLLLLELNNYIASVPGGY 359


>gi|50841523|ref|YP_054750.1| transcriptional regulator [Propionibacterium acnes KPA171202]
 gi|50839125|gb|AAT81792.1| transcriptional regulator [Propionibacterium acnes KPA171202]
 gi|313817674|gb|EFS55388.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL046PA2]
 gi|313821499|gb|EFS59213.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL036PA1]
 gi|313824556|gb|EFS62270.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL036PA2]
 gi|314926301|gb|EFS90132.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL036PA3]
 gi|314961694|gb|EFT05795.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL002PA2]
 gi|315086644|gb|EFT58620.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL002PA3]
 gi|315107465|gb|EFT79441.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL030PA1]
          Length = 252

 Score = 55.2 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 15/60 (25%), Positives = 26/60 (43%), Gaps = 1/60 (1%)

Query: 36 RVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMH-LPSP 94
          +  I  SL   P  +D ++  TG     +   L +L+  G+L     G V++ +   P P
Sbjct: 7  QKMIINSLGTSPTSVDTLVELTGASPATIRRDLTDLEGHGQLRKVHGGAVAVNLRGTPMP 66


>gi|162453392|ref|YP_001615759.1| DNA processing chain A [Sorangium cellulosum 'So ce 56']
 gi|161163974|emb|CAN95279.1| DNA processing chain A [Sorangium cellulosum 'So ce 56']
          Length = 350

 Score = 55.2 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 13/82 (15%), Positives = 23/82 (28%)

Query: 9   NFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVL 68
               +               P         +  +L+  P H+D++   TG+        L
Sbjct: 269 PLPEAALGARTGVLPEENGPPPSMSAAERAVLDALDARPAHVDEVCERTGLPPRRAVEAL 328

Query: 69  LELDLAGRLCHHPEGKVSLTMH 90
           L L L   +   P G     + 
Sbjct: 329 LTLTLQAVVVEGPAGLFRRALR 350


>gi|260172928|ref|ZP_05759340.1| Smf protein DNA processing chain A [Bacteroides sp. D2]
 gi|315921211|ref|ZP_07917451.1| conserved hypothetical protein [Bacteroides sp. D2]
 gi|313695086|gb|EFS31921.1| conserved hypothetical protein [Bacteroides sp. D2]
          Length = 374

 Score = 55.2 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 12/88 (13%), Positives = 27/88 (30%), Gaps = 5/88 (5%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYPEYT----QCERVRIKQSLNNVP-IHIDDIIHHTGI 59
              ++   +      T +    +           E  +I   L     + I+ ++    I
Sbjct: 285 LSAEDLVQAMGWNIPTTSSEKVNVQRSLFLDLSEEEQKIVSILEKQGNLQINSLVVEADI 344

Query: 60  EAPVVYLVLLELDLAGRLCHHPEGKVSL 87
               +  +L EL++ G +     G   L
Sbjct: 345 PVHKINAILFELEMKGVVRVLAGGMYQL 372


>gi|84501687|ref|ZP_00999859.1| DNA processing protein DprA, putative [Oceanicola batsensis
          HTCC2597]
 gi|84390308|gb|EAQ02867.1| DNA processing protein DprA, putative [Oceanicola batsensis
          HTCC2597]
          Length = 77

 Score = 55.2 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 15/69 (21%), Positives = 23/69 (33%)

Query: 19 HTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLC 78
                    P  T      I   L   PI  D +I      A  V   + +L++ GR+ 
Sbjct: 5  PETPAPEARDPAQTAALHREILDRLGPAPIAEDQLIRDLSRAARHVTPAITQLEMQGRVR 64

Query: 79 HHPEGKVSL 87
              G ++L
Sbjct: 65 RQAGGLLAL 73


>gi|254422740|ref|ZP_05036458.1| DNA protecting protein DprA, putative [Synechococcus sp. PCC 7335]
 gi|196190229|gb|EDX85193.1| DNA protecting protein DprA, putative [Synechococcus sp. PCC 7335]
          Length = 411

 Score = 55.2 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 12/76 (15%), Positives = 29/76 (38%)

Query: 13  SQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELD 72
             S+     + ++             + +++   P  +D I+  T +E  +V   L +L+
Sbjct: 336 ETSEALEINSTDLKKAISELTPVLANVLEAVAIEPTIVDYIVQQTQMETGIVLSALFQLE 395

Query: 73  LAGRLCHHPEGKVSLT 88
           L+G +   P  +    
Sbjct: 396 LSGMVIQLPGMQYQRA 411


>gi|187778969|ref|ZP_02995442.1| hypothetical protein CLOSPO_02564 [Clostridium sporogenes ATCC
           15579]
 gi|187772594|gb|EDU36396.1| hypothetical protein CLOSPO_02564 [Clostridium sporogenes ATCC
           15579]
          Length = 361

 Score = 55.2 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 13/53 (24%), Positives = 23/53 (43%)

Query: 33  QCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
              + ++   L++ P HIDD++    I+   +Y VL EL L   +        
Sbjct: 306 DSLQGKVYNVLSHEPKHIDDLLKLMDIDIKHLYEVLFELQLKKEIICLAGNYY 358


>gi|168184644|ref|ZP_02619308.1| DNA protecting protein DprA [Clostridium botulinum Bf]
 gi|237795874|ref|YP_002863426.1| DNA protecting protein DprA [Clostridium botulinum Ba4 str. 657]
 gi|182672290|gb|EDT84251.1| DNA protecting protein DprA [Clostridium botulinum Bf]
 gi|229263394|gb|ACQ54427.1| DNA protecting protein DprA [Clostridium botulinum Ba4 str. 657]
          Length = 361

 Score = 55.2 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 13/53 (24%), Positives = 23/53 (43%)

Query: 33  QCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
              + ++   L++ P HIDD++    I+   +Y VL EL L   +        
Sbjct: 306 DSLQGKVYNVLSHEPKHIDDLLKLMDIDIKHLYEVLFELQLKKEIICLAGNYY 358


>gi|330831508|ref|YP_004394460.1| DNA processing chain A [Aeromonas veronii B565]
 gi|328806644|gb|AEB51843.1| DNA processing chain A [Aeromonas veronii B565]
          Length = 371

 Score = 55.2 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 12/68 (17%), Positives = 27/68 (39%)

Query: 19  HTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLC 78
              ++  +  P  ++     +  +++     +D +     +   VV   L+EL+LAG + 
Sbjct: 297 PHSSVIPSEQPHNSELPYADLLDNVDYETTSVDTVAERAQLPVEVVLGRLVELELAGAVM 356

Query: 79  HHPEGKVS 86
               G V 
Sbjct: 357 AVAGGYVR 364


>gi|255524245|ref|ZP_05391204.1| DNA protecting protein DprA [Clostridium carboxidivorans P7]
 gi|296185366|ref|ZP_06853776.1| DNA protecting protein DprA [Clostridium carboxidivorans P7]
 gi|255512070|gb|EET88351.1| DNA protecting protein DprA [Clostridium carboxidivorans P7]
 gi|296050200|gb|EFG89624.1| DNA protecting protein DprA [Clostridium carboxidivorans P7]
          Length = 359

 Score = 55.2 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 15/56 (26%), Positives = 23/56 (41%)

Query: 32  TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
                 +I  S+ + P HIDDI   T ++   +Y VL EL L   +        + 
Sbjct: 299 MTSIEKKIYDSITDTPAHIDDIFERTNVDIKQLYEVLFELQLRDEVICISGNYYAR 354


>gi|328905809|gb|EGG25585.1| transcriptional regulator, DeoR family [Propionibacterium sp.
          P08]
          Length = 252

 Score = 54.8 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 16/60 (26%), Positives = 27/60 (45%), Gaps = 1/60 (1%)

Query: 36 RVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMH-LPSP 94
          +  I  SL   P  +D ++  TG     +   L EL+  G+L     G V++ +  +P P
Sbjct: 7  QKMIINSLGASPTSVDALVELTGASPATIRRDLTELEGHGQLRKVHGGAVTVNLRGMPMP 66


>gi|320103360|ref|YP_004178951.1| DNA protecting protein DprA [Isosphaera pallida ATCC 43644]
 gi|319750642|gb|ADV62402.1| DNA protecting protein DprA [Isosphaera pallida ATCC 43644]
          Length = 453

 Score = 54.8 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 19/90 (21%), Positives = 32/90 (35%), Gaps = 5/90 (5%)

Query: 3   HPQIEQNFFSSQSDTNHTK----NINITHYPEYTQCERVRI-KQSLNNVPIHIDDIIHHT 57
           HP + +N       +N              P     ER RI  +++    +HID II  +
Sbjct: 362 HPTLNKNETQPDPSSNSHSHNRGASTEPVPPGLILSERERIVWETIGTATLHIDAIIAQS 421

Query: 58  GIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           G++       L  L+L   +   P    + 
Sbjct: 422 GLDPGSAMATLATLELRRLIGRQPGQMFAR 451


>gi|307822753|ref|ZP_07652984.1| DNA protecting protein DprA [Methylobacter tundripaludum SV96]
 gi|307736357|gb|EFO07203.1| DNA protecting protein DprA [Methylobacter tundripaludum SV96]
          Length = 350

 Score = 54.8 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 15/81 (18%), Positives = 28/81 (34%), Gaps = 1/81 (1%)

Query: 8   QNFFSSQSDTNHTKNINITHYPEY-TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYL 66
           Q+     S  N    I      +     E+  +   +   P  ID ++ +      V+  
Sbjct: 268 QDILEELSQYNQQDEIFSPLTMQSTLDLEQQTLLNLVMFSPTSIDTLVENANESVEVISS 327

Query: 67  VLLELDLAGRLCHHPEGKVSL 87
           +LL L+L G +     G  + 
Sbjct: 328 MLLILELQGYIEASAGGCYTR 348


>gi|317504339|ref|ZP_07962325.1| DNA protecting protein DprA [Prevotella salivae DSM 15606]
 gi|315664530|gb|EFV04211.1| DNA protecting protein DprA [Prevotella salivae DSM 15606]
          Length = 375

 Score = 54.8 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 12/74 (16%), Positives = 25/74 (33%), Gaps = 2/74 (2%)

Query: 15  SDTNHTKNINITHYPEYTQCERVRIKQSLNNV-PIHIDDIIHHTGIEAPVVYLVLLELDL 73
            +    + I    +PE    E   +  +L       I+ +   T +    +  +L  L++
Sbjct: 301 LNRARNEGIERQLFPE-LSNEEQLVVTALQQENDQQINLLAVKTNLPIARLTALLFTLEM 359

Query: 74  AGRLCHHPEGKVSL 87
            G +     G   L
Sbjct: 360 KGVVKALAGGSYHL 373


>gi|239626521|ref|ZP_04669552.1| smf family protein [Clostridiales bacterium 1_7_47_FAA]
 gi|239516667|gb|EEQ56533.1| smf family protein [Clostridiales bacterium 1_7_47FAA]
          Length = 328

 Score = 54.8 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 14/57 (24%), Positives = 20/57 (35%)

Query: 36  RVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHLP 92
              +   L++ P H++ I   TGI        L EL+L G             M  P
Sbjct: 272 EKMVYSCLDSEPRHLEQIAMQTGIPVSQCMSTLCELELGGFALRTNGQCYIRRMTQP 328


>gi|218258323|ref|ZP_03474725.1| hypothetical protein PRABACTJOHN_00380 [Parabacteroides johnsonii
           DSM 18315]
 gi|218225563|gb|EEC98213.1| hypothetical protein PRABACTJOHN_00380 [Parabacteroides johnsonii
           DSM 18315]
          Length = 371

 Score = 54.8 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 11/76 (14%), Positives = 30/76 (39%), Gaps = 1/76 (1%)

Query: 14  QSDTNHTKNINITHYPEYTQCERVRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLLELD 72
           Q+     +   +    + +  E+  +   +     IHI+++     +    +  +L EL+
Sbjct: 296 QATATPAQTELLFADTDVSVPEQNPVLAIMRTRNEIHINELALVLEMPVHQLSTLLFELE 355

Query: 73  LAGRLCHHPEGKVSLT 88
           + G++   P     L+
Sbjct: 356 INGKIKALPGNIYKLS 371


>gi|282853073|ref|ZP_06262410.1| transcriptional regulator, DeoR family [Propionibacterium acnes
          J139]
 gi|282582526|gb|EFB87906.1| transcriptional regulator, DeoR family [Propionibacterium acnes
          J139]
 gi|314922714|gb|EFS86545.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL001PA1]
 gi|314982942|gb|EFT27034.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL110PA3]
 gi|315091247|gb|EFT63223.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL110PA4]
 gi|315105202|gb|EFT77178.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL050PA2]
          Length = 252

 Score = 54.8 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 15/60 (25%), Positives = 26/60 (43%), Gaps = 1/60 (1%)

Query: 36 RVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMH-LPSP 94
          +  I  SL   P  +D ++  TG     +   L +L+  G+L     G V++ +   P P
Sbjct: 7  QKMIINSLGTSPTSVDTLVELTGASPATIRRDLTDLEGHGQLRKVHGGAVAVNLRGTPMP 66


>gi|73666848|ref|YP_302864.1| SMF protein [Ehrlichia canis str. Jake]
 gi|72393989|gb|AAZ68266.1| SMF protein [Ehrlichia canis str. Jake]
          Length = 374

 Score = 54.8 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 15/52 (28%), Positives = 29/52 (55%)

Query: 36  RVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           +  I Q +++ PI I++II  T +    + + L EL+ + ++   P  KV+L
Sbjct: 321 KDIILQHISHSPIEIEEIITSTNLNISNILIALTELEESKKIERFPNNKVAL 372


>gi|239993912|ref|ZP_04714436.1| DNA protecting protein DprA [Alteromonas macleodii ATCC 27126]
          Length = 369

 Score = 54.5 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 14/51 (27%), Positives = 20/51 (39%)

Query: 37  VRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
            ++  S++     ID I     I        LLE +L G +   P G V L
Sbjct: 316 DKLLASVDCDITAIDVIAQRNAISVSQAMASLLEYELRGLVAAVPGGYVKL 366


>gi|237806931|ref|YP_002891371.1| DNA protecting protein DprA [Tolumonas auensis DSM 9187]
 gi|237499192|gb|ACQ91785.1| DNA protecting protein DprA [Tolumonas auensis DSM 9187]
          Length = 374

 Score = 54.5 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 16/83 (19%), Positives = 31/83 (37%), Gaps = 2/83 (2%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSL-NNVPIHIDDIIHHTGIEAPV 63
            IE+     +   ++ +   I   P        R+  ++ ++    ID I   + +    
Sbjct: 289 IIEEIGIFPRMVEHYGETGPIAEEPLSDLPFY-RLLDNVRSDEVTSIDVIAATSRLPVQE 347

Query: 64  VYLVLLELDLAGRLCHHPEGKVS 86
           V   L+ L+L G +   P G V 
Sbjct: 348 VMTELITLELEGLILSVPGGYVR 370


>gi|325299438|ref|YP_004259355.1| DNA protecting protein DprA [Bacteroides salanitronis DSM 18170]
 gi|324318991|gb|ADY36882.1| DNA protecting protein DprA [Bacteroides salanitronis DSM 18170]
          Length = 370

 Score = 54.5 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 14/60 (23%), Positives = 24/60 (40%), Gaps = 2/60 (3%)

Query: 30  EYTQCERVRIKQSLNNVP--IHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
                E  RI Q +   P  I ++ ++  + I    +  +L EL+L G +     G   L
Sbjct: 310 PELNPEEARIVQIMRKYPEGIQVNSLVVESNIAITGMTGILFELELKGVVKSLAGGMYRL 369


>gi|78356624|ref|YP_388073.1| DNA processing protein DprA [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|78219029|gb|ABB38378.1| DNA processing protein DprA, putative [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
          Length = 425

 Score = 54.5 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 12/63 (19%), Positives = 21/63 (33%), Gaps = 1/63 (1%)

Query: 25  ITHYPEYTQCERVRIKQSLNN-VPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEG 83
                     +  ++   L     +HID +      +A  V   LL L++AG +   P  
Sbjct: 361 TEPATSPADADGQKVLAVLARRGGLHIDVLCRELDWDAGRVSAALLLLEIAGSVRQAPGM 420

Query: 84  KVS 86
              
Sbjct: 421 LYC 423


>gi|299142014|ref|ZP_07035148.1| DNA processing protein DprA [Prevotella oris C735]
 gi|298576476|gb|EFI48348.1| DNA processing protein DprA [Prevotella oris C735]
          Length = 375

 Score = 54.5 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 14/74 (18%), Positives = 27/74 (36%), Gaps = 2/74 (2%)

Query: 15  SDTNHTKNINITHYPEYTQCERVRIKQSLNNV-PIHIDDIIHHTGIEAPVVYLVLLELDL 73
            +    + I    +PE    E  +I   L     + I+ +   T +    +  +L  L++
Sbjct: 301 LNRARNEGIERQLFPE-LGSEEQQIVTVLQRENDLQINLLTLKTNLPIARLTALLFTLEM 359

Query: 74  AGRLCHHPEGKVSL 87
            G +   P G   L
Sbjct: 360 KGVVKALPGGSYHL 373


>gi|225418683|ref|ZP_03761872.1| hypothetical protein CLOSTASPAR_05907 [Clostridium asparagiforme
           DSM 15981]
 gi|225041786|gb|EEG52032.1| hypothetical protein CLOSTASPAR_05907 [Clostridium asparagiforme
           DSM 15981]
          Length = 371

 Score = 54.5 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 10/54 (18%), Positives = 23/54 (42%)

Query: 36  RVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTM 89
              +   L++ P H+++I   +G+        LL+L+L G +        +  +
Sbjct: 315 EKMVYSCLDSAPKHVEEIAVLSGMCVGECMSALLDLELGGLVVKTAGQYYARRV 368


>gi|118443914|ref|YP_878225.1| DNA uptake protein [Clostridium novyi NT]
 gi|118134370|gb|ABK61414.1| DNA uptake protein [Clostridium novyi NT]
          Length = 359

 Score = 54.5 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 13/57 (22%), Positives = 22/57 (38%)

Query: 32  TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
                 ++   +N  PIH D+++  T I+   +Y VL EL L   +           
Sbjct: 299 MTSIEDKVYNKINTTPIHFDEVLRLTNIDIKQLYEVLFELQLKDEIMCLSGNYYVRN 355


>gi|323705454|ref|ZP_08117029.1| DNA protecting protein DprA [Thermoanaerobacterium xylanolyticum
           LX-11]
 gi|323535356|gb|EGB25132.1| DNA protecting protein DprA [Thermoanaerobacterium xylanolyticum
           LX-11]
          Length = 362

 Score = 54.5 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 11/54 (20%), Positives = 21/54 (38%)

Query: 32  TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
              E  ++   ++  P  I++I+  T      V  +L  L + G +   P  K 
Sbjct: 304 LSSEERKLYAIISECPRDIEEIVEITKFPISKVNYLLSSLTIKGLIVRLPGNKY 357


>gi|262273078|ref|ZP_06050895.1| rossmann fold nucleotide-binding protein Smf possibly involved in
           DNA uptake [Grimontia hollisae CIP 101886]
 gi|262222834|gb|EEY74142.1| rossmann fold nucleotide-binding protein Smf possibly involved in
           DNA uptake [Grimontia hollisae CIP 101886]
          Length = 365

 Score = 54.5 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 11/49 (22%), Positives = 20/49 (40%)

Query: 38  RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
            +  ++ N    +D +          + + LLEL+L G +   P G V 
Sbjct: 313 ELLANVGNEVRCVDVLAELCDQPVHEIMMQLLELELQGFVSAVPGGYVR 361


>gi|315079027|gb|EFT51039.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL053PA2]
          Length = 244

 Score = 54.5 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 15/57 (26%), Positives = 25/57 (43%), Gaps = 1/57 (1%)

Query: 39 IKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMH-LPSP 94
          I  SL   P  +D ++  TG     +   L +L+  G+L     G V++ +   P P
Sbjct: 2  IINSLGTSPTSVDTLVELTGASPATIRRDLTDLEGHGQLRKVHGGAVAVNLRGTPMP 58


>gi|242280185|ref|YP_002992314.1| DNA protecting protein DprA [Desulfovibrio salexigens DSM 2638]
 gi|242123079|gb|ACS80775.1| DNA protecting protein DprA [Desulfovibrio salexigens DSM 2638]
          Length = 402

 Score = 54.5 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 18/87 (20%), Positives = 33/87 (37%), Gaps = 3/87 (3%)

Query: 4   PQIEQNFFSSQSDTNHTKNIN--ITHYPEYTQCERVRIKQSL-NNVPIHIDDIIHHTGIE 60
           P    +  SS    +  KN         +  +     I ++L +   +HID+I    G +
Sbjct: 314 PVKRDDKSSSPKAEDPAKNEPAVPAFDIDSLEPPEYDIAKALKSGGKLHIDEIARAAGFD 373

Query: 61  APVVYLVLLELDLAGRLCHHPEGKVSL 87
             V   V+L +++ G +   P     L
Sbjct: 374 VSVAGAVILGMEVNGMVVRFPGMYYDL 400


>gi|51892618|ref|YP_075309.1| hypothetical protein STH1480 [Symbiobacterium thermophilum IAM
           14863]
 gi|51856307|dbj|BAD40465.1| conserved hypothetical protein [Symbiobacterium thermophilum IAM
           14863]
          Length = 386

 Score = 54.5 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 11/67 (16%), Positives = 24/67 (35%)

Query: 19  HTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLC 78
            +    +   P        R+   + + P    D+   +G+  P V   L  L++   + 
Sbjct: 316 PSAEGPLHFTPRGLTELEQRVLGWMGSAPWWPGDLAESSGLPLPEVQACLTMLEIRSAVR 375

Query: 79  HHPEGKV 85
             P+G+ 
Sbjct: 376 RLPDGQY 382


>gi|52842803|ref|YP_096602.1| DNA processing enzyme DprA [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|52629914|gb|AAU28655.1| DNA processing enzyme DprA (SMF family) [Legionella pneumophila
           subsp. pneumophila str. Philadelphia 1]
          Length = 361

 Score = 54.5 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 13/48 (27%), Positives = 20/48 (41%)

Query: 39  IKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
           + + +      ID II  +G     V   L EL+L G +   P G + 
Sbjct: 309 LVKFIGFETTTIDQIIDRSGYGMEQVTSGLAELELKGAVMAVPGGYIR 356


>gi|317486705|ref|ZP_07945522.1| DNA protecting protein DprA [Bilophila wadsworthia 3_1_6]
 gi|316922088|gb|EFV43357.1| DNA protecting protein DprA [Bilophila wadsworthia 3_1_6]
          Length = 429

 Score = 54.5 bits (130), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 17/89 (19%), Positives = 29/89 (32%), Gaps = 3/89 (3%)

Query: 3   HPQIEQNFFSSQSDTNHTKNINITHYP---EYTQCERVRIKQSLNNVPIHIDDIIHHTGI 59
            P      +S        ++      P           RI   L   P  IDD+    G 
Sbjct: 341 QPDSAPRPYSLDVPQEPFQSAPAAPPPLRQPDRSTLEGRILTLLAQSPRAIDDVCQSLGC 400

Query: 60  EAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
           +       L+ L++ G +   P+ + +LT
Sbjct: 401 DPGEAGSTLIILEVRGLIRQRPDLRYALT 429


>gi|314965799|gb|EFT09898.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL082PA2]
 gi|315094483|gb|EFT66459.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL060PA1]
 gi|327328977|gb|EGE70737.1| transcriptional regulator [Propionibacterium acnes HL103PA1]
          Length = 280

 Score = 54.5 bits (130), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 15/60 (25%), Positives = 26/60 (43%), Gaps = 1/60 (1%)

Query: 36 RVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMH-LPSP 94
          +  I  SL   P  +D ++  TG     +   L +L+  G+L     G V++ +   P P
Sbjct: 7  QKMIINSLGTSPTSVDTLVELTGASPATIRRDLTDLEGHGQLRKVHGGAVAVNLRGTPMP 66


>gi|145300984|ref|YP_001143825.1| DNA processing chain A [Aeromonas salmonicida subsp. salmonicida
           A449]
 gi|142853756|gb|ABO92077.1| DNA processing chain A [Aeromonas salmonicida subsp. salmonicida
           A449]
          Length = 371

 Score = 54.1 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 11/51 (21%), Positives = 22/51 (43%)

Query: 36  RVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
              +  +++     +D +   + +   VV   L+EL+LAG +     G V 
Sbjct: 314 YADLLDNVDYETTSVDTVAERSQLPVEVVLGRLVELELAGAVIAVAGGYVR 364


>gi|194335563|ref|YP_002017357.1| DNA protecting protein DprA [Pelodictyon phaeoclathratiforme BU-1]
 gi|194308040|gb|ACF42740.1| DNA protecting protein DprA [Pelodictyon phaeoclathratiforme BU-1]
          Length = 383

 Score = 54.1 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 13/51 (25%), Positives = 21/51 (41%)

Query: 32  TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPE 82
                  I Q +   PIHID +   +GI+   + + L EL+L   +     
Sbjct: 325 LTPIEQAIMQCMEREPIHIDTLAVASGIDVSSLLVHLFELELKAAVVQQAG 375


>gi|310778327|ref|YP_003966660.1| DNA protecting protein DprA [Ilyobacter polytropus DSM 2926]
 gi|309747650|gb|ADO82312.1| DNA protecting protein DprA [Ilyobacter polytropus DSM 2926]
          Length = 357

 Score = 54.1 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 17/54 (31%), Positives = 28/54 (51%), Gaps = 1/54 (1%)

Query: 36  RVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTM 89
              +   L    +++D++I  TGI A  +  VL+EL+L G +C  P GK    +
Sbjct: 304 EKIVFNILKKE-MNLDELIMSTGIRAGELLAVLMELELKGLICGAPGGKYRRKV 356


>gi|302874646|ref|YP_003843279.1| DNA protecting protein DprA [Clostridium cellulovorans 743B]
 gi|307690742|ref|ZP_07633188.1| DNA protecting protein DprA [Clostridium cellulovorans 743B]
 gi|302577503|gb|ADL51515.1| DNA protecting protein DprA [Clostridium cellulovorans 743B]
          Length = 344

 Score = 54.1 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 14/56 (25%), Positives = 25/56 (44%)

Query: 31  YTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
                  RI ++L++ PIH+DD+I    I+   +Y VL E+     +        +
Sbjct: 283 SLSEVESRIFENLSDSPIHVDDLISMVNIDINQIYKVLFEMQAKNLIYTLSGNYYA 338


>gi|220907030|ref|YP_002482341.1| DNA protecting protein DprA [Cyanothece sp. PCC 7425]
 gi|219863641|gb|ACL43980.1| DNA protecting protein DprA [Cyanothece sp. PCC 7425]
          Length = 370

 Score = 54.1 bits (129), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 12/73 (16%), Positives = 27/73 (36%), Gaps = 1/73 (1%)

Query: 13  SQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELD 72
            Q D    +  ++            ++ Q L+   +  D I+   G++       L++L+
Sbjct: 296 PQLDQPPPRP-DLAPDLATVLASLTQLTQDLSQSSVPFDLIVQTCGLDPGTASSALMQLE 354

Query: 73  LAGRLCHHPEGKV 85
           L G +   P  + 
Sbjct: 355 LLGLINQLPGMRY 367


>gi|307611476|emb|CBX01147.1| hypothetical protein LPW_28461 [Legionella pneumophila 130b]
          Length = 361

 Score = 54.1 bits (129), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 13/48 (27%), Positives = 20/48 (41%)

Query: 39  IKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
           + + +      ID II  +G     V   L EL+L G +   P G + 
Sbjct: 309 LVKFIGFETTTIDQIIDRSGYGMEQVTSGLAELELKGAVMAVPGGYIR 356


>gi|28210944|ref|NP_781888.1| SMF protein, putative DNA processing chain A [Clostridium tetani
           E88]
 gi|28203383|gb|AAO35825.1| SMF protein, putative DNA processing chain A [Clostridium tetani
           E88]
          Length = 361

 Score = 54.1 bits (129), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 14/52 (26%), Positives = 21/52 (40%)

Query: 36  RVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
              I   + + PIHIDDI+  T ++   +Y VL EL     +          
Sbjct: 305 ENEIYTVIEDTPIHIDDIVRVTKVDIKRLYEVLFELQFKNHITCLSGNYYVR 356


>gi|312130376|ref|YP_003997716.1| DNA protecting protein dpra [Leadbetterella byssophila DSM 17132]
 gi|311906922|gb|ADQ17363.1| DNA protecting protein DprA [Leadbetterella byssophila DSM 17132]
          Length = 359

 Score = 54.1 bits (129), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 17/76 (22%), Positives = 28/76 (36%), Gaps = 1/76 (1%)

Query: 14  QSDTNHTKNINITHYPEYTQCERVRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLLELD 72
           Q          +   P++       + + + N   I ID++   T I    +   LLEL+
Sbjct: 284 QLSEIMLWTQEVAPRPKWENESERSLIEIIANYREIGIDELSWRTEIPLNQLASHLLELE 343

Query: 73  LAGRLCHHPEGKVSLT 88
             G +   P  K SL 
Sbjct: 344 FKGVVKQLPGKKFSLA 359


>gi|299138372|ref|ZP_07031551.1| DNA protecting protein DprA [Acidobacterium sp. MP5ACTX8]
 gi|298599618|gb|EFI55777.1| DNA protecting protein DprA [Acidobacterium sp. MP5ACTX8]
          Length = 403

 Score = 54.1 bits (129), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 13/68 (19%), Positives = 26/68 (38%), Gaps = 3/68 (4%)

Query: 24  NITHYPEYTQCERVRIKQSL-NNVPIHIDDIIHHT--GIEAPVVYLVLLELDLAGRLCHH 80
                      +   + Q L  +  + +D++I      + +  V+  L EL+LAGR+   
Sbjct: 335 PEAAAMPPMSEQERLVMQHLRQDEALQLDELIERLEPKMVSGEVFTALFELELAGRVKQM 394

Query: 81  PEGKVSLT 88
           P      +
Sbjct: 395 PGKNYVRS 402


>gi|314929122|gb|EFS92953.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL044PA1]
          Length = 244

 Score = 54.1 bits (129), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 16/57 (28%), Positives = 26/57 (45%), Gaps = 1/57 (1%)

Query: 39 IKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMH-LPSP 94
          I  SL   P  +D ++  TG     +   L EL+  G+L     G V++ +  +P P
Sbjct: 2  IINSLGASPTSVDALVELTGASPATIRRDLTELEGHGQLRKVHGGAVTVNLRGMPMP 58


>gi|314970931|gb|EFT15029.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL037PA3]
          Length = 135

 Score = 54.1 bits (129), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 16/60 (26%), Positives = 27/60 (45%), Gaps = 1/60 (1%)

Query: 36 RVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMH-LPSP 94
          +  I  SL   P  +D ++  TG     +   L EL+  G+L     G V++ +  +P P
Sbjct: 7  QKMIINSLGASPTSVDALVELTGASPATIRRDLTELEGHGQLRKVHGGAVTVNLRGMPMP 66


>gi|126733565|ref|ZP_01749312.1| DNA processing protein DprA, putative [Roseobacter sp. CCS2]
 gi|126716431|gb|EBA13295.1| DNA processing protein DprA, putative [Roseobacter sp. CCS2]
          Length = 379

 Score = 54.1 bits (129), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 13/81 (16%), Positives = 29/81 (35%), Gaps = 7/81 (8%)

Query: 7   EQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYL 66
           E +  +           ++             I   L + PI  D ++    + A  +  
Sbjct: 304 ELDLSTPTPTAATRSLRDVA-------ALHSEILSRLGSAPIAEDQLLRDIKVAATEIAP 356

Query: 67  VLLELDLAGRLCHHPEGKVSL 87
           VL++L+L G++     G ++ 
Sbjct: 357 VLVDLELEGKITRQSGGLLAR 377


>gi|54298586|ref|YP_124955.1| hypothetical protein lpp2650 [Legionella pneumophila str. Paris]
 gi|53752371|emb|CAH13803.1| hypothetical protein lpp2650 [Legionella pneumophila str. Paris]
          Length = 361

 Score = 54.1 bits (129), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 13/48 (27%), Positives = 20/48 (41%)

Query: 39  IKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
           + + +      ID II  +G     V   L EL+L G +   P G + 
Sbjct: 309 LVKFIGFETTTIDQIIDRSGYGMEQVTSGLAELELKGAVMAVPGGYIR 356


>gi|54295434|ref|YP_127849.1| hypothetical protein lpl2520 [Legionella pneumophila str. Lens]
 gi|53755266|emb|CAH16760.1| hypothetical protein lpl2520 [Legionella pneumophila str. Lens]
          Length = 361

 Score = 53.7 bits (128), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 13/48 (27%), Positives = 20/48 (41%)

Query: 39  IKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
           + + +      ID II  +G     V   L EL+L G +   P G + 
Sbjct: 309 LVKFIGFETTTIDQIIDRSGYGMEQVTSGLAELELKGAVMAVPGGYIR 356


>gi|15895060|ref|NP_348409.1| DNA uptake protein [Clostridium acetobutylicum ATCC 824]
 gi|15024755|gb|AAK79749.1|AE007687_6 DNA uptake protein [Clostridium acetobutylicum ATCC 824]
 gi|325509198|gb|ADZ20834.1| DNA uptake protein [Clostridium acetobutylicum EA 2018]
          Length = 354

 Score = 53.7 bits (128), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 12/52 (23%), Positives = 24/52 (46%)

Query: 36  RVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           + +I   +++ PIH+DDI     I+   +Y +L E+ L  ++          
Sbjct: 298 QRQIYDLVSDKPIHVDDIKRCLNIDIQELYELLFEMQLKNKILCLSGSYYVR 349


>gi|117621477|ref|YP_854788.1| DNA protecting protein DprA [Aeromonas hydrophila subsp. hydrophila
           ATCC 7966]
 gi|117562884|gb|ABK39832.1| DNA protecting protein DprA [Aeromonas hydrophila subsp. hydrophila
           ATCC 7966]
          Length = 371

 Score = 53.7 bits (128), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 11/51 (21%), Positives = 22/51 (43%)

Query: 36  RVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
              +  +++     +D +   + +   VV   L+EL+LAG +     G V 
Sbjct: 314 YADLLDNVDYETTSVDTVAERSQLPVEVVLGRLVELELAGAVMAVAGGYVR 364


>gi|326791406|ref|YP_004309227.1| DNA protecting protein DprA [Clostridium lentocellum DSM 5427]
 gi|326542170|gb|ADZ84029.1| DNA protecting protein DprA [Clostridium lentocellum DSM 5427]
          Length = 362

 Score = 53.7 bits (128), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 10/53 (18%), Positives = 26/53 (49%)

Query: 35  ERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           E   +   ++  PI ++++++ T +    +Y  LL+L++ G +   P  +   
Sbjct: 309 EERIVYAYVSQEPIFLNELVNSTQLSYKSIYKGLLQLEIKGLIKRLPGERYVR 361


>gi|114570266|ref|YP_756946.1| DNA protecting protein DprA [Maricaulis maris MCS10]
 gi|114340728|gb|ABI66008.1| DNA protecting protein DprA [Maricaulis maris MCS10]
          Length = 387

 Score = 53.7 bits (128), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 12/72 (16%), Positives = 29/72 (40%)

Query: 16  DTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAG 75
           D     + +             R++  L+  P+  D++     +    V  +L+E++++G
Sbjct: 312 DEEAGLSTDEGLSNTSALSPLERLRALLSPAPVSGDELARAADLPIGEVQAMLMEMEMSG 371

Query: 76  RLCHHPEGKVSL 87
            +   P+G V  
Sbjct: 372 EIATLPDGLVQR 383


>gi|332704254|ref|ZP_08424342.1| DNA protecting protein DprA [Desulfovibrio africanus str. Walvis
           Bay]
 gi|332554403|gb|EGJ51447.1| DNA protecting protein DprA [Desulfovibrio africanus str. Walvis
           Bay]
          Length = 427

 Score = 53.7 bits (128), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 14/59 (23%), Positives = 23/59 (38%), Gaps = 1/59 (1%)

Query: 30  EYTQCERVRIKQSLNNVP-IHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           +    E   +   L      HID +   TG+ +  +  +LL L+L G +   P    S 
Sbjct: 366 DDLAPEENAVLLVLAADVRTHIDVLGRTTGLASGTLSGILLALELKGLVRQWPGMYYSR 424


>gi|160884732|ref|ZP_02065735.1| hypothetical protein BACOVA_02721 [Bacteroides ovatus ATCC 8483]
 gi|156109767|gb|EDO11512.1| hypothetical protein BACOVA_02721 [Bacteroides ovatus ATCC 8483]
          Length = 374

 Score = 53.7 bits (128), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 11/58 (18%), Positives = 21/58 (36%), Gaps = 1/58 (1%)

Query: 31  YTQCERVRIKQSLNN-VPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
               E  +I   L     + I+ ++    I    +  +L EL++ G +     G   L
Sbjct: 315 ELSEEEQKIVAILGKLGNLQINSLVVEADIPVNKMTALLFELEMKGVIRVLAGGMYQL 372


>gi|189460247|ref|ZP_03009032.1| hypothetical protein BACCOP_00884 [Bacteroides coprocola DSM 17136]
 gi|189433108|gb|EDV02093.1| hypothetical protein BACCOP_00884 [Bacteroides coprocola DSM 17136]
          Length = 371

 Score = 53.7 bits (128), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 11/60 (18%), Positives = 21/60 (35%), Gaps = 2/60 (3%)

Query: 30  EYTQCERVRIKQSLN--NVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
                   +I   L      I I+ ++  + I    +  +L EL++ G +     G   L
Sbjct: 311 PELDENEEKIVSLLQKHPDGIQINTLVVESNIAINRMTGILFELEMKGIIRTLAGGVYKL 370


>gi|255261380|ref|ZP_05340722.1| DNA protecting protein DprA [Thalassiobium sp. R2A62]
 gi|255103715|gb|EET46389.1| DNA protecting protein DprA [Thalassiobium sp. R2A62]
          Length = 100

 Score = 53.7 bits (128), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 13/82 (15%), Positives = 30/82 (36%)

Query: 8  QNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLV 67
          +    + +        +       T      I   L   P+  + +I      A +V   
Sbjct: 18 ETIRPAPTPQLELPPQSEPRRLSETAALHSEILNRLGPSPLAENQLIRDLKSAAAIVTPA 77

Query: 68 LLELDLAGRLCHHPEGKVSLTM 89
          L++L+L G++     G ++L++
Sbjct: 78 LIDLELEGKITRQSGGLIALSV 99


>gi|110597593|ref|ZP_01385878.1| DNA processing protein DprA, putative [Chlorobium ferrooxidans DSM
           13031]
 gi|110340713|gb|EAT59190.1| DNA processing protein DprA, putative [Chlorobium ferrooxidans DSM
           13031]
          Length = 375

 Score = 53.7 bits (128), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 12/50 (24%), Positives = 23/50 (46%)

Query: 32  TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHP 81
                  I + +   P+HID +   TG++  ++ + L EL+L   +   P
Sbjct: 319 LNDHERTILERMTREPVHIDTLAAETGMDISLLLVHLFELELKSAIMQMP 368


>gi|103486697|ref|YP_616258.1| DNA processing protein DprA, putative [Sphingopyxis alaskensis
           RB2256]
 gi|98976774|gb|ABF52925.1| DNA processing protein DprA, putative [Sphingopyxis alaskensis
           RB2256]
          Length = 360

 Score = 53.7 bits (128), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 23/71 (32%), Positives = 36/71 (50%)

Query: 17  TNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGR 76
               +   +    E    ER  +   L   P+ +D+++  +G +A  V LVLLEL+LAGR
Sbjct: 289 REPVRAFFVPPVTEPANDERQALVDLLGPTPVTVDELVRQSGQDAAAVQLVLLELELAGR 348

Query: 77  LCHHPEGKVSL 87
           +  H   K+SL
Sbjct: 349 IERHAGAKISL 359


>gi|298529949|ref|ZP_07017351.1| DNA protecting protein DprA [Desulfonatronospira thiodismutans
           ASO3-1]
 gi|298509323|gb|EFI33227.1| DNA protecting protein DprA [Desulfonatronospira thiodismutans
           ASO3-1]
          Length = 381

 Score = 53.3 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 13/81 (16%), Positives = 29/81 (35%), Gaps = 2/81 (2%)

Query: 8   QNFFSSQSDTNHTKNINITHY-PEYTQCERVRIK-QSLNNVPIHIDDIIHHTGIEAPVVY 65
           +N    ++D   +  +      P     E   +  + +N    HIDD+     +    + 
Sbjct: 297 KNHLQQENDNEMSAPVPAEPALPGDLTSEEKAVAGELINRERTHIDDLSQCLDLSPSSIS 356

Query: 66  LVLLELDLAGRLCHHPEGKVS 86
            +L+ L++ G +   P     
Sbjct: 357 RILVNLEIRGMVRREPGMYYK 377


>gi|88657722|ref|YP_507678.1| putative DNA processing protein DprA [Ehrlichia chaffeensis str.
           Arkansas]
 gi|88599179|gb|ABD44648.1| putative DNA processing protein DprA [Ehrlichia chaffeensis str.
           Arkansas]
          Length = 375

 Score = 53.3 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 15/54 (27%), Positives = 28/54 (51%)

Query: 34  CERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
             +  I Q + + P  I++II  T +    + + L+EL+ A ++   P  KV+L
Sbjct: 319 NAKDTILQYITHSPTEIEEIIASTNLNISSILIALIELEAAQKIERFPNNKVAL 372


>gi|307543966|ref|YP_003896445.1| DNA processing protein [Halomonas elongata DSM 2581]
 gi|307215990|emb|CBV41260.1| K04096 DNA processing protein [Halomonas elongata DSM 2581]
          Length = 366

 Score = 53.3 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 15/62 (24%), Positives = 24/62 (38%)

Query: 30  EYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTM 89
                +   +   L++ P  +D ++  TG+  P     LL L+L GR      G V L  
Sbjct: 302 PEAAPDADPVLAWLSDTPTPVDALVDLTGLAVPDCQRRLLALELEGRASQAAGGWVRLPT 361

Query: 90  HL 91
             
Sbjct: 362 SP 363


>gi|32476472|ref|NP_869466.1| DNA processing chain A [Rhodopirellula baltica SH 1]
 gi|32447017|emb|CAD78923.1| DNA processing chain A [Rhodopirellula baltica SH 1]
          Length = 455

 Score = 53.3 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 8/52 (15%), Positives = 21/52 (40%)

Query: 36  RVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
             ++  ++      ID++   +G+ A  V  ++  L++   +       VS 
Sbjct: 403 ERQVLAAVGTSGTAIDEVTLSSGLPASRVNAIVSILEMKRFVRRLSGQYVSR 454


>gi|86141090|ref|ZP_01059649.1| Smf protein DNA processing chain A [Leeuwenhoekiella blandensis
           MED217]
 gi|85833032|gb|EAQ51481.1| Smf protein DNA processing chain A [Leeuwenhoekiella blandensis
           MED217]
          Length = 366

 Score = 53.3 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 14/59 (23%), Positives = 23/59 (38%), Gaps = 1/59 (1%)

Query: 31  YTQCERVRIKQSLNNVPI-HIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
               E   I   L++     +D I  H  +    V  +LL ++L G +   P  +  LT
Sbjct: 308 ELSSEEKLIWNYLSDAGKEQLDLIALHCKMPTFKVASILLNMELKGVVRPLPGKQFELT 366


>gi|253682393|ref|ZP_04863190.1| DNA protecting protein DprA [Clostridium botulinum D str. 1873]
 gi|253562105|gb|EES91557.1| DNA protecting protein DprA [Clostridium botulinum D str. 1873]
          Length = 359

 Score = 53.3 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 14/53 (26%), Positives = 25/53 (47%)

Query: 36  RVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
             ++ + +N+VPIH D+++  T I+   +Y VL EL L   +           
Sbjct: 303 ETKVYKHINSVPIHFDEVLRLTNIDIKQLYEVLFELQLKDEIMCLSGNYYVRN 355


>gi|329962716|ref|ZP_08300639.1| DNA protecting protein DprA [Bacteroides fluxus YIT 12057]
 gi|328529550|gb|EGF56453.1| DNA protecting protein DprA [Bacteroides fluxus YIT 12057]
          Length = 371

 Score = 53.3 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 10/75 (13%), Positives = 23/75 (30%), Gaps = 1/75 (1%)

Query: 14  QSDTNHTKNINITHYPEYTQCERVRIKQSLN-NVPIHIDDIIHHTGIEAPVVYLVLLELD 72
                        +       E   +   L+    +HI+ ++    +    +  +L EL+
Sbjct: 296 PVSKAEKPEAVQRNLFPDLSEEEEGVVHILSCRGDLHINTLVVEANLPVNRMSALLFELE 355

Query: 73  LAGRLCHHPEGKVSL 87
           + G +     G   L
Sbjct: 356 MKGVVKALVGGVYHL 370


>gi|224023530|ref|ZP_03641896.1| hypothetical protein BACCOPRO_00232 [Bacteroides coprophilus DSM
           18228]
 gi|224016752|gb|EEF74764.1| hypothetical protein BACCOPRO_00232 [Bacteroides coprophilus DSM
           18228]
          Length = 371

 Score = 53.3 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 13/60 (21%), Positives = 23/60 (38%), Gaps = 2/60 (3%)

Query: 30  EYTQCERVRIKQSL--NNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
                E   I   L  N   + ++ +I  + I    +  ++LEL+L G +     G   L
Sbjct: 311 PDLNEEESLICSLLEKNPDGMQLNSLIVASNIPVNRLAGIMLELELKGVVRAAAGGMYRL 370


>gi|327539302|gb|EGF25923.1| DNA recombination-mediator protein A [Rhodopirellula baltica WH47]
          Length = 424

 Score = 53.3 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 8/52 (15%), Positives = 21/52 (40%)

Query: 36  RVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
             ++  ++      ID++   +G+ A  V  ++  L++   +       VS 
Sbjct: 372 ERQVLAAVGTSGTAIDEVTLSSGLPASRVNAIVSILEMKRFVRRLSGQYVSR 423


>gi|269836418|ref|YP_003318646.1| DNA protecting protein DprA [Sphaerobacter thermophilus DSM 20745]
 gi|269785681|gb|ACZ37824.1| DNA protecting protein DprA [Sphaerobacter thermophilus DSM 20745]
          Length = 359

 Score = 53.3 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 14/48 (29%), Positives = 23/48 (47%)

Query: 31  YTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLC 78
            T  E   +   L+  P HID+I   +G+    +  +LLE+ L G + 
Sbjct: 302 PTTSEEADVLHYLDGEPRHIDEIALESGLAISRLSALLLEMQLKGLVR 349


>gi|319900680|ref|YP_004160408.1| DNA protecting protein DprA [Bacteroides helcogenes P 36-108]
 gi|319415711|gb|ADV42822.1| DNA protecting protein DprA [Bacteroides helcogenes P 36-108]
          Length = 374

 Score = 53.3 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 14/75 (18%), Positives = 34/75 (45%)

Query: 13  SQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELD 72
           S  +++  + I  T +PE T+ E   ++  +    +H++ ++    +    +  +L EL+
Sbjct: 296 SPRESSGVEGIQRTFFPELTEDEERVVRILMRQGDLHVNALVVEANVPVNRMSALLFELE 355

Query: 73  LAGRLCHHPEGKVSL 87
           + G +     G   L
Sbjct: 356 MKGVIKAMVGGVYHL 370


>gi|225621489|ref|YP_002722748.1| putative DNA protecting protein DprA [Brachyspira hyodysenteriae
           WA1]
 gi|225216310|gb|ACN85044.1| putative DNA protecting protein DprA [Brachyspira hyodysenteriae
           WA1]
          Length = 416

 Score = 53.3 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 12/68 (17%), Positives = 28/68 (41%), Gaps = 1/68 (1%)

Query: 21  KNINITHYPEYTQCERVRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCH 79
              N        Q +   +   +  N  IHID++I  + ++   V  +L++L++ G +  
Sbjct: 347 SKQNDESIISALQEDEALLYNIIKQNDKIHIDEVIEESKMKVQAVTSMLMQLEIKGIIKQ 406

Query: 80  HPEGKVSL 87
                 ++
Sbjct: 407 LSGKYYTI 414


>gi|88855250|ref|ZP_01129915.1| DNA processing factor [marine actinobacterium PHSC20C1]
 gi|88815778|gb|EAR25635.1| DNA processing factor [marine actinobacterium PHSC20C1]
          Length = 434

 Score = 52.9 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 13/70 (18%), Positives = 23/70 (32%), Gaps = 1/70 (1%)

Query: 9   NFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLN-NVPIHIDDIIHHTGIEAPVVYLV 67
                 ++     +            E  R+  +L+       DDI   +G+    V   
Sbjct: 349 PESQPPTNLPPESSAPKVDADSPPSTETTRLLDALSVRSARTADDIASRSGLALATVRAH 408

Query: 68  LLELDLAGRL 77
           L  L+L GR+
Sbjct: 409 LGLLELDGRV 418


>gi|255693546|ref|ZP_05417221.1| putative DNA processing protein DprA [Bacteroides finegoldii DSM
           17565]
 gi|260620611|gb|EEX43482.1| putative DNA processing protein DprA [Bacteroides finegoldii DSM
           17565]
          Length = 374

 Score = 52.9 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 12/60 (20%), Positives = 23/60 (38%), Gaps = 5/60 (8%)

Query: 31  YTQCERVRI---KQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
               E  +I    + L N  + I+ ++    I    +  +L EL++ G +     G   L
Sbjct: 315 ELSEEEQKIVAILEKLGN--LQINSLVVEADIPVNKMTAILFELEMKGVIRVLAGGMYQL 372


>gi|331007628|ref|ZP_08330770.1| Rossmann fold nucleotide-binding protein [gamma proteobacterium
           IMCC1989]
 gi|330418568|gb|EGG93092.1| Rossmann fold nucleotide-binding protein [gamma proteobacterium
           IMCC1989]
          Length = 391

 Score = 52.9 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 12/62 (19%), Positives = 21/62 (33%)

Query: 23  INITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPE 82
                     + +   +   L   P  ID +I  T +    +   LL L++ G + H   
Sbjct: 327 AQTEKKRPELEPKDKVLLAHLGFAPTSIDQLIETTQLSHADISDALLTLEINGWIKHSAW 386

Query: 83  GK 84
           G 
Sbjct: 387 GY 388


>gi|281422352|ref|ZP_06253351.1| putative DNA processing protein DprA [Prevotella copri DSM 18205]
 gi|281403583|gb|EFB34263.1| putative DNA processing protein DprA [Prevotella copri DSM 18205]
          Length = 392

 Score = 52.9 bits (126), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 13/72 (18%), Positives = 28/72 (38%), Gaps = 2/72 (2%)

Query: 17  TNHTKNINITHYPEYTQCERVRIKQSLNNV-PIHIDDIIHHTGIEAPVVYLVLLELDLAG 75
               + I  + +PE    E   I   L+    + I+ I   + I+   +  +L ++++ G
Sbjct: 320 RAKQQGIERSLFPE-LSTEEELIVSILSKTNDLQINIISVKSNIDISRLTSLLFQMEMKG 378

Query: 76  RLCHHPEGKVSL 87
            +     G   L
Sbjct: 379 IIRTLAGGMYHL 390


>gi|119896389|ref|YP_931602.1| putative DNA processing protein DrpA [Azoarcus sp. BH72]
 gi|119668802|emb|CAL92715.1| putative DNA processing protein DrpA [Azoarcus sp. BH72]
          Length = 372

 Score = 52.5 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 9/49 (18%), Positives = 24/49 (48%)

Query: 39  IKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           +   + + P+ I+ ++  +G+    +Y +LL ++L GR+      +   
Sbjct: 323 VLALIGHEPVDIELLVQRSGLTVDALYAILLPMELDGRIGRCAGSRFQR 371


>gi|326799926|ref|YP_004317745.1| DNA protecting protein DprA [Sphingobacterium sp. 21]
 gi|326550690|gb|ADZ79075.1| DNA protecting protein DprA [Sphingobacterium sp. 21]
          Length = 364

 Score = 52.5 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 12/56 (21%), Positives = 23/56 (41%), Gaps = 1/56 (1%)

Query: 32  TQCERVRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
              E   +   +  +  I ID + + T +    + ++LLEL++ G L   P     
Sbjct: 307 LNPEEKHVFDIVKESGSIGIDALAYKTNLTQSKLAILLLELEMKGVLIALPGKMYR 362


>gi|313159668|gb|EFR59025.1| DNA protecting protein DprA [Alistipes sp. HGB5]
          Length = 367

 Score = 52.5 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 8/69 (11%), Positives = 24/69 (34%), Gaps = 1/69 (1%)

Query: 18  NHTKNINITHYPEYTQCERVRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGR 76
                +           +   +      + P+  + +   +G++   +  +L+ L+LAG 
Sbjct: 295 AEPATLRPKPATPQLTPDETGLLGCFRTDDPLSHETLSELSGLDPGELATLLVGLELAGA 354

Query: 77  LCHHPEGKV 85
           +   P  + 
Sbjct: 355 VRQLPGNRY 363


>gi|302392405|ref|YP_003828225.1| DNA protecting protein DprA [Acetohalobium arabaticum DSM 5501]
 gi|302204482|gb|ADL13160.1| DNA protecting protein DprA [Acetohalobium arabaticum DSM 5501]
          Length = 367

 Score = 52.5 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 9/57 (15%), Positives = 23/57 (40%)

Query: 32  TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
              +  ++   + +VP   D I+      A  +  +LL+L++ G +      +   +
Sbjct: 310 LSLQEAKVYDKIESVPQEFDKILATVDFSASQLNSILLKLEIKGLITQLAGNRFKRS 366


>gi|167763918|ref|ZP_02436045.1| hypothetical protein BACSTE_02300 [Bacteroides stercoris ATCC
           43183]
 gi|167698034|gb|EDS14613.1| hypothetical protein BACSTE_02300 [Bacteroides stercoris ATCC
           43183]
          Length = 372

 Score = 52.5 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 11/59 (18%), Positives = 23/59 (38%), Gaps = 1/59 (1%)

Query: 30  EYTQCERVRIKQSLNNVP-IHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
                E   + + L +   +HI+ ++    I    +  +L EL++ G +     G   L
Sbjct: 312 PELTDEEELVVRILTHQGDLHINALVVEADIPVNRMSALLFELEMKGVVKALVGGVYCL 370


>gi|319407290|emb|CBI80931.1| DNA processing chain A [Bartonella sp. 1-1C]
          Length = 383

 Score = 52.5 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 42/77 (54%)

Query: 13  SQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELD 72
            + +T+  K I           ER  +  +L++ PI +D +  ++G+    +YL+L+ELD
Sbjct: 307 PRENTSPPKQITNETSLIGDDIEREAVLAALSSTPIDLDTLSIYSGVSLQKLYLLLIELD 366

Query: 73  LAGRLCHHPEGKVSLTM 89
           LAG+L  H  G VSL+ 
Sbjct: 367 LAGKLIRHSGGYVSLST 383


>gi|313835145|gb|EFS72859.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL037PA2]
          Length = 127

 Score = 52.5 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 16/57 (28%), Positives = 26/57 (45%), Gaps = 1/57 (1%)

Query: 39 IKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMH-LPSP 94
          I  SL   P  +D ++  TG     +   L EL+  G+L     G V++ +  +P P
Sbjct: 2  IINSLGASPTSVDALVELTGASPATIRRDLTELEGHGQLRKVHGGAVTVNLRGMPMP 58


>gi|117926935|ref|YP_867552.1| DNA protecting protein DprA [Magnetococcus sp. MC-1]
 gi|117610691|gb|ABK46146.1| DNA protecting protein DprA [Magnetococcus sp. MC-1]
          Length = 365

 Score = 52.5 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 9/57 (15%), Positives = 23/57 (40%)

Query: 31  YTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
                   +  +L +  + +D ++    +    +   LL+L+L G +     G ++L
Sbjct: 304 PDIPGAASVVAALGDGALTVDGLLRLCHLTPAELSSTLLQLELCGIITREMGGTLAL 360


>gi|284099271|ref|ZP_06385988.1| SMF protein [Candidatus Poribacteria sp. WGA-A3]
 gi|283830401|gb|EFC34611.1| SMF protein [Candidatus Poribacteria sp. WGA-A3]
          Length = 375

 Score = 52.5 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 11/64 (17%), Positives = 25/64 (39%)

Query: 25  ITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGK 84
                     +  R+   +++ P+ ID+++     +   V  +LL L+L G +   P   
Sbjct: 308 QETAVPVFTAKEQRVLALVHDEPVSIDEVLTQAPFDRAEVMSLLLSLELRGCIQQVPGSC 367

Query: 85  VSLT 88
              +
Sbjct: 368 YIRS 371


>gi|319404285|emb|CBI77878.1| DNA processing chain A [Bartonella rochalimae ATCC BAA-1498]
          Length = 383

 Score = 52.5 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 26/77 (33%), Positives = 42/77 (54%)

Query: 13  SQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELD 72
            Q +T+  K I           ER  +  +L++ PI +D +  ++G+    +YL+L+ELD
Sbjct: 307 PQENTSPPKQITNETSLIGDDIEREAVLSALSSTPIDLDTLSIYSGVSLQKLYLLLIELD 366

Query: 73  LAGRLCHHPEGKVSLTM 89
           LAG+L  H  G VSL+ 
Sbjct: 367 LAGKLIRHSGGYVSLST 383


>gi|134299832|ref|YP_001113328.1| DNA protecting protein DprA [Desulfotomaculum reducens MI-1]
 gi|134052532|gb|ABO50503.1| DNA protecting protein DprA [Desulfotomaculum reducens MI-1]
          Length = 364

 Score = 52.5 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 8/54 (14%), Positives = 22/54 (40%)

Query: 32  TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
            +    ++   L+ +P  ++ +I+ + +    V   L  L++ G +   P    
Sbjct: 306 LEVNEKKVLAVLSEIPQTMEQVINLSKLLPEEVAAALTILEIEGLIRSLPGKMY 359


>gi|226942189|ref|YP_002797262.1| DNA processing protein DprA [Azotobacter vinelandii DJ]
 gi|226717116|gb|ACO76287.1| DNA processing protein, DprA (SMF family) [Azotobacter vinelandii
           DJ]
          Length = 366

 Score = 52.5 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 12/69 (17%), Positives = 22/69 (31%), Gaps = 1/69 (1%)

Query: 14  QSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDL 73
           +   N          P      R  +   L+  P   +++   +G     V   L EL+L
Sbjct: 292 RGWQNLAPPPRSQAGPAPLDA-RHPLLALLHAAPQTSEELALASGWPLARVLAALTELEL 350

Query: 74  AGRLCHHPE 82
            G++     
Sbjct: 351 DGKVAREGG 359


>gi|317057707|ref|YP_004106174.1| SMF family protein [Ruminococcus albus 7]
 gi|315449976|gb|ADU23540.1| SMF family protein [Ruminococcus albus 7]
          Length = 380

 Score = 52.5 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 15/75 (20%), Positives = 25/75 (33%), Gaps = 2/75 (2%)

Query: 15  SDTNHTKNINITHYPE-YTQCERVRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLLELD 72
           +    +K       P          I   L  N  + +D+I   +G+    V   +  L+
Sbjct: 304 NAQAVSKQEKAPKKPARELNSTESTIYDLLKENGAMSLDEITARSGLSVMEVLTCMTGLE 363

Query: 73  LAGRLCHHPEGKVSL 87
           LAG     P  +  L
Sbjct: 364 LAGIAVSLPGKRYEL 378


>gi|330994161|ref|ZP_08318089.1| Protein smf [Gluconacetobacter sp. SXCC-1]
 gi|329758628|gb|EGG75144.1| Protein smf [Gluconacetobacter sp. SXCC-1]
          Length = 390

 Score = 52.1 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 16/94 (17%), Positives = 28/94 (29%), Gaps = 6/94 (6%)

Query: 4   PQIEQNFFSSQSDTNHTKNINITHYPEYTQCE---RVRIKQSLNNVPIHIDDIIHHTGIE 60
           P         +      + +         Q E      I+  L+  P  +DD++      
Sbjct: 299 PVRNPAVPQRERAGTVLRAVPAPGPCPPAQGEGDLHEMIEGFLSFTPSPVDDLVRRCQFS 358

Query: 61  APVVYLVLLELDLAGRLCHHPEGKVSLTMHLPSP 94
              V   L E+++AG +       V      P P
Sbjct: 359 TAAVLTALSEMEIAGTVEFLAGDMVVRR---PPP 389


>gi|323524422|ref|YP_004226575.1| DNA protecting protein DprA [Burkholderia sp. CCGE1001]
 gi|323381424|gb|ADX53515.1| DNA protecting protein DprA [Burkholderia sp. CCGE1001]
          Length = 448

 Score = 52.1 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 15/65 (23%), Positives = 33/65 (50%)

Query: 26  THYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
           +H P  +  +  R+  +L + P  ++ +   T ++  ++   LL+L+LAG +   P G+ 
Sbjct: 383 SHAPAPSDPDAQRLLAALGHAPTSLEILATRTEMDYAILQTTLLQLELAGHVSALPGGRY 442

Query: 86  SLTMH 90
           +   H
Sbjct: 443 TRASH 447


>gi|329956498|ref|ZP_08297095.1| DNA protecting protein DprA [Bacteroides clarus YIT 12056]
 gi|328524395|gb|EGF51465.1| DNA protecting protein DprA [Bacteroides clarus YIT 12056]
          Length = 372

 Score = 52.1 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 17/70 (24%), Positives = 29/70 (41%), Gaps = 4/70 (5%)

Query: 20  TKNINITHYPEYTQCE--RVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRL 77
            + I    +PE T  E   VRI     +  +HI+ ++    I    +  +L EL++ G +
Sbjct: 303 AEGIQRNLFPELTDEEGMIVRILARQGD--LHINALVVEADIPVNRMSALLFELEMKGVV 360

Query: 78  CHHPEGKVSL 87
                G   L
Sbjct: 361 KTLVGGMYHL 370


>gi|29348479|ref|NP_811982.1| Smf protein DNA processing chain A [Bacteroides thetaiotaomicron
           VPI-5482]
 gi|29340383|gb|AAO78176.1| Smf protein DNA processing chain A [Bacteroides thetaiotaomicron
           VPI-5482]
          Length = 358

 Score = 52.1 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 16/84 (19%), Positives = 34/84 (40%), Gaps = 2/84 (2%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVP-IHIDDIIHHTGIEAPV 63
            +E   ++  S     +N+  + + E    E  +I  +L     + I+ ++  T I    
Sbjct: 275 LVEAMGWTLDSHPAKVENVQRSLFLE-LTEEEQKIVHTLEKQGNLQINTLVVETDIPVHK 333

Query: 64  VYLVLLELDLAGRLCHHPEGKVSL 87
           +  +L EL++ G +     G   L
Sbjct: 334 MSAILFELEMKGAVRVLAGGVYQL 357


>gi|270157751|ref|ZP_06186408.1| DNA protecting protein DprA [Legionella longbeachae D-4968]
 gi|289163980|ref|YP_003454118.1| Protein smf [Legionella longbeachae NSW150]
 gi|269989776|gb|EEZ96030.1| DNA protecting protein DprA [Legionella longbeachae D-4968]
 gi|288857153|emb|CBJ10969.1| Protein smf [Legionella longbeachae NSW150]
          Length = 357

 Score = 52.1 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 12/56 (21%), Positives = 21/56 (37%)

Query: 31  YTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
                   + + +      +D II  +G     V   L EL+L+G +   P G + 
Sbjct: 301 PLASGNKNLVKFIGFEMTTVDQIILRSGCTVEQVTRELAELELSGVVVSVPGGYMR 356


>gi|260061224|ref|YP_003194304.1| DNA processing protein DprA [Robiginitalea biformata HTCC2501]
 gi|88785356|gb|EAR16525.1| DNA processing protein DprA, putative [Robiginitalea biformata
           HTCC2501]
          Length = 412

 Score = 52.1 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 9/69 (13%), Positives = 20/69 (28%), Gaps = 1/69 (1%)

Query: 19  HTKNINITHYPEYTQCERVRIKQSLNNVP-IHIDDIIHHTGIEAPVVYLVLLELDLAGRL 77
              N  +   P         + + L     +H+D++     +        L  L++ G +
Sbjct: 341 PNPNRAVNPVPGDLDPTENTLARCLAESGCMHLDEVAVRCQLGVSEAVSGLFNLEMRGLV 400

Query: 78  CHHPEGKVS 86
              P     
Sbjct: 401 RSLPGKLFR 409


>gi|218131616|ref|ZP_03460420.1| hypothetical protein BACEGG_03236 [Bacteroides eggerthii DSM 20697]
 gi|217985919|gb|EEC52258.1| hypothetical protein BACEGG_03236 [Bacteroides eggerthii DSM 20697]
          Length = 372

 Score = 52.1 bits (124), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 14/77 (18%), Positives = 32/77 (41%)

Query: 11  FSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLE 70
           ++        + I  + +PE T+ E   ++  +    +HI+ ++    I    +  +L E
Sbjct: 294 WTDTEPPVKAEGIQRSLFPELTEEEEAVVRILVRQGDLHINTLVVEADIPVNRMSALLFE 353

Query: 71  LDLAGRLCHHPEGKVSL 87
           L++ G +     G   L
Sbjct: 354 LEMKGVVKTLVGGVYHL 370


>gi|317474750|ref|ZP_07934024.1| DNA recombination-mediator protein A [Bacteroides eggerthii
           1_2_48FAA]
 gi|316909431|gb|EFV31111.1| DNA recombination-mediator protein A [Bacteroides eggerthii
           1_2_48FAA]
          Length = 372

 Score = 52.1 bits (124), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 14/68 (20%), Positives = 30/68 (44%)

Query: 20  TKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCH 79
            + I  + +PE T+ E   ++  +    +HI+ ++    I    +  +L EL++ G +  
Sbjct: 303 AEGIQRSLFPELTEEEEAVVRILVRQGDLHINTLVVEADIPVNRMSALLFELEMKGVVKT 362

Query: 80  HPEGKVSL 87
              G   L
Sbjct: 363 LVGGVYHL 370


>gi|110832994|ref|YP_691853.1| peptide deformylase, DNA processing protein [Alcanivorax
           borkumensis SK2]
 gi|110646105|emb|CAL15581.1| peptide deformylase, DNA processing protein [Alcanivorax
           borkumensis SK2]
          Length = 353

 Score = 52.1 bits (124), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 10/53 (18%), Positives = 20/53 (37%)

Query: 35  ERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           E   +   L +    +D +   TG+    +   L +L+L G +     G +  
Sbjct: 296 EAPALLTQLTSGVNSLDALQERTGLPVAALAGQLADLELEGWVERVAGGYLKR 348


>gi|299144970|ref|ZP_07038038.1| putative DNA processing protein DprA [Bacteroides sp. 3_1_23]
 gi|298515461|gb|EFI39342.1| putative DNA processing protein DprA [Bacteroides sp. 3_1_23]
          Length = 374

 Score = 52.1 bits (124), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 12/60 (20%), Positives = 23/60 (38%), Gaps = 5/60 (8%)

Query: 31  YTQCERVRI---KQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
               E  +I    + L N  + I+ ++    I    +  +L EL++ G +     G   L
Sbjct: 315 ELSEEEQKIVAILEKLGN--LQINSLVVEADIPVNKMTALLFELEMKGVIRVLAGGMYQL 372


>gi|298385823|ref|ZP_06995380.1| DNA processing protein DprA [Bacteroides sp. 1_1_14]
 gi|298261051|gb|EFI03918.1| DNA processing protein DprA [Bacteroides sp. 1_1_14]
          Length = 373

 Score = 52.1 bits (124), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 15/84 (17%), Positives = 34/84 (40%), Gaps = 2/84 (2%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVP-IHIDDIIHHTGIEAPV 63
            +E   ++  S     +N+  + + E    E  ++  +L     + I+ ++  T I    
Sbjct: 290 LVEAMGWTLDSHPAKVENVQRSLFLE-LTEEEQKVVHTLEKQGNLQINTLVVETDIPVHK 348

Query: 64  VYLVLLELDLAGRLCHHPEGKVSL 87
           +  +L EL++ G +     G   L
Sbjct: 349 MSAILFELEMKGAVRVLAGGVYQL 372


>gi|323701838|ref|ZP_08113508.1| DNA protecting protein DprA [Desulfotomaculum nigrificans DSM 574]
 gi|323533142|gb|EGB23011.1| DNA protecting protein DprA [Desulfotomaculum nigrificans DSM 574]
          Length = 363

 Score = 52.1 bits (124), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 5/50 (10%), Positives = 19/50 (38%)

Query: 36  RVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
              + + L+  P+ ++ ++  + +        +  L++ G +   P    
Sbjct: 309 ERDLWEVLSYQPMSLEQLVEASKLSPQDTAAAITMLEIKGLVRLLPGKVY 358


>gi|148556726|ref|YP_001264308.1| DNA protecting protein DprA [Sphingomonas wittichii RW1]
 gi|148501916|gb|ABQ70170.1| DNA protecting protein DprA [Sphingomonas wittichii RW1]
          Length = 592

 Score = 52.1 bits (124), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 27/84 (32%), Positives = 40/84 (47%), Gaps = 1/84 (1%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYP-EYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPV 63
             E     +        N      P E  +  R  +   L  VP+ +D++I  +G+ A +
Sbjct: 506 IAEALSPIAGVAARPADNFASAPAPAEADEPARAALTGLLGPVPLAVDELIRQSGVSAAM 565

Query: 64  VYLVLLELDLAGRLCHHPEGKVSL 87
           V +VLLEL+L GRL  H  G+VSL
Sbjct: 566 VQMVLLELELGGRLDRHAGGRVSL 589


>gi|240850661|ref|YP_002972061.1| DNA processing chain A [Bartonella grahamii as4aup]
 gi|240267784|gb|ACS51372.1| DNA processing chain A [Bartonella grahamii as4aup]
          Length = 404

 Score = 51.8 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 33/99 (33%), Positives = 48/99 (48%), Gaps = 8/99 (8%)

Query: 4   PQIEQNFFSSQSDT-------NHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHH 56
           P  + NFF   S         N     N +         R  +  +L+  PI +D +  H
Sbjct: 302 PNSQLNFFEEPSSLQLKKENFNLADEKNSSLSLAGDDAARAAVLSALSTTPIDLDTLSIH 361

Query: 57  TGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHLPSPQ 95
           +G+  P +YL+L+ELDLAG+L  H  G VSL+ +L  PQ
Sbjct: 362 SGVSLPALYLLLVELDLAGKLIRHSGGCVSLS-NLDLPQ 399


>gi|253569154|ref|ZP_04846564.1| smf protein DNA processing chain A [Bacteroides sp. 1_1_6]
 gi|251841173|gb|EES69254.1| smf protein DNA processing chain A [Bacteroides sp. 1_1_6]
          Length = 373

 Score = 51.8 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 15/84 (17%), Positives = 34/84 (40%), Gaps = 2/84 (2%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVP-IHIDDIIHHTGIEAPV 63
            +E   ++  S     +N+  + + E    E  ++  +L     + I+ ++  T I    
Sbjct: 290 LVEAMGWTLDSHPAKVENVQRSLFLE-LTEEEQKVVHTLEKQGNLQINTLVVETDIPVHK 348

Query: 64  VYLVLLELDLAGRLCHHPEGKVSL 87
           +  +L EL++ G +     G   L
Sbjct: 349 MSAILFELEMKGAVRVLAGGVYQL 372


>gi|254497988|ref|ZP_05110751.1| DNA processing enzyme DprA [Legionella drancourtii LLAP12]
 gi|254352765|gb|EET11537.1| DNA processing enzyme DprA [Legionella drancourtii LLAP12]
          Length = 357

 Score = 51.8 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 14/53 (26%), Positives = 21/53 (39%)

Query: 34  CERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
            E   + + +      ID II  +G     V   L EL+L G +   P G + 
Sbjct: 304 SENENLVKFIGFEMTTIDQIILRSGSTVEQVTRELAELELKGAVLSVPGGYMR 356


>gi|282900736|ref|ZP_06308678.1| SMF protein [Cylindrospermopsis raciborskii CS-505]
 gi|281194536|gb|EFA69491.1| SMF protein [Cylindrospermopsis raciborskii CS-505]
          Length = 375

 Score = 51.8 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 11/54 (20%), Positives = 23/54 (42%)

Query: 32  TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
            + E  ++   L    +  D I+    + + +V   LL+L+L G +   P  + 
Sbjct: 318 LEPELQQVMSILTVDALPFDLIVEKAKMGSGLVSGYLLQLELMGLVSQLPGMRY 371


>gi|330720128|gb|EGG98532.1| Rossmann fold nucleotide-binding protein Smf possibly involved in
           DNA uptake [gamma proteobacterium IMCC2047]
          Length = 383

 Score = 51.8 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 11/57 (19%), Positives = 25/57 (43%)

Query: 31  YTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
                  ++ + +   P+ +D ++  T +    +  VL +L L G++ H   G V +
Sbjct: 320 PEGAVYQQVLEKMGFDPVPMDALVERTELMVTELSAVLTQLTLQGKVEHTERGFVRV 376


>gi|329851389|ref|ZP_08266146.1| DNA protecting protein DprA [Asticcacaulis biprosthecum C19]
 gi|328840235|gb|EGF89807.1| DNA protecting protein DprA [Asticcacaulis biprosthecum C19]
          Length = 372

 Score = 51.8 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 14/75 (18%), Positives = 24/75 (32%)

Query: 12  SSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLEL 71
            S                        R+++     P+  D++I   G    V    L EL
Sbjct: 297 PSPRWPVPPLIFPTDGQDGDIAKAARRLRELAGATPVSRDELIRLAGAPVHVALSALCEL 356

Query: 72  DLAGRLCHHPEGKVS 86
           ++AG +     G V+
Sbjct: 357 EIAGLITEVEGGYVA 371


>gi|237721926|ref|ZP_04552407.1| smf protein DNA processing chain A [Bacteroides sp. 2_2_4]
 gi|229448795|gb|EEO54586.1| smf protein DNA processing chain A [Bacteroides sp. 2_2_4]
          Length = 374

 Score = 51.8 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 12/60 (20%), Positives = 23/60 (38%), Gaps = 5/60 (8%)

Query: 31  YTQCERVRI---KQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
               E  +I    + L N  + I+ ++    I    +  +L EL++ G +     G   L
Sbjct: 315 ELSEEEQKIVAILEKLGN--LQINSLVVEADIPVNKMTALLFELEMKGVIRVLAGGMYQL 372


>gi|298482604|ref|ZP_07000789.1| DNA processing protein DprA [Bacteroides sp. D22]
 gi|298271311|gb|EFI12887.1| DNA processing protein DprA [Bacteroides sp. D22]
          Length = 374

 Score = 51.8 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 12/60 (20%), Positives = 23/60 (38%), Gaps = 5/60 (8%)

Query: 31  YTQCERVRI---KQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
               E  +I    + L N  + I+ ++    I    +  +L EL++ G +     G   L
Sbjct: 315 ELSEEEQKIVAILEKLGN--LQINSLVVEADIPVNKMTALLFELEMKGVIRVLAGGMYQL 372


>gi|261378982|ref|ZP_05983555.1| putative DNA processing protein DprA [Neisseria cinerea ATCC 14685]
 gi|269144597|gb|EEZ71015.1| putative DNA processing protein DprA [Neisseria cinerea ATCC 14685]
          Length = 397

 Score = 51.8 bits (123), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 18/84 (21%), Positives = 31/84 (36%)

Query: 4   PQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPV 63
           P+       + SD   +    +       +     I   +   P+H D +    G+ A  
Sbjct: 311 PEKRITAVQTASDPPFSSEGKMPSEKTENRPVGGSILDRMGFDPVHPDVLAEQLGMPAAD 370

Query: 64  VYLVLLELDLAGRLCHHPEGKVSL 87
           +Y  LLEL+L G +   P G+   
Sbjct: 371 LYAELLELELDGSIAAMPGGRYQR 394


>gi|302389647|ref|YP_003825468.1| DNA protecting protein DprA [Thermosediminibacter oceani DSM 16646]
 gi|302200275|gb|ADL07845.1| DNA protecting protein DprA [Thermosediminibacter oceani DSM 16646]
          Length = 359

 Score = 51.8 bits (123), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 9/53 (16%), Positives = 22/53 (41%)

Query: 35  ERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           E + +   ++  P +++ ++  TG     +  ++  L L   +   P G V  
Sbjct: 306 EEMEVLNLIDYHPTNVEVVVQKTGKAPQEINAIITRLQLKDLIASLPGGYVMR 358


>gi|198274063|ref|ZP_03206595.1| hypothetical protein BACPLE_00200 [Bacteroides plebeius DSM
          17135]
 gi|198273141|gb|EDY97410.1| hypothetical protein BACPLE_00200 [Bacteroides plebeius DSM
          17135]
          Length = 79

 Score = 51.4 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 10/61 (16%), Positives = 21/61 (34%), Gaps = 2/61 (3%)

Query: 30 EYTQCERVRIKQSLN--NVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
               E  ++   L      I I+ ++  + I    +  +L  L++ G +     G   L
Sbjct: 19 PELTPEEEQVITHLQKHPDGIQINTLVVESNIAINRMTSLLFNLEMKGVVRALAGGVYKL 78

Query: 88 T 88
           
Sbjct: 79 A 79


>gi|153807025|ref|ZP_01959693.1| hypothetical protein BACCAC_01302 [Bacteroides caccae ATCC 43185]
 gi|149130145|gb|EDM21355.1| hypothetical protein BACCAC_01302 [Bacteroides caccae ATCC 43185]
          Length = 374

 Score = 51.4 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 9/57 (15%), Positives = 21/57 (36%), Gaps = 1/57 (1%)

Query: 32  TQCERVRIKQSLNNVP-IHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
              +  ++   L     + I+ ++    I    +  +L EL++ G +     G   L
Sbjct: 316 LSEDEQKVVDILEKQGDLQINTLVVEADIPVQKMNAILFELEMKGVIRVLVGGMYQL 372


>gi|312887672|ref|ZP_07747263.1| DNA protecting protein DprA [Mucilaginibacter paludis DSM 18603]
 gi|311299851|gb|EFQ76929.1| DNA protecting protein DprA [Mucilaginibacter paludis DSM 18603]
          Length = 366

 Score = 51.4 bits (122), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 13/72 (18%), Positives = 25/72 (34%), Gaps = 2/72 (2%)

Query: 19  HTKNINITHYPEYTQCERVRIKQSL--NNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGR 76
             K       P         I +++  N   + IDD+   T +    + + LL L++ G 
Sbjct: 295 EVKPQAQLMLPIDLSPNESLIFETIRQNAGQLGIDDLAIKTNLPLSQLAMNLLNLEMQGF 354

Query: 77  LCHHPEGKVSLT 88
           +   P     + 
Sbjct: 355 VNSLPGKTYRVN 366


>gi|171913964|ref|ZP_02929434.1| putative protein required for chromosomal DNA transformation
           [Verrucomicrobium spinosum DSM 4136]
          Length = 367

 Score = 51.4 bits (122), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 7/82 (8%), Positives = 26/82 (31%), Gaps = 1/82 (1%)

Query: 9   NFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTG-IEAPVVYLV 67
           +  +          +           +   + +++ +   HI++I      +   +V   
Sbjct: 286 DLMTLFPTEPQAPKMESVQPGVTLAPDEATVFEAIGSGEAHINEIAERCSPLSGSLVSAT 345

Query: 68  LLELDLAGRLCHHPEGKVSLTM 89
           L++L++   +   P       +
Sbjct: 346 LMKLEIKRVVKPLPGKFYVRLV 367


>gi|121533773|ref|ZP_01665600.1| DNA protecting protein DprA [Thermosinus carboxydivorans Nor1]
 gi|121307764|gb|EAX48679.1| DNA protecting protein DprA [Thermosinus carboxydivorans Nor1]
          Length = 282

 Score = 51.0 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 13/51 (25%), Positives = 24/51 (47%), Gaps = 1/51 (1%)

Query: 28  YPEYTQCERVRIKQSLNNV-PIHIDDIIHHTGIEAPVVYLVLLELDLAGRL 77
                  +   +  SL+   P+ +D+I+  T + A  V   LL+L+L G +
Sbjct: 215 AAPELLPDEAAVYGSLDYEHPLSVDEIVIKTNLSASKVTYALLQLELRGLI 265


>gi|119475270|ref|ZP_01615623.1| SMF protein [marine gamma proteobacterium HTCC2143]
 gi|119451473|gb|EAW32706.1| SMF protein [marine gamma proteobacterium HTCC2143]
          Length = 368

 Score = 51.0 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 8/49 (16%), Positives = 16/49 (32%)

Query: 36  RVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGK 84
              +   +   P+ ID +   T      +  ++  L+L G L       
Sbjct: 316 ERLLLDIIGYDPVSIDSLQQRTDWPMHDLVALVTALELRGLLDCVAGSY 364


>gi|293373773|ref|ZP_06620119.1| DNA protecting protein DprA [Bacteroides ovatus SD CMC 3f]
 gi|292631263|gb|EFF49895.1| DNA protecting protein DprA [Bacteroides ovatus SD CMC 3f]
          Length = 374

 Score = 51.0 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 12/60 (20%), Positives = 23/60 (38%), Gaps = 5/60 (8%)

Query: 31  YTQCERVRI---KQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
               E  +I    + L N  + I+ ++    I    +  +L EL++ G +     G   L
Sbjct: 315 ELSEEEQKIVAILEKLGN--LQINSLVVEADIPVNKMTALLFELEMKGVIRVLAGGMYQL 372


>gi|296120323|ref|YP_003628101.1| DNA protecting protein DprA [Planctomyces limnophilus DSM 3776]
 gi|296012663|gb|ADG65902.1| DNA protecting protein DprA [Planctomyces limnophilus DSM 3776]
          Length = 368

 Score = 51.0 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 9/75 (12%), Positives = 21/75 (28%)

Query: 13  SQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELD 72
           S         +           +  ++ Q +      +D ++   G+E       L  L+
Sbjct: 292 SAPVQKPGGQVVQQPRELLLNDQEQKLLQLVGIEATPVDTVLTQCGLEYSRALSTLTVLE 351

Query: 73  LAGRLCHHPEGKVSL 87
           +   +   P   V  
Sbjct: 352 IKKLVRRLPGNFVVR 366


>gi|295085711|emb|CBK67234.1| DNA protecting protein DprA [Bacteroides xylanisolvens XB1A]
          Length = 374

 Score = 51.0 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 12/60 (20%), Positives = 23/60 (38%), Gaps = 5/60 (8%)

Query: 31  YTQCERVRI---KQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
               E  +I    + L N  + I+ ++    I    +  +L EL++ G +     G   L
Sbjct: 315 ELSEEEQKIVAILEKLGN--LQINSLVVEADIPVNKMTALLFELEMKGVIRVLAGGMYQL 372


>gi|291544309|emb|CBL17418.1| DNA protecting protein DprA [Ruminococcus sp. 18P13]
          Length = 408

 Score = 51.0 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 13/89 (14%), Positives = 24/89 (26%), Gaps = 3/89 (3%)

Query: 1   MVHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVP-IHIDDIIHHTGI 59
           +V P+ +     S                      +  I   L     +H D +     +
Sbjct: 322 VVKPKKQPEQ--SAEPEQPETTAKPKGDRSSLDLLQTAIVNCLEQEGKMHADVLATRLEL 379

Query: 60  EAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
               + + L EL+L G +         L 
Sbjct: 380 SMEDLMMSLTELELMGVVTSLFGKVYELN 408


>gi|170742467|ref|YP_001771122.1| DNA protecting protein DprA [Methylobacterium sp. 4-46]
 gi|168196741|gb|ACA18688.1| DNA protecting protein DprA [Methylobacterium sp. 4-46]
          Length = 391

 Score = 51.0 bits (121), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 22/81 (27%), Positives = 36/81 (44%)

Query: 7   EQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYL 66
           E +FF+   +    + +           +R R+   L   P+ +D +    G+ A  V  
Sbjct: 310 ETDFFAQDPEPAAPEGLYEEAEEPPPPDDRARLLALLGPSPVAVDALGRQAGLSARSVQG 369

Query: 67  VLLELDLAGRLCHHPEGKVSL 87
           +LLEL+L G +  H  G VSL
Sbjct: 370 LLLELELDGLVTRHGGGSVSL 390


>gi|91216156|ref|ZP_01253124.1| Smf protein DNA processing chain A [Psychroflexus torquis ATCC
           700755]
 gi|91185673|gb|EAS72048.1| Smf protein DNA processing chain A [Psychroflexus torquis ATCC
           700755]
          Length = 366

 Score = 51.0 bits (121), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 11/57 (19%), Positives = 21/57 (36%), Gaps = 1/57 (1%)

Query: 32  TQCERVRIKQSLNNVPIH-IDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
              +   + Q L       ID +    G+    +  +LL L+L G +   P  +  +
Sbjct: 309 LNDDEKFVLQKLTETGKAEIDALSLICGLPTHKLSSILLNLELGGFVRPLPGKQFEI 365


>gi|296315164|ref|ZP_06865105.1| putative DNA processing protein DprA [Neisseria polysaccharea ATCC
           43768]
 gi|296837973|gb|EFH21911.1| putative DNA processing protein DprA [Neisseria polysaccharea ATCC
           43768]
          Length = 397

 Score = 50.6 bits (120), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 18/84 (21%), Positives = 31/84 (36%)

Query: 4   PQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPV 63
           P+       + SD   +    +       +     I   +   P+H D +    G+ A  
Sbjct: 311 PEKRITAVQTASDPPFSSEGKMPSEKTENRPVGGGILDRMGFDPVHPDVLAEQLGMPAAD 370

Query: 64  VYLVLLELDLAGRLCHHPEGKVSL 87
           +Y  LLEL+L G +   P G+   
Sbjct: 371 LYAELLELELDGSVAAMPGGRYQR 394


>gi|325859769|ref|ZP_08172899.1| DNA protecting protein DprA [Prevotella denticola CRIS 18C-A]
 gi|325482695|gb|EGC85698.1| DNA protecting protein DprA [Prevotella denticola CRIS 18C-A]
          Length = 372

 Score = 50.6 bits (120), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 14/76 (18%), Positives = 31/76 (40%), Gaps = 2/76 (2%)

Query: 13  SQSDTNHTKNINITHYPEYTQCERVRIKQSLN-NVPIHIDDIIHHTGIEAPVVYLVLLEL 71
           ++ +  H + I  T +P+    E   + + L  N  + I+ +    G+    +  +L  L
Sbjct: 296 ARLEQAHQRGIERTLFPD-LSPEENSVVRVLAKNNDLQINLLSIQAGLPVSRLTGILFAL 354

Query: 72  DLAGRLCHHPEGKVSL 87
           ++ G +     G   L
Sbjct: 355 EMKGIIRAMAGGCYHL 370


>gi|228471774|ref|ZP_04056547.1| DNA processing chain A [Capnocytophaga gingivalis ATCC 33624]
 gi|228276927|gb|EEK15622.1| DNA processing chain A [Capnocytophaga gingivalis ATCC 33624]
          Length = 371

 Score = 50.6 bits (120), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 11/73 (15%), Positives = 24/73 (32%), Gaps = 4/73 (5%)

Query: 20  TKNINITHYPE---YTQCERVRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLLELDLAG 75
            K       PE       E  ++   L  N    +DD+     +    +  +L ++++ G
Sbjct: 296 EKKNPKVITPELFVELTPEEEKVATYLRENGKQTLDDLARECSLPVYKLSNLLFQMEMKG 355

Query: 76  RLCHHPEGKVSLT 88
            +   P     + 
Sbjct: 356 VVRPLPGKMFVMA 368


>gi|171057039|ref|YP_001789388.1| DNA protecting protein DprA [Leptothrix cholodnii SP-6]
 gi|170774484|gb|ACB32623.1| DNA protecting protein DprA [Leptothrix cholodnii SP-6]
          Length = 379

 Score = 50.6 bits (120), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 13/86 (15%), Positives = 26/86 (30%)

Query: 2   VHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEA 61
           +H  +     S+                         I  +L      +D +   TG   
Sbjct: 290 LHLAVPAAAVSTGPAHAEPAAEQPDDANPPPDDVDDPILLALGWSAATLDVLQARTGWAT 349

Query: 62  PVVYLVLLELDLAGRLCHHPEGKVSL 87
             + + LL+L+L+G++   P      
Sbjct: 350 AELNVHLLDLELSGQVVRLPGQLFQR 375


>gi|222099410|ref|YP_002533978.1| DNA protecting protein DprA [Thermotoga neapolitana DSM 4359]
 gi|221571800|gb|ACM22612.1| DNA protecting protein DprA [Thermotoga neapolitana DSM 4359]
          Length = 337

 Score = 50.6 bits (120), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 11/56 (19%), Positives = 22/56 (39%), Gaps = 1/56 (1%)

Query: 31  YTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
             +  +  + + L   P  +DD++     +   V  V+ EL+L G +     G   
Sbjct: 280 SLEPAQRTVYEYLKVSPKSVDDLVEELEWDVSEVLRVISELELMGLVEFT-GGIYR 334


>gi|327312940|ref|YP_004328377.1| DNA protecting protein DprA [Prevotella denticola F0289]
 gi|326944194|gb|AEA20079.1| DNA protecting protein DprA [Prevotella denticola F0289]
          Length = 372

 Score = 50.6 bits (120), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 14/76 (18%), Positives = 31/76 (40%), Gaps = 2/76 (2%)

Query: 13  SQSDTNHTKNINITHYPEYTQCERVRIKQSLN-NVPIHIDDIIHHTGIEAPVVYLVLLEL 71
           ++ +  H + I  T +P+    E   + + L  N  + I+ +    G+    +  +L  L
Sbjct: 296 ARLEQAHQRGIERTLFPD-LSPEENSVVRVLAKNNDLQINLLSIQAGLPVSRLTGILFAL 354

Query: 72  DLAGRLCHHPEGKVSL 87
           ++ G +     G   L
Sbjct: 355 EMKGIIRAMAGGCYHL 370


>gi|325294278|ref|YP_004280792.1| DNA protecting protein DprA [Desulfurobacterium thermolithotrophum
           DSM 11699]
 gi|325064726|gb|ADY72733.1| DNA protecting protein DprA [Desulfurobacterium thermolithotrophum
           DSM 11699]
          Length = 337

 Score = 50.6 bits (120), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 11/44 (25%), Positives = 22/44 (50%)

Query: 39  IKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPE 82
           I + L+  P+ ID I     ++ P +  +LLE+++ G +     
Sbjct: 289 IYELLSRSPLSIDQIADKLDMDIPTLTTLLLEMEILGLVRKEGG 332


>gi|167561028|ref|ZP_02353944.1| DNA protecting protein DprA [Burkholderia oklahomensis EO147]
          Length = 395

 Score = 50.6 bits (120), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 14/90 (15%), Positives = 36/90 (40%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVV 64
             E +   ++                    +  R+  ++ + P+ ++ +   T + +  +
Sbjct: 292 LDEFSLDRARPAAASRNAPADASTDAGLDADARRLLDAIGHGPVPLELLAQRTSLASDAL 351

Query: 65  YLVLLELDLAGRLCHHPEGKVSLTMHLPSP 94
           + +LL+L+LAGR+   P G+ +       P
Sbjct: 352 HRLLLQLELAGRITALPGGRYTRIDGAQGP 381


>gi|256819503|ref|YP_003140782.1| DNA protecting protein DprA [Capnocytophaga ochracea DSM 7271]
 gi|256581086|gb|ACU92221.1| DNA protecting protein DprA [Capnocytophaga ochracea DSM 7271]
          Length = 364

 Score = 50.2 bits (119), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 8/82 (9%), Positives = 22/82 (26%), Gaps = 1/82 (1%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSL-NNVPIHIDDIIHHTGIEAPV 63
              ++                         E   I   L  N    +D++     +    
Sbjct: 280 TSAKDLIYQLGWDTPAPKAVQQELFVTLSPEEETISAFLKANGKQSLDELALGCQMPIYQ 339

Query: 64  VYLVLLELDLAGRLCHHPEGKV 85
           +  +L ++++ G +   P  + 
Sbjct: 340 LSNLLFQMEIKGVIKPLPGKRF 361


>gi|78484539|ref|YP_390464.1| DNA processing protein DprA, putative [Thiomicrospira crunogena
           XCL-2]
 gi|78362825|gb|ABB40790.1| DNA protecting protein DprA [Thiomicrospira crunogena XCL-2]
          Length = 377

 Score = 50.2 bits (119), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 11/74 (14%), Positives = 28/74 (37%)

Query: 14  QSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDL 73
           Q   N       +   +  +     + + +   PI +D+++  + +    +   L+ L+L
Sbjct: 302 QLSLNEPSKGQGSSPTKKDKEAPGDLLRYIEFEPIGLDELVVLSKLPVSDIQSQLMMLEL 361

Query: 74  AGRLCHHPEGKVSL 87
            GR+     G+   
Sbjct: 362 EGRIEALSAGRWRR 375


>gi|167568289|ref|ZP_02361163.1| DNA protecting protein DprA [Burkholderia oklahomensis C6786]
          Length = 395

 Score = 50.2 bits (119), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 14/90 (15%), Positives = 35/90 (38%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVV 64
             E     ++                    +  R+  ++ + P+ ++ +   T + +  +
Sbjct: 292 LDEFGLDRARPAAASRNAPADASTDAGLDADARRLLDAIGHGPVPLELLAQRTSLASDAL 351

Query: 65  YLVLLELDLAGRLCHHPEGKVSLTMHLPSP 94
           + +LL+L+LAGR+   P G+ +       P
Sbjct: 352 HRLLLQLELAGRITALPGGRYTRIDGAQGP 381


>gi|158320506|ref|YP_001513013.1| DNA protecting protein DprA [Alkaliphilus oremlandii OhILAs]
 gi|158140705|gb|ABW19017.1| DNA protecting protein DprA [Alkaliphilus oremlandii OhILAs]
          Length = 365

 Score = 50.2 bits (119), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 11/63 (17%), Positives = 24/63 (38%)

Query: 25  ITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGK 84
                E       R+ + +   PIHID + + T +    +  +L  L++ G +       
Sbjct: 301 EKSTQEELSPLEKRVYEIIRRNPIHIDLLYNETRLHPWELNPILTILEIKGYIIQISGKT 360

Query: 85  VSL 87
            ++
Sbjct: 361 FTV 363


>gi|150026465|ref|YP_001297291.1| protein Smf of unknown function [Flavobacterium psychrophilum
           JIP02/86]
 gi|149773006|emb|CAL44490.1| Protein Smf of unknown function [Flavobacterium psychrophilum
           JIP02/86]
          Length = 366

 Score = 50.2 bits (119), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 10/58 (17%), Positives = 19/58 (32%), Gaps = 1/58 (1%)

Query: 31  YTQCERVRIKQSLNNVPIHI-DDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
             + E   I   L      + D I     +    +  +LL ++L G +   P     +
Sbjct: 308 SLEPEEQLIHDFLQKKGKELLDTIAIECNLPVFKLSSILLNMELKGLIRPLPGKLFEI 365


>gi|317153575|ref|YP_004121623.1| DNA protecting protein DprA [Desulfovibrio aespoeensis Aspo-2]
 gi|316943826|gb|ADU62877.1| DNA protecting protein DprA [Desulfovibrio aespoeensis Aspo-2]
          Length = 439

 Score = 50.2 bits (119), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 14/72 (19%), Positives = 23/72 (31%), Gaps = 1/72 (1%)

Query: 15  SDTNHTKNINITHYPEYTQCERVRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLLELDL 73
                 +             E  ++   L     +HID +    G E+  V  VLL L++
Sbjct: 355 ESRTRKRPGAARRSEMTLNDEERQLLAVLDGTDRVHIDTLGRTLGWESSRVSRVLLMLEV 414

Query: 74  AGRLCHHPEGKV 85
            G +   P    
Sbjct: 415 GGAVHQLPGMWY 426


>gi|49474246|ref|YP_032288.1| DNA processing chain A [Bartonella quintana str. Toulouse]
 gi|49239750|emb|CAF26132.1| DNA processing chain A [Bartonella quintana str. Toulouse]
          Length = 410

 Score = 50.2 bits (119), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 22/57 (38%), Positives = 35/57 (61%)

Query: 32  TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
              ER  +  +L+  PI +D +  H+G+    +YL+L+EL+LAG+L  H  G VSL+
Sbjct: 343 DDSERAALLSALSTTPIDLDTLSTHSGVPLQNLYLLLVELELAGKLIRHSGGYVSLS 399


>gi|158337778|ref|YP_001518954.1| DNA protecting protein DprA [Acaryochloris marina MBIC11017]
 gi|158308019|gb|ABW29636.1| DNA protecting protein DprA [Acaryochloris marina MBIC11017]
          Length = 376

 Score = 50.2 bits (119), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 11/79 (13%), Positives = 27/79 (34%), Gaps = 5/79 (6%)

Query: 13  SQSDTNHTKNINITHYPEYTQCER-----VRIKQSLNNVPIHIDDIIHHTGIEAPVVYLV 67
               +    +I+       +          ++ Q   +  +  D I+    + A  V   
Sbjct: 295 PPLSSAPAPSISEIPSTLPSVQAEILKTVSQLCQQSGDGSVPFDLIVQSVELSAGEVSGE 354

Query: 68  LLELDLAGRLCHHPEGKVS 86
           +L+L+L G +   P  + +
Sbjct: 355 ILQLELQGLVNQLPGMRYA 373


>gi|259418008|ref|ZP_05741927.1| DNA protecting protein DprA [Silicibacter sp. TrichCH4B]
 gi|259346914|gb|EEW58728.1| DNA protecting protein DprA [Silicibacter sp. TrichCH4B]
          Length = 382

 Score = 50.2 bits (119), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 14/84 (16%), Positives = 25/84 (29%)

Query: 2   VHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEA 61
           + P   +         +             T     +I   L   P     +I      A
Sbjct: 295 LPPMQMERAVRRPHINDLPSPPPERRSLRQTAALHQQILDRLAVAPTPEGQLIDDLDTPA 354

Query: 62  PVVYLVLLELDLAGRLCHHPEGKV 85
             +  VL +L+L+G +   P G +
Sbjct: 355 RKIRTVLTDLELSGEIGRGPGGVI 378


>gi|319405728|emb|CBI79351.1| DNA processing chain A [Bartonella sp. AR 15-3]
          Length = 383

 Score = 49.8 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 23/76 (30%), Positives = 40/76 (52%)

Query: 13  SQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELD 72
            Q + +    I           ER  +  +L++ PI +D +  ++G+    ++L+L+ELD
Sbjct: 307 PQGNAHSPNKITNETPLIGDDIERAAVLSALSSTPIDLDTLSIYSGVSLQKLHLLLIELD 366

Query: 73  LAGRLCHHPEGKVSLT 88
           LAG+L  H  G VSL+
Sbjct: 367 LAGKLIRHSGGYVSLS 382


>gi|311747458|ref|ZP_07721243.1| putative DNA processing protein DprA [Algoriphagus sp. PR1]
 gi|311302664|gb|EAZ79188.2| putative DNA processing protein DprA [Algoriphagus sp. PR1]
          Length = 373

 Score = 49.8 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 17/70 (24%), Positives = 23/70 (32%), Gaps = 1/70 (1%)

Query: 17  TNHTKNINITHYPEYTQCERVRIKQSLN-NVPIHIDDIIHHTGIEAPVVYLVLLELDLAG 75
               K             E V+I + L  N    ID+I   T I    +   LL L+  G
Sbjct: 300 PGEVKASKPKLDFSSRDAEEVKILKILQENGEAGIDEISFQTEIPIGQLSSKLLALEFEG 359

Query: 76  RLCHHPEGKV 85
            +   P  K 
Sbjct: 360 IVKSLPGKKY 369


>gi|314969050|gb|EFT13148.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL037PA1]
          Length = 252

 Score = 49.8 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 14/60 (23%), Positives = 24/60 (40%), Gaps = 1/60 (1%)

Query: 36 RVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMH-LPSP 94
          +  I  SL   P  +D ++  TG     +   L +L+  G+L     G   + +   P P
Sbjct: 7  QKMIINSLGTSPTSVDTLVELTGASPATIRRDLTDLEGHGQLRKVRGGAGGVNLRGTPMP 66


>gi|302386227|ref|YP_003822049.1| DNA protecting protein DprA [Clostridium saccharolyticum WM1]
 gi|302196855|gb|ADL04426.1| DNA protecting protein DprA [Clostridium saccharolyticum WM1]
          Length = 366

 Score = 49.8 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 11/44 (25%), Positives = 21/44 (47%)

Query: 36  RVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCH 79
              +   L+  P ++++II  +G+        LLEL+L G +  
Sbjct: 313 EKMVYSCLDLHPKNLEEIIALSGLSVSDCMSTLLELELKGCVVQ 356


>gi|254428234|ref|ZP_05041941.1| DNA protecting protein DprA, putative [Alcanivorax sp. DG881]
 gi|196194403|gb|EDX89362.1| DNA protecting protein DprA, putative [Alcanivorax sp. DG881]
          Length = 353

 Score = 49.8 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 10/50 (20%), Positives = 20/50 (40%)

Query: 38  RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
            +   L +    +D +   TG+  P +   L +L+L G +     G +  
Sbjct: 299 ALLAHLTSGLNSLDALQQRTGMPMPELAGQLADLELEGWVERVAGGYLKR 348


>gi|313676995|ref|YP_004054991.1| DNA protecting protein dpra [Marivirga tractuosa DSM 4126]
 gi|312943693|gb|ADR22883.1| DNA protecting protein DprA [Marivirga tractuosa DSM 4126]
          Length = 368

 Score = 49.8 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 13/74 (17%), Positives = 25/74 (33%), Gaps = 2/74 (2%)

Query: 17  TNHTKNINITHYPEYTQCERVRIKQSL--NNVPIHIDDIIHHTGIEAPVVYLVLLELDLA 74
            N                E   +  +L  NN  + ID +   + I    +  +LL L++ 
Sbjct: 295 ENQAAIKQKVLDLSSLNEEEQSVMNTLLQNNKELSIDILSIKSQINLNQLASILLNLEMQ 354

Query: 75  GRLCHHPEGKVSLT 88
           G +   P  +  + 
Sbjct: 355 GIIKSLPGKRYQVA 368


>gi|261491953|ref|ZP_05988530.1| SMF family Rossmann fold nucleotide-binding protein [Mannheimia
           haemolytica serotype A2 str. BOVINE]
 gi|261496244|ref|ZP_05992649.1| SMF family Rossmann fold nucleotide-binding protein [Mannheimia
           haemolytica serotype A2 str. OVINE]
 gi|261308075|gb|EEY09373.1| SMF family Rossmann fold nucleotide-binding protein [Mannheimia
           haemolytica serotype A2 str. OVINE]
 gi|261312420|gb|EEY13546.1| SMF family Rossmann fold nucleotide-binding protein [Mannheimia
           haemolytica serotype A2 str. BOVINE]
          Length = 381

 Score = 49.8 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 20/79 (25%), Positives = 31/79 (39%)

Query: 7   EQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYL 66
           E     S S      +      P      + +I Q ++  PI IDD+   T +    + +
Sbjct: 298 EPKPIVSTSLQAVKSSEKFAKNPPNLTACQQQIYQHISLEPIAIDDLARATELTIETLLV 357

Query: 67  VLLELDLAGRLCHHPEGKV 85
            LL L+LAG +     G V
Sbjct: 358 ELLGLELAGVIKQVSGGYV 376


>gi|323484746|ref|ZP_08090105.1| DNA processing protein DprA [Clostridium symbiosum WAL-14163]
 gi|323691814|ref|ZP_08106071.1| smf family protein [Clostridium symbiosum WAL-14673]
 gi|323401983|gb|EGA94322.1| DNA processing protein DprA [Clostridium symbiosum WAL-14163]
 gi|323504180|gb|EGB19985.1| smf family protein [Clostridium symbiosum WAL-14673]
          Length = 390

 Score = 49.8 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 8/44 (18%), Positives = 21/44 (47%)

Query: 36  RVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCH 79
              +   L++ P H++++I  + + +      LL L++ G +  
Sbjct: 336 EKMLYSCLDSQPKHVEELIKISKLPSGECMAALLRLEMDGFIMQ 379


>gi|257440568|ref|ZP_05616323.1| DNA processing protein DprA [Faecalibacterium prausnitzii A2-165]
 gi|257196891|gb|EEU95175.1| DNA processing protein DprA [Faecalibacterium prausnitzii A2-165]
          Length = 381

 Score = 49.8 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 12/82 (14%), Positives = 30/82 (36%)

Query: 6   IEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVY 65
              + F             +   P+       R+   +      ++++   +G+   ++ 
Sbjct: 299 KPSDLFGVLGLRGAAAPAVVRSAPDPMSETERRVLACIGPKAKGVEELGAASGLPTGLLL 358

Query: 66  LVLLELDLAGRLCHHPEGKVSL 87
             L++L+LAGR+   P  +  L
Sbjct: 359 GTLMKLELAGRVTCLPGKRYIL 380


>gi|313204519|ref|YP_004043176.1| DNA protecting protein dpra [Paludibacter propionicigenes WB4]
 gi|312443835|gb|ADQ80191.1| DNA protecting protein DprA [Paludibacter propionicigenes WB4]
          Length = 372

 Score = 49.8 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 7/59 (11%), Positives = 20/59 (33%), Gaps = 2/59 (3%)

Query: 31  YTQCERVRIKQSL--NNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
               E   +   L  +   + ++++          +  +LLE++  G +   P     +
Sbjct: 312 ELSDEEQTVVSVLRQHTDGLQLNELSILLEKPVSRISSMLLEMEFKGVVKCLPGNLYKI 370


>gi|296127436|ref|YP_003634688.1| DNA protecting protein DprA [Brachyspira murdochii DSM 12563]
 gi|296019252|gb|ADG72489.1| DNA protecting protein DprA [Brachyspira murdochii DSM 12563]
          Length = 426

 Score = 49.8 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 12/57 (21%), Positives = 25/57 (43%), Gaps = 1/57 (1%)

Query: 32  TQCERVRIKQSLN-NVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
              E   +   +  +  IHIDDI+  + I+      VL++L++ G +        ++
Sbjct: 368 LNNEETSLYNIIKKSDKIHIDDIVEESNIKVHTAASVLMQLEIKGIIKQLSGKYYTI 424


>gi|283798137|ref|ZP_06347290.1| DNA processing protein DprA [Clostridium sp. M62/1]
 gi|291074116|gb|EFE11480.1| DNA processing protein DprA [Clostridium sp. M62/1]
          Length = 364

 Score = 49.8 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 12/52 (23%), Positives = 21/52 (40%)

Query: 36  RVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
              +   L+  P H++ I+  +G+ A     VLL+L+L G            
Sbjct: 310 EKMVYSCLDLQPKHLEQIVTESGLPAGECTAVLLKLELDGFAVQTSNQYYVR 361


>gi|188586006|ref|YP_001917551.1| DNA protecting protein DprA [Natranaerobius thermophilus
           JW/NM-WN-LF]
 gi|179350693|gb|ACB84963.1| DNA protecting protein DprA [Natranaerobius thermophilus
           JW/NM-WN-LF]
          Length = 349

 Score = 49.8 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 14/54 (25%), Positives = 23/54 (42%), Gaps = 1/54 (1%)

Query: 32  TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
               +  I + +    I ID+++  T      +Y  LLEL+L G +     G V
Sbjct: 293 LSSSQKAILEKIPYYEISIDELLSSTN-TDKDIYTCLLELELNGWIMRRLGGYV 345


>gi|307564746|ref|ZP_07627274.1| DNA protecting protein DprA [Prevotella amnii CRIS 21A-A]
 gi|307346468|gb|EFN91777.1| DNA protecting protein DprA [Prevotella amnii CRIS 21A-A]
          Length = 376

 Score = 49.5 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 18/78 (23%), Positives = 33/78 (42%)

Query: 12  SSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLEL 71
           +S+ D    K I  T +P+ T+ E   I     +  + I+ +   +GI    +  +L  L
Sbjct: 298 TSKIDIARKKGIERTLFPDVTEEEERIITTLTKHNDLQINMLSIQSGIPFSKLTGLLFSL 357

Query: 72  DLAGRLCHHPEGKVSLTM 89
           ++ G +     G   L M
Sbjct: 358 EMKGIVKMLAGGIYHLYM 375


>gi|291166170|gb|EFE28216.1| Smf family protein [Filifactor alocis ATCC 35896]
          Length = 360

 Score = 49.5 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 14/58 (24%), Positives = 23/58 (39%), Gaps = 1/58 (1%)

Query: 32  TQCERVRIKQSLNN-VPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
                  I   L    PI+ID+I +   ++   V  +L  L++ G +        SLT
Sbjct: 301 LSEAEQNILSLLEKKSPIYIDEIAYTLQLQIKEVSSILSILEIKGFVLEMGNNLYSLT 358


>gi|295091717|emb|CBK77824.1| DNA protecting protein DprA [Clostridium cf. saccharolyticum K10]
          Length = 364

 Score = 49.5 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 12/52 (23%), Positives = 21/52 (40%)

Query: 36  RVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
              +   L+  P H++ I+  +G+ A     VLL+L+L G            
Sbjct: 310 EKMVYSCLDLQPKHLEQIVTESGLPAGECTAVLLKLELDGFAVQTSNQYYVR 361


>gi|163868294|ref|YP_001609503.1| DNA processing chain A [Bartonella tribocorum CIP 105476]
 gi|161017950|emb|CAK01508.1| DNA processing chain A [Bartonella tribocorum CIP 105476]
          Length = 404

 Score = 49.5 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 29/92 (31%), Positives = 43/92 (46%), Gaps = 7/92 (7%)

Query: 4   PQIEQNFFSSQSDT-------NHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHH 56
           P  + NFF   S         N     N           R  +  +L+  PI +D +  H
Sbjct: 302 PNSQLNFFEEPSSLKIEKENFNSAYEKNAHPSLTGDDAARAAVLSALSTTPIDLDTLSIH 361

Query: 57  TGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
           +G+  P +YL+L+EL+LAG+L  H  G VSL+
Sbjct: 362 SGVSLPTLYLLLVELELAGKLIRHSGGCVSLS 393


>gi|319898957|ref|YP_004159050.1| DNA processing chain A [Bartonella clarridgeiae 73]
 gi|319402921|emb|CBI76472.1| DNA processing chain A [Bartonella clarridgeiae 73]
          Length = 383

 Score = 49.5 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 25/64 (39%), Positives = 39/64 (60%), Gaps = 1/64 (1%)

Query: 32  TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHL 91
              ER  +  +L++ PI +D +  ++G+    +YL+L+ELDLAG+L  H  G VSL+  L
Sbjct: 316 DDIERAAVLAALSSTPIDLDTLSIYSGVPLQKLYLLLIELDLAGKLIRHSGGYVSLSS-L 374

Query: 92  PSPQ 95
             PQ
Sbjct: 375 DLPQ 378


>gi|291542637|emb|CBL15747.1| DNA protecting protein DprA [Ruminococcus bromii L2-63]
          Length = 419

 Score = 49.5 bits (117), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 10/46 (21%), Positives = 17/46 (36%)

Query: 37  VRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPE 82
             + + + N P+HID I     I    V   L  L++   +     
Sbjct: 368 QDVYEYIGNEPVHIDKISADLKIPVFKVLTALTMLEMKDLVSALQG 413


>gi|332879161|ref|ZP_08446862.1| DNA protecting protein DprA [Capnocytophaga sp. oral taxon 329 str.
           F0087]
 gi|332682961|gb|EGJ55857.1| DNA protecting protein DprA [Capnocytophaga sp. oral taxon 329 str.
           F0087]
          Length = 365

 Score = 49.5 bits (117), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 12/84 (14%), Positives = 27/84 (32%), Gaps = 1/84 (1%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLN-NVPIHIDDIIHHTGIEAPV 63
              Q+  ++    N                E V + + L  N  + +D +     I    
Sbjct: 281 LSAQDLINTLGWHNTPPKEVQQELFPTYTPEEVPVIEQLKKNGKMSLDSLSLACQIPVYQ 340

Query: 64  VYLVLLELDLAGRLCHHPEGKVSL 87
           +  +L +++L G +   P     +
Sbjct: 341 LSNLLFQMELKGYVHPLPGKMFEI 364


>gi|237717087|ref|ZP_04547568.1| smf protein DNA processing chain A [Bacteroides sp. D1]
 gi|262405855|ref|ZP_06082405.1| conserved hypothetical protein [Bacteroides sp. 2_1_22]
 gi|294647816|ref|ZP_06725368.1| DNA protecting protein DprA [Bacteroides ovatus SD CC 2a]
 gi|294806210|ref|ZP_06765057.1| DNA protecting protein DprA [Bacteroides xylanisolvens SD CC 1b]
 gi|229443070|gb|EEO48861.1| smf protein DNA processing chain A [Bacteroides sp. D1]
 gi|262356730|gb|EEZ05820.1| conserved hypothetical protein [Bacteroides sp. 2_1_22]
 gi|292636724|gb|EFF55190.1| DNA protecting protein DprA [Bacteroides ovatus SD CC 2a]
 gi|294446466|gb|EFG15086.1| DNA protecting protein DprA [Bacteroides xylanisolvens SD CC 1b]
          Length = 373

 Score = 49.5 bits (117), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 10/57 (17%), Positives = 22/57 (38%), Gaps = 1/57 (1%)

Query: 32  TQCERVRIKQSLNN-VPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
              E  ++ + L     + I+ ++    I    +  +L EL++ G +     G   L
Sbjct: 316 LSEEEQKVIEILEKRGDLQINTLVVEADIPVQKMNTILFELEMKGVVRVLVGGMYQL 372


>gi|150388066|ref|YP_001318115.1| DNA protecting protein DprA [Alkaliphilus metalliredigens QYMF]
 gi|149947928|gb|ABR46456.1| DNA protecting protein DprA [Alkaliphilus metalliredigens QYMF]
          Length = 378

 Score = 49.5 bits (117), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 14/65 (21%), Positives = 26/65 (40%)

Query: 20  TKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCH 79
                    P+       R+  +L   P  +  I+  T ++  V+  V+  L+L G++  
Sbjct: 308 AMEAMKIASPQVNTPTEQRVIDALFGTPKTMAQIVEETKLQQLVLLEVMTILELEGKISS 367

Query: 80  HPEGK 84
            P GK
Sbjct: 368 LPGGK 372


>gi|212703031|ref|ZP_03311159.1| hypothetical protein DESPIG_01069 [Desulfovibrio piger ATCC 29098]
 gi|212673619|gb|EEB34102.1| hypothetical protein DESPIG_01069 [Desulfovibrio piger ATCC 29098]
          Length = 432

 Score = 49.5 bits (117), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 16/83 (19%), Positives = 29/83 (34%), Gaps = 4/83 (4%)

Query: 7   EQNFFSSQSDTNHTKNINITHYPEYTQ---CERVRIKQSLNNV-PIHIDDIIHHTGIEAP 62
           E +  + + D    +          T      +  I   L    P+H+D +    G    
Sbjct: 347 ETDAPARKVDPGDGEGAPAQGTDGETDTAAPAQDNIVPLLREQGPLHVDALGAALGRSPA 406

Query: 63  VVYLVLLELDLAGRLCHHPEGKV 85
            +  VLL L++ GR+   P  + 
Sbjct: 407 ELAPVLLGLEIMGRIRRLPGARY 429


>gi|333029584|ref|ZP_08457645.1| DNA protecting protein DprA [Bacteroides coprosuis DSM 18011]
 gi|332740181|gb|EGJ70663.1| DNA protecting protein DprA [Bacteroides coprosuis DSM 18011]
          Length = 372

 Score = 49.5 bits (117), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 11/57 (19%), Positives = 22/57 (38%), Gaps = 1/57 (1%)

Query: 32  TQCERVRIKQSLN-NVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
              +   + + L     + ID+++    I    ++  L EL++ G L     G   L
Sbjct: 315 LNSQERNVIEMLQLRGDLQIDNLVVLCNIPIQTMHTTLFELEMKGVLKALAGGTYHL 371


>gi|295131961|ref|YP_003582637.1| Smf family protein [Zunongwangia profunda SM-A87]
 gi|294979976|gb|ADF50441.1| Smf family protein [Zunongwangia profunda SM-A87]
          Length = 366

 Score = 49.1 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 10/56 (17%), Positives = 17/56 (30%), Gaps = 1/56 (1%)

Query: 31  YTQCERVRIKQSLNNVPIH-IDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
               E  +I   L       +D I  +          +LL ++L G +   P    
Sbjct: 308 ELDEEEQQIYDLLKEKGKSQLDAIALYCDFPTFKTASILLNMELKGVIRPLPGKLF 363


>gi|270295207|ref|ZP_06201408.1| conserved hypothetical protein [Bacteroides sp. D20]
 gi|270274454|gb|EFA20315.1| conserved hypothetical protein [Bacteroides sp. D20]
          Length = 372

 Score = 49.1 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 17/78 (21%), Positives = 31/78 (39%), Gaps = 4/78 (5%)

Query: 14  QSDTNHTKNINITHYPEYTQCER--VRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLEL 71
                 T+ I    +PE T+ E   +RI     +  +HI+ ++    I    +  +L EL
Sbjct: 297 AEQPARTEGIQRNLFPELTEEEELVMRILMRQGD--LHINAMVVEADIPVNRMSALLFEL 354

Query: 72  DLAGRLCHHPEGKVSLTM 89
           ++ G +     G   L  
Sbjct: 355 EMKGVVKAMVGGVYHLLT 372


>gi|332981422|ref|YP_004462863.1| DNA protecting protein DprA [Mahella australiensis 50-1 BON]
 gi|332699100|gb|AEE96041.1| DNA protecting protein DprA [Mahella australiensis 50-1 BON]
          Length = 366

 Score = 49.1 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 11/49 (22%), Positives = 22/49 (44%), Gaps = 1/49 (2%)

Query: 35  ERVRIKQSLNNV-PIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPE 82
           E  R+ +   +  P+  +D+   + + A  V  VL  L++ G +   P 
Sbjct: 311 EEQRLLKFFQDSQPVSAEDLCVLSKMSAAKVNGVLTSLEIKGIIKQLPG 359


>gi|229496478|ref|ZP_04390192.1| Smf protein DNA processing chain A [Porphyromonas endodontalis ATCC
           35406]
 gi|229316375|gb|EEN82294.1| Smf protein DNA processing chain A [Porphyromonas endodontalis ATCC
           35406]
          Length = 368

 Score = 49.1 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 12/75 (16%), Positives = 23/75 (30%), Gaps = 3/75 (4%)

Query: 12  SSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLEL 71
            S      + +                I +      IH +D++   G+ A  +   L  L
Sbjct: 295 KSNGGEEESSSSLFVPQDLPDDPVLRLIVE---EETIHFNDLLMRLGMSAAELSNKLFTL 351

Query: 72  DLAGRLCHHPEGKVS 86
           +  G +   P G  +
Sbjct: 352 EFDGFIKPLPGGLYA 366


>gi|189464639|ref|ZP_03013424.1| hypothetical protein BACINT_00982 [Bacteroides intestinalis DSM
           17393]
 gi|189436913|gb|EDV05898.1| hypothetical protein BACINT_00982 [Bacteroides intestinalis DSM
           17393]
          Length = 372

 Score = 49.1 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 16/85 (18%), Positives = 32/85 (37%), Gaps = 2/85 (2%)

Query: 6   IEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVP-IHIDDIIHHTGIEAPVV 64
           IE   ++   +    + I    +PE    +   I   L     +H++ ++    I    +
Sbjct: 289 IEAMGWNPAGEPVKPEGIQRDLFPE-LSKDEECIVGILTRQGDLHVNALVVEADIPVNRM 347

Query: 65  YLVLLELDLAGRLCHHPEGKVSLTM 89
             +L EL++ G +     G   L M
Sbjct: 348 TGLLFELEMKGVVRAMVGGVYHLLM 372


>gi|170719275|ref|YP_001746963.1| DNA protecting protein DprA [Pseudomonas putida W619]
 gi|169757278|gb|ACA70594.1| DNA protecting protein DprA [Pseudomonas putida W619]
          Length = 365

 Score = 48.7 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 10/62 (16%), Positives = 20/62 (32%)

Query: 27  HYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
             P         +   L+  P   + +   + +    V   L EL+L GR+ +      +
Sbjct: 303 LPPAVVDKPSHPLLALLHAAPQTSEALAACSELPLAQVLAQLTELELEGRVTNEAGRWFA 362

Query: 87  LT 88
             
Sbjct: 363 RA 364


>gi|313673068|ref|YP_004051179.1| DNA protecting protein dpra [Calditerrivibrio nitroreducens DSM
           19672]
 gi|312939824|gb|ADR19016.1| DNA protecting protein DprA [Calditerrivibrio nitroreducens DSM
           19672]
          Length = 370

 Score = 48.7 bits (115), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 13/58 (22%), Positives = 23/58 (39%)

Query: 33  QCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMH 90
                +I   L   P  ID+I   +G  A  +  ++  ++L   +    +GK SL   
Sbjct: 310 DGNYAKIIDILMAGPATIDEICLKSGKSASDILAIITNMELEDIIYMGSDGKYSLNRR 367


>gi|332666158|ref|YP_004448946.1| DNA protecting protein DprA [Haliscomenobacter hydrossis DSM 1100]
 gi|332334972|gb|AEE52073.1| DNA protecting protein DprA [Haliscomenobacter hydrossis DSM 1100]
          Length = 364

 Score = 48.7 bits (115), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 12/58 (20%), Positives = 21/58 (36%), Gaps = 1/58 (1%)

Query: 31  YTQCERVRIKQSLNN-VPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
               E   I   L +     ID + + +      +  +LLEL+  G +   P  +  L
Sbjct: 306 ELSVEEKNIVNLLRHDEEKDIDALTYLSQKSNSEMATLLLELEFKGVIRALPGKRYVL 363


>gi|146298756|ref|YP_001193347.1| DNA protecting protein DprA [Flavobacterium johnsoniae UW101]
 gi|146153174|gb|ABQ04028.1| DNA protecting protein DprA [Flavobacterium johnsoniae UW101]
          Length = 366

 Score = 48.7 bits (115), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 9/59 (15%), Positives = 18/59 (30%), Gaps = 5/59 (8%)

Query: 32  TQCERVRIKQSL---NNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
              +  +I   L         +D I     +    +   LL ++L G +   P     +
Sbjct: 309 LNPDEQKIYDFLLKNGKE--LLDIIALECDLPIFKISGTLLNMELKGIIRPLPGKMFEV 365


>gi|126662793|ref|ZP_01733792.1| Smf protein DNA processing chain A [Flavobacteria bacterium BAL38]
 gi|126626172|gb|EAZ96861.1| Smf protein DNA processing chain A [Flavobacteria bacterium BAL38]
          Length = 358

 Score = 48.7 bits (115), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 10/58 (17%), Positives = 17/58 (29%), Gaps = 1/58 (1%)

Query: 31  YTQCERVRIKQSLNNVPIHI-DDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
               E   I   L      + D I          +  +LL ++L G +   P     +
Sbjct: 300 SLTEEEQLIYDYLQKTGKEMMDIIALECNFPIYRISSILLNMELKGVVRPLPGKMFEV 357


>gi|326334729|ref|ZP_08200936.1| SMF family DNA processing protein [Capnocytophaga sp. oral taxon
           338 str. F0234]
 gi|325693179|gb|EGD35111.1| SMF family DNA processing protein [Capnocytophaga sp. oral taxon
           338 str. F0234]
          Length = 369

 Score = 48.7 bits (115), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 12/73 (16%), Positives = 26/73 (35%), Gaps = 2/73 (2%)

Query: 16  DTNHTKNINITHYPEYTQCERVRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLLELDLA 74
           +    K I    + E    E  +I   L  +    +DD+          +  +L ++++ 
Sbjct: 296 EETSAKPIAAELFVE-LSEEEEKIITYLKEHGKQTLDDLSRECSFPIHKLSNLLFQIEMK 354

Query: 75  GRLCHHPEGKVSL 87
           G +   P    +L
Sbjct: 355 GIIRPLPGKVFAL 367


>gi|86607132|ref|YP_475895.1| DNA protecting protein DprA [Synechococcus sp. JA-3-3Ab]
 gi|86555674|gb|ABD00632.1| DNA protecting protein DprA [Synechococcus sp. JA-3-3Ab]
          Length = 381

 Score = 48.7 bits (115), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 11/69 (15%), Positives = 26/69 (37%)

Query: 20  TKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCH 79
           +           +  ++  + Q L N  + +D ++  T ++   +   LL ++L G L  
Sbjct: 312 SPPPEQPPSFGPSDPQQQLLWQLLGNEILSLDALVQATQMDIATLSSTLLLMELEGWLVQ 371

Query: 80  HPEGKVSLT 88
            P  +    
Sbjct: 372 LPGMRYQRA 380


>gi|225163857|ref|ZP_03726152.1| DNA protecting protein DprA [Opitutaceae bacterium TAV2]
 gi|224801538|gb|EEG19839.1| DNA protecting protein DprA [Opitutaceae bacterium TAV2]
          Length = 388

 Score = 48.7 bits (115), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 13/84 (15%), Positives = 26/84 (30%), Gaps = 1/84 (1%)

Query: 3   HPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIH-IDDIIHHTGIEA 61
            P   +   +           + T +      +  R+        +  ID +   TG+ A
Sbjct: 298 QPIPAKGSDAGDGGDTPAHVPSSTLFGGDLTDDEQRLLACFAGGAMPGIDTLTAQTGLPA 357

Query: 62  PVVYLVLLELDLAGRLCHHPEGKV 85
             V   L+ L+L   +    +G  
Sbjct: 358 HHVSSTLMMLELKRLIAKRADGTF 381


>gi|218133651|ref|ZP_03462455.1| hypothetical protein BACPEC_01520 [Bacteroides pectinophilus ATCC
          43243]
 gi|217991026|gb|EEC57032.1| hypothetical protein BACPEC_01520 [Bacteroides pectinophilus ATCC
          43243]
          Length = 78

 Score = 48.3 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 14/56 (25%), Positives = 22/56 (39%)

Query: 34 CERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTM 89
           E  ++  S+  +P  ID II  T +    V  +LL L+L   +           M
Sbjct: 18 SEEEKVYGSICLIPKSIDIIIEETHLTPLKVCEILLNLELKDMIEQVSHNYYVRKM 73


>gi|260591927|ref|ZP_05857385.1| putative DNA processing protein DprA [Prevotella veroralis F0319]
 gi|260536211|gb|EEX18828.1| putative DNA processing protein DprA [Prevotella veroralis F0319]
          Length = 372

 Score = 48.3 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 12/57 (21%), Positives = 23/57 (40%), Gaps = 1/57 (1%)

Query: 30  EYTQCERVRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
                E  RI ++L +N  + I+ +   T I    +  +L  L++ G +     G  
Sbjct: 312 PDLSPEEERIVRTLQSNNDLQINMLSVKTDIAISRLTGILFTLEMKGLIRAMAGGCY 368


>gi|167040338|ref|YP_001663323.1| DNA protecting protein DprA [Thermoanaerobacter sp. X514]
 gi|300914422|ref|ZP_07131738.1| DNA protecting protein DprA [Thermoanaerobacter sp. X561]
 gi|307724342|ref|YP_003904093.1| DNA protecting protein DprA [Thermoanaerobacter sp. X513]
 gi|166854578|gb|ABY92987.1| DNA protecting protein DprA [Thermoanaerobacter sp. X514]
 gi|300889357|gb|EFK84503.1| DNA protecting protein DprA [Thermoanaerobacter sp. X561]
 gi|307581403|gb|ADN54802.1| DNA protecting protein DprA [Thermoanaerobacter sp. X513]
          Length = 362

 Score = 48.3 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 12/55 (21%), Positives = 20/55 (36%)

Query: 31  YTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
               E   +   +   P  I++I  +  I+   V  +L  L L G +   P  K 
Sbjct: 303 PLTEEEKEVYDFICEAPRDIEEIAGYVKIKISKVNAILSSLMLKGMIEKLPGNKY 357


>gi|282858750|ref|ZP_06267903.1| DNA protecting protein DprA [Prevotella bivia JCVIHMP010]
 gi|282588499|gb|EFB93651.1| DNA protecting protein DprA [Prevotella bivia JCVIHMP010]
          Length = 376

 Score = 48.3 bits (114), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 14/73 (19%), Positives = 28/73 (38%)

Query: 15  SDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLA 74
            +  H K I  T +P  TQ E   +        + ++ +   +G+    +  +L  L++ 
Sbjct: 301 LEEAHQKGIERTLFPNLTQEEECVVAALTKQNDLQVNLLSIQSGVSISTLTGILFGLEMK 360

Query: 75  GRLCHHPEGKVSL 87
           G +     G   L
Sbjct: 361 GVVKMLAGGVYHL 373


>gi|325268282|ref|ZP_08134915.1| SMF family DNA processing protein [Prevotella multiformis DSM
           16608]
 gi|324989424|gb|EGC21374.1| SMF family DNA processing protein [Prevotella multiformis DSM
           16608]
          Length = 372

 Score = 48.3 bits (114), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 16/74 (21%), Positives = 25/74 (33%), Gaps = 2/74 (2%)

Query: 15  SDTNHTKNINITHYPEYTQCERVRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLLELDL 73
                 K I  T +P     E   +   L  N  + I+ +   T I    +  VL  L++
Sbjct: 298 LAQAQQKGIERTLFPH-LSPEENAVVHVLRQNNDLQINLLSVRTDIPISRLTGVLFTLEM 356

Query: 74  AGRLCHHPEGKVSL 87
            G +     G   L
Sbjct: 357 KGVIRAMAGGCYHL 370


>gi|104779339|ref|YP_605837.1| Smf protein, DNA processing chain A [Pseudomonas entomophila L48]
 gi|95108326|emb|CAK13020.1| putative Smf protein, DNA processing chain A [Pseudomonas
           entomophila L48]
          Length = 365

 Score = 48.3 bits (114), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 12/62 (19%), Positives = 22/62 (35%)

Query: 27  HYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
             P         +   L+  P   + + H +G+    V   L EL+L GR+ +      +
Sbjct: 303 LPPAVVDKPAHPLLALLHAAPQTSEGLAHSSGLPLAQVLASLTELELEGRVSNEAGRWFA 362

Query: 87  LT 88
             
Sbjct: 363 RA 364


>gi|323343753|ref|ZP_08083980.1| SMF family DNA processing protein [Prevotella oralis ATCC 33269]
 gi|323095572|gb|EFZ38146.1| SMF family DNA processing protein [Prevotella oralis ATCC 33269]
          Length = 375

 Score = 48.3 bits (114), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 11/74 (14%), Positives = 26/74 (35%), Gaps = 2/74 (2%)

Query: 15  SDTNHTKNINITHYPEYTQCERVRIKQSLNNV-PIHIDDIIHHTGIEAPVVYLVLLELDL 73
                   I    +P  T  E ++I + L     + I+ +   + +    +  +L  +++
Sbjct: 301 LQQTRKSGIERELFPNLTD-EELQIVKVLAKTNDLQINMLSVQSNLPIARLTALLFSMEM 359

Query: 74  AGRLCHHPEGKVSL 87
            G +     G   L
Sbjct: 360 KGVVKTLAGGVYHL 373


>gi|312115161|ref|YP_004012757.1| DNA protecting protein DprA [Rhodomicrobium vannielii ATCC 17100]
 gi|311220290|gb|ADP71658.1| DNA protecting protein DprA [Rhodomicrobium vannielii ATCC 17100]
          Length = 487

 Score = 48.3 bits (114), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 18/50 (36%), Positives = 24/50 (48%)

Query: 30  EYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCH 79
                    + Q L+  PI IDDI   TG +   V+  ++ LDLAGRL  
Sbjct: 428 ASLDATIASVMQLLSFSPIAIDDICRMTGKQTREVHAAIMSLDLAGRLER 477


>gi|315648145|ref|ZP_07901246.1| DNA protecting protein DprA [Paenibacillus vortex V453]
 gi|315276791|gb|EFU40134.1| DNA protecting protein DprA [Paenibacillus vortex V453]
          Length = 391

 Score = 47.9 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 14/87 (16%), Positives = 30/87 (34%), Gaps = 6/87 (6%)

Query: 7   EQNFFSSQSDTNHTKNINITHYPEYTQ------CERVRIKQSLNNVPIHIDDIIHHTGIE 60
           E + +  +  ++        H  E          +   I   L   P  +D++I  T  +
Sbjct: 304 EYDSWLPKEASDTYNKERQAHRQEQPDLQAGLTNDERHIYHMLEQGPGSLDEMIERTQWD 363

Query: 61  APVVYLVLLELDLAGRLCHHPEGKVSL 87
              ++ VLL L +  ++   P     +
Sbjct: 364 FGHLHSVLLSLIIKKQITQLPGAIYKI 390


>gi|330970345|gb|EGH70411.1| SMF protein [Pseudomonas syringae pv. aceris str. M302273PT]
          Length = 372

 Score = 47.9 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 12/71 (16%), Positives = 20/71 (28%), Gaps = 3/71 (4%)

Query: 18  NHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRL 77
               +      P         +   L+  P   + +    G   P V   L EL+L GR+
Sbjct: 304 APDSDPVTPAKPAPCD---HPLLALLHAAPHTSEGLSVSCGWPLPKVLAGLTELELDGRI 360

Query: 78  CHHPEGKVSLT 88
                   +  
Sbjct: 361 SCEAGRWFARA 371


>gi|226313080|ref|YP_002772974.1| smf protein [Brevibacillus brevis NBRC 100599]
 gi|226096028|dbj|BAH44470.1| putative smf protein [Brevibacillus brevis NBRC 100599]
          Length = 356

 Score = 47.9 bits (113), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 10/58 (17%), Positives = 23/58 (39%), Gaps = 1/58 (1%)

Query: 31  YTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVL-LELDLAGRLCHHPEGKVSL 87
               E   I +++    IH+D+++     +   +   L + L+  G +   P G  + 
Sbjct: 298 PLSNEEKAIVEAVTYDGIHLDELMSCLEKDQRKMLHQLVIRLEAKGAILALPGGYFAR 355


>gi|160880855|ref|YP_001559823.1| DNA protecting protein DprA [Clostridium phytofermentans ISDg]
 gi|160429521|gb|ABX43084.1| DNA protecting protein DprA [Clostridium phytofermentans ISDg]
          Length = 369

 Score = 47.9 bits (113), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 11/60 (18%), Positives = 24/60 (40%)

Query: 30  EYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTM 89
           E        +   L++  IH+++++  T +    +  VL EL+    +      +   TM
Sbjct: 310 EGLTEVEQLVYSFLSHEAIHVEELLMKTNLNQGQLLEVLFELESKQYVRMISGQQYVRTM 369


>gi|49475582|ref|YP_033623.1| DNA processing chain A [Bartonella henselae str. Houston-1]
 gi|49238389|emb|CAF27616.1| DNA processing chain A [Bartonella henselae str. Houston-1]
          Length = 410

 Score = 47.9 bits (113), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 36/57 (63%)

Query: 32  TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
            + ER  +  +L+  PI +D +  ++G+    +YL+L+EL+LAG+L  H  G VSL+
Sbjct: 343 DERERRAVLSALSTTPIDLDTLSTNSGVSLSNLYLLLVELELAGKLIRHSGGYVSLS 399


>gi|300727517|ref|ZP_07060908.1| DNA processing chain A [Prevotella bryantii B14]
 gi|299775220|gb|EFI71821.1| DNA processing chain A [Prevotella bryantii B14]
          Length = 375

 Score = 47.9 bits (113), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 11/59 (18%), Positives = 18/59 (30%), Gaps = 1/59 (1%)

Query: 30  EYTQCERVRIKQSLNNV-PIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
                E   I   L     +  + I   T I    +  +L  L++ G +     G   L
Sbjct: 315 PELNKEEQAIVNLLKKTNDLQTNIISVKTNIPINKLTSMLFTLEMKGVIKGLAGGMYHL 373


>gi|226324651|ref|ZP_03800169.1| hypothetical protein COPCOM_02436 [Coprococcus comes ATCC 27758]
 gi|225207099|gb|EEG89453.1| hypothetical protein COPCOM_02436 [Coprococcus comes ATCC 27758]
          Length = 365

 Score = 47.9 bits (113), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 10/57 (17%), Positives = 20/57 (35%)

Query: 32  TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
            + +   +   L   P  +DD+   TG+    V  + + L L G +    +      
Sbjct: 308 LETKENLVYSKLGLYPRGLDDLQRETGLTPQEVMGICVSLQLKGCIQERSKNYYVRA 364


>gi|283852862|ref|ZP_06370124.1| DNA protecting protein DprA [Desulfovibrio sp. FW1012B]
 gi|283571772|gb|EFC19770.1| DNA protecting protein DprA [Desulfovibrio sp. FW1012B]
          Length = 437

 Score = 47.9 bits (113), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 12/63 (19%), Positives = 22/63 (34%), Gaps = 1/63 (1%)

Query: 29  PEYTQCERVRIKQSLNNVP-IHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           P+        I   L +    HID +    G  +  V   L+ L++ G +   P    + 
Sbjct: 374 PDGLSDLEAAIAGLLGDGSKRHIDALATALGAPSGPVSQALVLLEMKGLVRKWPGMYYTR 433

Query: 88  TMH 90
            + 
Sbjct: 434 DVE 436


>gi|167031106|ref|YP_001666337.1| DNA protecting protein DprA [Pseudomonas putida GB-1]
 gi|166857594|gb|ABY96001.1| DNA protecting protein DprA [Pseudomonas putida GB-1]
          Length = 365

 Score = 47.9 bits (113), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 11/62 (17%), Positives = 21/62 (33%)

Query: 27  HYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
             P         +   L+  P   + + H + +    V   L EL+L GR+ +      +
Sbjct: 303 LPPAVVDRFEHPLLALLHAAPQTSESLAHCSELPLAEVLAQLTELELDGRVSNEAGRWFA 362

Query: 87  LT 88
             
Sbjct: 363 RA 364


>gi|71905661|ref|YP_283248.1| SMF protein [Dechloromonas aromatica RCB]
 gi|71845282|gb|AAZ44778.1| DNA protecting protein DprA [Dechloromonas aromatica RCB]
          Length = 358

 Score = 47.9 bits (113), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 14/66 (21%), Positives = 26/66 (39%)

Query: 22  NINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHP 81
           N          + +   I  +L + P  +DD++  T + A  +   LL L+L G +   P
Sbjct: 291 NAAPAADIPSDKADEGPILTALGHDPCSLDDLVERTTMSADQLLPELLTLELCGLIATLP 350

Query: 82  EGKVSL 87
             +   
Sbjct: 351 GNRYQR 356


>gi|315224924|ref|ZP_07866743.1| DNA protecting protein DprA [Capnocytophaga ochracea F0287]
 gi|314945037|gb|EFS97067.1| DNA protecting protein DprA [Capnocytophaga ochracea F0287]
          Length = 364

 Score = 47.9 bits (113), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 7/82 (8%), Positives = 22/82 (26%), Gaps = 1/82 (1%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSL-NNVPIHIDDIIHHTGIEAPV 63
              ++                         +   I   L  N    +D++     +    
Sbjct: 280 TSAKDLIYQLGWDTPAPKAVQQELFVTLSPKEETISAFLKANGKQSLDELALGCQMPIYQ 339

Query: 64  VYLVLLELDLAGRLCHHPEGKV 85
           +  +L ++++ G +   P  + 
Sbjct: 340 LSNLLFQMEIKGVIKPLPGKRF 361


>gi|120602206|ref|YP_966606.1| DNA protecting protein DprA [Desulfovibrio vulgaris DP4]
 gi|120562435|gb|ABM28179.1| DNA protecting protein DprA [Desulfovibrio vulgaris DP4]
          Length = 668

 Score = 47.9 bits (113), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 14/75 (18%), Positives = 26/75 (34%), Gaps = 1/75 (1%)

Query: 13  SQSDTNHTKNINITHYPEYTQCERVRIKQSLNN-VPIHIDDIIHHTGIEAPVVYLVLLEL 71
           S   T    +      P+       R+   L +    H+DD+     +    V   LL L
Sbjct: 592 SLRATARGVHAVNPDMPKEHGDPESRLLALLRDMGEAHVDDLCRALAMAPGDVSGTLLLL 651

Query: 72  DLAGRLCHHPEGKVS 86
           ++ G +   P  + +
Sbjct: 652 EVQGVVRRLPGMRYA 666


>gi|294055361|ref|YP_003549019.1| DNA protecting protein DprA [Coraliomargarita akajimensis DSM
           45221]
 gi|293614694|gb|ADE54849.1| DNA protecting protein DprA [Coraliomargarita akajimensis DSM
           45221]
          Length = 373

 Score = 47.9 bits (113), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 12/64 (18%), Positives = 25/64 (39%), Gaps = 2/64 (3%)

Query: 20  TKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCH 79
              +N T      + + +++ +      + ID +   TG  A  +   LL L+L   +  
Sbjct: 306 EGAVNPTVALSPDESDLLQVFR--GGSILSIDALSEQTGKPASTISAALLGLELKQLVAK 363

Query: 80  HPEG 83
             +G
Sbjct: 364 RSDG 367


>gi|315924786|ref|ZP_07921003.1| DNA processing protein DprA [Pseudoramibacter alactolyticus ATCC
           23263]
 gi|315621685|gb|EFV01649.1| DNA processing protein DprA [Pseudoramibacter alactolyticus ATCC
           23263]
          Length = 369

 Score = 47.9 bits (113), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 9/70 (12%), Positives = 23/70 (32%)

Query: 13  SQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELD 72
                  T +++          E   +   L    + +D ++  +G     +  +L+ L+
Sbjct: 292 PLQPAVKTPSVDAEAPAVTLSAEEAALYHWLQKGILTVDALVQVSGEPIQQINALLMMLE 351

Query: 73  LAGRLCHHPE 82
           L G +     
Sbjct: 352 LKGAVAVDYG 361


>gi|320108287|ref|YP_004183877.1| DNA protecting protein DprA [Terriglobus saanensis SP1PR4]
 gi|319926808|gb|ADV83883.1| DNA protecting protein DprA [Terriglobus saanensis SP1PR4]
          Length = 410

 Score = 47.5 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 12/60 (20%), Positives = 24/60 (40%), Gaps = 3/60 (5%)

Query: 32  TQCERVRIKQSLN-NVPIHIDDIIHHTG--IEAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
                 ++   L  +  I +D +I      + +  ++  L EL+LAG++   P      T
Sbjct: 350 LSTAEQKVYDLLRMDESIQLDLLIESLEGILPSAEIFNALFELELAGKVRQIPGKNYLRT 409


>gi|220929474|ref|YP_002506383.1| DNA protecting protein DprA [Clostridium cellulolyticum H10]
 gi|219999802|gb|ACL76403.1| DNA protecting protein DprA [Clostridium cellulolyticum H10]
          Length = 374

 Score = 47.5 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 10/56 (17%), Positives = 24/56 (42%)

Query: 32  TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
                ++I + + N   +ID+I+  +   A     +L  L++ G +  +P     +
Sbjct: 317 LSAGEIKILKVIFNGANNIDEILERSNFSAKDASSILFMLEMKGVIKQNPGKLFEV 372


>gi|288818476|ref|YP_003432824.1| DNA processing protein [Hydrogenobacter thermophilus TK-6]
 gi|288787876|dbj|BAI69623.1| DNA processing protein [Hydrogenobacter thermophilus TK-6]
 gi|308752066|gb|ADO45549.1| DNA protecting protein DprA [Hydrogenobacter thermophilus TK-6]
          Length = 337

 Score = 47.5 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 11/56 (19%), Positives = 22/56 (39%), Gaps = 2/56 (3%)

Query: 33  QCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
           + +   +   L   P   D++   +G++A  +   L E +L G+L         L 
Sbjct: 284 EAQEDFLLNLL-TTPKTFDELAILSGLDAKELTAKLTEYELLGKLRRI-GAYYRLA 337


>gi|213963472|ref|ZP_03391726.1| SMF family protein [Capnocytophaga sputigena Capno]
 gi|213953880|gb|EEB65208.1| SMF family protein [Capnocytophaga sputigena Capno]
          Length = 364

 Score = 47.5 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 8/82 (9%), Positives = 22/82 (26%), Gaps = 1/82 (1%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSL-NNVPIHIDDIIHHTGIEAPV 63
              ++     +                   +   +   L  N    +D++     I    
Sbjct: 280 TSAKDLIYLLNWDTPAPKAVQQELFIDLSPDEELVANYLKENGKQALDELALGCQIPIYQ 339

Query: 64  VYLVLLELDLAGRLCHHPEGKV 85
           +  +L +++L G +   P    
Sbjct: 340 LSNLLFQMELKGVINPLPGKMF 361


>gi|163786973|ref|ZP_02181420.1| DNA processing protein [Flavobacteriales bacterium ALC-1]
 gi|159876861|gb|EDP70918.1| DNA processing protein [Flavobacteriales bacterium ALC-1]
          Length = 367

 Score = 47.5 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 9/58 (15%), Positives = 20/58 (34%), Gaps = 1/58 (1%)

Query: 31  YTQCERVRIKQSLNNVPIHI-DDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
             + +   I   L +    + D I     +    +  +LL ++L G +   P     +
Sbjct: 309 ELEPDEKLIYNFLKDNDKELLDVIALRCEMPTYKIAGILLNMELKGVVRPLPGKLFEV 366


>gi|46580474|ref|YP_011282.1| DNA processing protein DprA [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|46449893|gb|AAS96542.1| DNA processing protein DprA, putative [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|311234216|gb|ADP87070.1| DNA protecting protein DprA [Desulfovibrio vulgaris RCH1]
          Length = 663

 Score = 47.5 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 14/75 (18%), Positives = 26/75 (34%), Gaps = 1/75 (1%)

Query: 13  SQSDTNHTKNINITHYPEYTQCERVRIKQSLNN-VPIHIDDIIHHTGIEAPVVYLVLLEL 71
           S   T    +      P+       R+   L +    H+DD+     +    V   LL L
Sbjct: 587 SLRATARGVHAVNPDMPKEHGDPESRLLALLRDMGEAHVDDLCRALAMAPGDVSGTLLLL 646

Query: 72  DLAGRLCHHPEGKVS 86
           ++ G +   P  + +
Sbjct: 647 EVQGVVRRLPGMRYA 661


>gi|209964829|ref|YP_002297744.1| DNA processing protein DprA, putative [Rhodospirillum centenum SW]
 gi|209958295|gb|ACI98931.1| DNA processing protein DprA, putative [Rhodospirillum centenum SW]
          Length = 381

 Score = 47.5 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 36/57 (63%)

Query: 31  YTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
             +  R  + ++L+  P+ +D+++    + A VV  VLLEL+LAGR+  HP G++SL
Sbjct: 324 ELERARALVLEALSPTPVLVDEVVRGCQLSAGVVLTVLLELELAGRVQRHPGGQISL 380


>gi|86135181|ref|ZP_01053763.1| Smf protein DNA processing chain A [Polaribacter sp. MED152]
 gi|85822044|gb|EAQ43191.1| Smf protein DNA processing chain A [Polaribacter sp. MED152]
          Length = 368

 Score = 47.5 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 11/57 (19%), Positives = 19/57 (33%), Gaps = 1/57 (1%)

Query: 32  TQCERVRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
                 +I   L       +D I     I    +  +LL+++L G L   P     +
Sbjct: 311 LNENEQKIYDLLFEKGQKLLDVIALECNIPIFQISSILLQMELKGVLRPLPGKMFEI 367


>gi|330901112|gb|EGH32531.1| SMF protein [Pseudomonas syringae pv. japonica str. M301072PT]
          Length = 372

 Score = 47.5 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 12/71 (16%), Positives = 21/71 (29%), Gaps = 3/71 (4%)

Query: 18  NHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRL 77
             + +      P         +   L+  P   + +    G   P V   L EL+L GR+
Sbjct: 304 APSVDPVTPAKPAPCD---HPLLALLHAAPHTSEGLSVSCGWPLPKVLAGLTELELDGRI 360

Query: 78  CHHPEGKVSLT 88
                   +  
Sbjct: 361 SCEAGRWFARA 371


>gi|330890230|gb|EGH22891.1| DNA processing protein DprA [Pseudomonas syringae pv. mori str.
           301020]
          Length = 372

 Score = 47.5 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 12/71 (16%), Positives = 20/71 (28%), Gaps = 3/71 (4%)

Query: 18  NHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRL 77
                      P         +   L+  P   + +   +G   P V   L EL+L GR+
Sbjct: 304 APGAPPETPAKPVPCD---HPLLALLHAAPHTSEGLSVSSGWPLPKVLAGLTELELDGRI 360

Query: 78  CHHPEGKVSLT 88
                   +  
Sbjct: 361 SCEAGRWFARA 371


>gi|298484629|ref|ZP_07002733.1| Rossmann fold nucleotide-binding protein Smf possibly involved in
           DNA uptake [Pseudomonas savastanoi pv. savastanoi NCPPB
           3335]
 gi|298160853|gb|EFI01870.1| Rossmann fold nucleotide-binding protein Smf possibly involved in
           DNA uptake [Pseudomonas savastanoi pv. savastanoi NCPPB
           3335]
          Length = 372

 Score = 47.5 bits (112), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 12/71 (16%), Positives = 20/71 (28%), Gaps = 3/71 (4%)

Query: 18  NHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRL 77
                      P         +   L+  P   + +   +G   P V   L EL+L GR+
Sbjct: 304 APGAPPETPAKPVPCD---HPLLALLHAAPHTSEGLSVSSGWPLPKVLAGLTELELDGRI 360

Query: 78  CHHPEGKVSLT 88
                   +  
Sbjct: 361 SCEAGRWFARA 371


>gi|163754748|ref|ZP_02161870.1| putative DNA processing Smf-like protein [Kordia algicida OT-1]
 gi|161325689|gb|EDP97016.1| putative DNA processing Smf-like protein [Kordia algicida OT-1]
          Length = 368

 Score = 47.1 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 9/55 (16%), Positives = 18/55 (32%), Gaps = 1/55 (1%)

Query: 32  TQCERVRIKQSLNNVPIHI-DDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
              E   I   L      + D I     +    +  +LL++++ G +   P    
Sbjct: 311 LSSEETIIHSYLQEKGQSVLDSIALACKLPIHKIAPLLLQMEMKGVVKPLPGKLF 365


>gi|298207288|ref|YP_003715467.1| Smf protein DNA processing chain A [Croceibacter atlanticus
           HTCC2559]
 gi|83849924|gb|EAP87792.1| Smf protein DNA processing chain A [Croceibacter atlanticus
           HTCC2559]
          Length = 366

 Score = 47.1 bits (111), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 11/58 (18%), Positives = 20/58 (34%), Gaps = 1/58 (1%)

Query: 31  YTQCERVRIKQSLNNVPI-HIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
                   I + L      HID I     + +  +  VLL +++ G +   P     +
Sbjct: 308 ELDDTEKTIYKYLQEQGKEHIDLIALGCNMPSYKIASVLLTMEMKGVIRPLPGKLFEV 365


>gi|326561730|gb|EGE12065.1| DNA protecting protein DprA [Moraxella catarrhalis 7169]
 gi|326569048|gb|EGE19117.1| DNA protecting protein DprA [Moraxella catarrhalis BC1]
 gi|326571737|gb|EGE21750.1| DNA protecting protein DprA [Moraxella catarrhalis BC8]
 gi|326571808|gb|EGE21814.1| DNA protecting protein DprA [Moraxella catarrhalis BC7]
          Length = 414

 Score = 47.1 bits (111), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 12/90 (13%), Positives = 32/90 (35%), Gaps = 9/90 (10%)

Query: 3   HPQIEQNF-----FSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHT 57
           HP    +       + ++  +H +  + +        +      +L N P  +D ++  +
Sbjct: 329 HPSQAPDTNTLVSPNPKTAAHHLQPASRSTCVPEHLAD----LYALMNEPCDLDQLVFSS 384

Query: 58  GIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
             +   +   L+EL++ G +         L
Sbjct: 385 QKDTGSLLAELMELEILGLIEQVGGRYGRL 414


>gi|308068644|ref|YP_003870249.1| Smf protein [Paenibacillus polymyxa E681]
 gi|305857923|gb|ADM69711.1| Smf protein [Paenibacillus polymyxa E681]
          Length = 395

 Score = 47.1 bits (111), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 17/76 (22%), Positives = 31/76 (40%)

Query: 12  SSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLEL 71
           SS +     K    +  PE    E  R+   L    + +D+++  T  +  +++ VLL L
Sbjct: 319 SSYNREQSLKLKEASKVPESETSEENRVILLLEQGTMTLDELLDATAWDFGLLHAVLLSL 378

Query: 72  DLAGRLCHHPEGKVSL 87
            +  R+      K  L
Sbjct: 379 IIKKRIAQLAGTKYKL 394


>gi|126439436|ref|YP_001057202.1| DNA protecting protein DprA [Burkholderia pseudomallei 668]
 gi|126218929|gb|ABN82435.1| DNA protecting protein DprA [Burkholderia pseudomallei 668]
          Length = 434

 Score = 47.1 bits (111), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 13/83 (15%), Positives = 34/83 (40%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVV 64
             E     ++   +                +  R+  ++   P+ ++ +   T + +  +
Sbjct: 330 LDEFGLDPARPVNSKRGAPTAASADADLDNDTRRLLDAIGYGPVPLELLAQRTSLPSGTL 389

Query: 65  YLVLLELDLAGRLCHHPEGKVSL 87
           + +LL+L+LAGR+   P G+ + 
Sbjct: 390 HRLLLQLELAGRVAALPGGRYTR 412


>gi|153815654|ref|ZP_01968322.1| hypothetical protein RUMTOR_01890 [Ruminococcus torques ATCC 27756]
 gi|317502440|ref|ZP_07960604.1| smf family protein [Lachnospiraceae bacterium 8_1_57FAA]
 gi|145847085|gb|EDK24003.1| hypothetical protein RUMTOR_01890 [Ruminococcus torques ATCC 27756]
 gi|316896178|gb|EFV18285.1| smf family protein [Lachnospiraceae bacterium 8_1_57FAA]
          Length = 357

 Score = 47.1 bits (111), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 12/74 (16%), Positives = 28/74 (37%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVV 64
            +    F  +   +  K        +  + +   +   L   P  +++I+  T +E   V
Sbjct: 274 LLSPEMFLEELGLSGKKTEKEGKNKKMLETQEELLYSCLGLYPKSVEEILKETKLEVRQV 333

Query: 65  YLVLLELDLAGRLC 78
             +L+ L+L G + 
Sbjct: 334 MEILVSLELRGYIR 347


>gi|126455418|ref|YP_001064441.1| DNA protecting protein DprA [Burkholderia pseudomallei 1106a]
 gi|242314805|ref|ZP_04813821.1| DNA protecting protein DprA [Burkholderia pseudomallei 1106b]
 gi|126229060|gb|ABN92600.1| DNA protecting protein DprA [Burkholderia pseudomallei 1106a]
 gi|242138044|gb|EES24446.1| DNA protecting protein DprA [Burkholderia pseudomallei 1106b]
          Length = 434

 Score = 47.1 bits (111), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 13/83 (15%), Positives = 34/83 (40%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVV 64
             E     ++   +                +  R+  ++   P+ ++ +   T + +  +
Sbjct: 330 LDEFGLDPARPVNSKRGAPTAASADADLDNDTRRLLDAIGYGPVPLELLAQRTSLPSGTL 389

Query: 65  YLVLLELDLAGRLCHHPEGKVSL 87
           + +LL+L+LAGR+   P G+ + 
Sbjct: 390 HRLLLQLELAGRVAALPGGRYTR 412


>gi|329118699|ref|ZP_08247400.1| SMF-family protein [Neisseria bacilliformis ATCC BAA-1200]
 gi|327465202|gb|EGF11486.1| SMF-family protein [Neisseria bacilliformis ATCC BAA-1200]
          Length = 422

 Score = 47.1 bits (111), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 13/81 (16%), Positives = 27/81 (33%)

Query: 7   EQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYL 66
             +     +      +       +    +   +  ++   P+H D +    G  A  ++ 
Sbjct: 340 RPSENIPAAAPTERPSEQTAAQAQTGGADANPLLAAMGYSPVHPDALAESLGRPAADIFA 399

Query: 67  VLLELDLAGRLCHHPEGKVSL 87
            LLEL+L GR+     G    
Sbjct: 400 ELLELELEGRVAAAAGGCYQR 420


>gi|224537324|ref|ZP_03677863.1| hypothetical protein BACCELL_02202 [Bacteroides cellulosilyticus
           DSM 14838]
 gi|224521055|gb|EEF90160.1| hypothetical protein BACCELL_02202 [Bacteroides cellulosilyticus
           DSM 14838]
          Length = 373

 Score = 47.1 bits (111), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 12/50 (24%), Positives = 22/50 (44%), Gaps = 2/50 (4%)

Query: 38  RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           RI     +  +HI+ ++  T I    +  +L EL++ G +     G   L
Sbjct: 323 RILTRQGD--LHINALVVETDIPINRMISLLFELEMKGVVKALVGGVYHL 370


>gi|225010380|ref|ZP_03700852.1| SMF family protein [Flavobacteria bacterium MS024-3C]
 gi|225005859|gb|EEG43809.1| SMF family protein [Flavobacteria bacterium MS024-3C]
          Length = 378

 Score = 47.1 bits (111), Expect = 9e-04,   Method: Composition-based stats.
 Identities = 15/53 (28%), Positives = 24/53 (45%), Gaps = 1/53 (1%)

Query: 34  CERVRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
            E   + Q L +N  +H+D +      E  V+Y  L+ L+L G + H P    
Sbjct: 323 AEESVLYQCLFSNGKMHVDQLASVLNWEIKVLYPCLMTLELKGGVRHLPGQFY 375


>gi|327399011|ref|YP_004339880.1| DNA protecting protein DprA [Hippea maritima DSM 10411]
 gi|327181640|gb|AEA33821.1| DNA protecting protein DprA [Hippea maritima DSM 10411]
          Length = 333

 Score = 47.1 bits (111), Expect = 9e-04,   Method: Composition-based stats.
 Identities = 12/65 (18%), Positives = 20/65 (30%), Gaps = 1/65 (1%)

Query: 21  KNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHH 80
           +    T            +  ++    I  D+I      +   V  VL +L L G +   
Sbjct: 267 EEAEKTESEVELSPLEKEVLNAMEGD-ITEDEIALKINRDIGEVSEVLFDLHLKGVVRLM 325

Query: 81  PEGKV 85
           P G  
Sbjct: 326 PNGSY 330


>gi|288801753|ref|ZP_06407195.1| DNA processing protein DprA [Prevotella melaninogenica D18]
 gi|288335795|gb|EFC74228.1| DNA processing protein DprA [Prevotella melaninogenica D18]
          Length = 372

 Score = 47.1 bits (111), Expect = 9e-04,   Method: Composition-based stats.
 Identities = 14/74 (18%), Positives = 27/74 (36%), Gaps = 2/74 (2%)

Query: 15  SDTNHTKNINITHYPEYTQCERVRIKQSLN-NVPIHIDDIIHHTGIEAPVVYLVLLELDL 73
            +    + I  T +P+    E   I + L  N  + I+ +     I    +  +L  L++
Sbjct: 298 LEQAQQRGIERTLFPD-LSSEEEAIVRVLAKNNDLQINLLSIQANIPIARLTGILFTLEM 356

Query: 74  AGRLCHHPEGKVSL 87
            G +     G   L
Sbjct: 357 KGVIRAMAGGCYHL 370


>gi|302344838|ref|YP_003813191.1| DNA protecting protein DprA [Prevotella melaninogenica ATCC 25845]
 gi|302149494|gb|ADK95756.1| DNA protecting protein DprA [Prevotella melaninogenica ATCC 25845]
          Length = 353

 Score = 47.1 bits (111), Expect = 9e-04,   Method: Composition-based stats.
 Identities = 14/72 (19%), Positives = 26/72 (36%), Gaps = 2/72 (2%)

Query: 17  TNHTKNINITHYPEYTQCERVRIKQSLN-NVPIHIDDIIHHTGIEAPVVYLVLLELDLAG 75
               + I  T +P+    E   I + L  N  + I+ +     I    +  +L  L++ G
Sbjct: 281 QAQQRGIERTLFPD-LSSEEEAIVRVLAKNNDLQINLLSIQANIPISRLTGILFTLEMKG 339

Query: 76  RLCHHPEGKVSL 87
            +     G   L
Sbjct: 340 VIRAMAGGCYHL 351


>gi|237740653|ref|ZP_04571134.1| smf protein [Fusobacterium sp. 2_1_31]
 gi|229422670|gb|EEO37717.1| smf protein [Fusobacterium sp. 2_1_31]
          Length = 283

 Score = 47.1 bits (111), Expect = 9e-04,   Method: Composition-based stats.
 Identities = 11/54 (20%), Positives = 23/54 (42%), Gaps = 1/54 (1%)

Query: 33  QCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
              +  I  SL++    +D I+  T I+   +   L+ L++ G +     G+  
Sbjct: 228 SKNQQLILDSLSSE-KSLDKILEETKIDQTEILSELINLEIMGLIKSIAGGRYK 280


>gi|302186430|ref|ZP_07263103.1| SMF protein [Pseudomonas syringae pv. syringae 642]
          Length = 372

 Score = 46.8 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 13/71 (18%), Positives = 20/71 (28%)

Query: 19  HTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLC 78
           H         P         +   L+  P   + +    G   P V   L EL+L GR+ 
Sbjct: 302 HVAPDIDPVTPAKPAPCDHPLLALLHAAPHTSEGLSVSCGWPLPKVLAGLTELELDGRIS 361

Query: 79  HHPEGKVSLTM 89
                  +   
Sbjct: 362 CEAGRWFARAT 372


>gi|167757715|ref|ZP_02429842.1| hypothetical protein CLOSCI_00045 [Clostridium scindens ATCC 35704]
 gi|167664597|gb|EDS08727.1| hypothetical protein CLOSCI_00045 [Clostridium scindens ATCC 35704]
          Length = 365

 Score = 46.8 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 11/81 (13%), Positives = 25/81 (30%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVV 64
              ++       +N     N     +  +     +   L   P  I  ++  TG+    +
Sbjct: 281 LSPEDLLMELEISNMNPGQNSDENKKMLESPENMVYSCLGLFPKSIGQLLEETGLCPKEL 340

Query: 65  YLVLLELDLAGRLCHHPEGKV 85
              L+ L+L G +    +   
Sbjct: 341 LERLITLELEGYIKEVSKNYY 361


>gi|332291882|ref|YP_004430491.1| DNA protecting protein DprA [Krokinobacter diaphorus 4H-3-7-5]
 gi|332169968|gb|AEE19223.1| DNA protecting protein DprA [Krokinobacter diaphorus 4H-3-7-5]
          Length = 367

 Score = 46.8 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 12/59 (20%), Positives = 23/59 (38%), Gaps = 1/59 (1%)

Query: 31  YTQCERVRIKQSLNNVPIHI-DDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
               E   + + LN     + D I  +  +    +  +LL+++L G +   P     LT
Sbjct: 309 ELTDEEKVVWRFLNENGKELMDIIALNCKLPTFKIASILLQMELKGVVRPLPGKLFELT 367


>gi|167900761|ref|ZP_02487966.1| DNA protecting protein DprA [Burkholderia pseudomallei NCTC 13177]
          Length = 396

 Score = 46.8 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 13/83 (15%), Positives = 34/83 (40%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVV 64
             E     ++   +                +  R+  ++   P+ ++ +   T + +  +
Sbjct: 292 LDEFGLDPARPVNSKRGAPTAASADADLDNDTRRLLDAIGYGPVPLELLAQRTSLPSGTL 351

Query: 65  YLVLLELDLAGRLCHHPEGKVSL 87
           + +LL+L+LAGR+   P G+ + 
Sbjct: 352 HRLLLQLELAGRVAALPGGRYTR 374


>gi|294011703|ref|YP_003545163.1| DNA processing protein [Sphingobium japonicum UT26S]
 gi|292675033|dbj|BAI96551.1| DNA processing protein [Sphingobium japonicum UT26S]
          Length = 360

 Score = 46.8 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 24/64 (37%), Positives = 35/64 (54%)

Query: 25  ITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGK 84
                +  + ER  +   L   P+ +D++I  +G+   VV  VLLEL+LA RL  H  GK
Sbjct: 297 EPPSGDVAERERASVVALLGPAPVPVDELIRLSGLGPAVVQTVLLELELAARLERHAGGK 356

Query: 85  VSLT 88
           VSL+
Sbjct: 357 VSLS 360


>gi|325272508|ref|ZP_08138886.1| DNA protecting protein DprA [Pseudomonas sp. TJI-51]
 gi|324102369|gb|EGB99837.1| DNA protecting protein DprA [Pseudomonas sp. TJI-51]
          Length = 285

 Score = 46.8 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 11/62 (17%), Positives = 21/62 (33%)

Query: 27  HYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
             P         +   L+  P   + + H + +    V   L EL+L GR+ +      +
Sbjct: 223 LPPAVVDKFDHPLLALLHAAPQTSESLAHCSELPLAEVLAQLTELELEGRVSNEAGRWFA 282

Query: 87  LT 88
             
Sbjct: 283 RA 284


>gi|329929328|ref|ZP_08283081.1| DNA protecting protein DprA [Paenibacillus sp. HGF5]
 gi|328936697|gb|EGG33140.1| DNA protecting protein DprA [Paenibacillus sp. HGF5]
          Length = 391

 Score = 46.8 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 11/71 (15%), Positives = 23/71 (32%)

Query: 17  TNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGR 76
                             +  +I   L   P  +D++I  T  +   ++ VLL L +  +
Sbjct: 320 ERRAPRQERPDELAGLTNDERQIYHMLEQGPGSLDEMIERTRWDFGHLHSVLLSLIIKKQ 379

Query: 77  LCHHPEGKVSL 87
           +   P     +
Sbjct: 380 ITQLPGAIYKI 390


>gi|288929781|ref|ZP_06423624.1| DNA processing protein DprA [Prevotella sp. oral taxon 317 str.
           F0108]
 gi|288328882|gb|EFC67470.1| DNA processing protein DprA [Prevotella sp. oral taxon 317 str.
           F0108]
          Length = 375

 Score = 46.8 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 13/72 (18%), Positives = 26/72 (36%), Gaps = 2/72 (2%)

Query: 17  TNHTKNINITHYPEYTQCERVRIKQSLNN-VPIHIDDIIHHTGIEAPVVYLVLLELDLAG 75
               + I    +P+    E   + Q+L       I+ +     I    + ++L +L++ G
Sbjct: 303 QATRQGIERQLFPQ-LSGEEQAVVQALQKLNDQPINQLSLTANIPISQLTVLLFQLEMKG 361

Query: 76  RLCHHPEGKVSL 87
            L     G   L
Sbjct: 362 LLKLLAGGSYHL 373


>gi|254182255|ref|ZP_04888852.1| DNA protecting protein DprA [Burkholderia pseudomallei 1655]
 gi|184212793|gb|EDU09836.1| DNA protecting protein DprA [Burkholderia pseudomallei 1655]
          Length = 434

 Score = 46.8 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 13/83 (15%), Positives = 34/83 (40%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVV 64
             E     ++   +                +  R+  ++   P+ ++ +   T + +  +
Sbjct: 330 LDEFGLDPARPVNSKRGAPTAASADADLDNDMRRLLDAIGYGPVPLELLAQRTSLPSGTL 389

Query: 65  YLVLLELDLAGRLCHHPEGKVSL 87
           + +LL+L+LAGR+   P G+ + 
Sbjct: 390 HRLLLQLELAGRVAALPGGRYTR 412


>gi|303326956|ref|ZP_07357398.1| DNA processing protein DprA [Desulfovibrio sp. 3_1_syn3]
 gi|302862944|gb|EFL85876.1| DNA processing protein DprA [Desulfovibrio sp. 3_1_syn3]
          Length = 444

 Score = 46.8 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 10/73 (13%), Positives = 23/73 (31%), Gaps = 3/73 (4%)

Query: 14  QSDTNHTKNINITHYPEYTQCERVRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLLELD 72
                    +         + ER  +   L    P+  D +     +    +  +L+ L+
Sbjct: 370 PPIPVEIPCVEAEALVPPDRKER--LLHCLRGQGPMQADALAVALDMPIHELNALLIGLE 427

Query: 73  LAGRLCHHPEGKV 85
           + GR+   P  + 
Sbjct: 428 MLGRVKRLPGARY 440


>gi|297544718|ref|YP_003677020.1| DNA protecting protein DprA [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
 gi|296842493|gb|ADH61009.1| DNA protecting protein DprA [Thermoanaerobacter mathranii subsp.
           mathranii str. A3]
          Length = 362

 Score = 46.8 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 13/56 (23%), Positives = 21/56 (37%)

Query: 30  EYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
                E   +   +   P  I++I  H  I+   V ++L  L L G +   P  K 
Sbjct: 302 SSLTEEEKEVYDFICEAPRDIEEIAGHVKIKISKVNVILSSLMLKGMIEKLPGNKY 357


>gi|87300983|ref|ZP_01083825.1| putative DNA processing protein (Smf family protein) [Synechococcus
           sp. WH 5701]
 gi|87284854|gb|EAQ76806.1| putative DNA processing protein (Smf family protein) [Synechococcus
           sp. WH 5701]
          Length = 396

 Score = 46.8 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 13/82 (15%), Positives = 26/82 (31%), Gaps = 4/82 (4%)

Query: 1   MVHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIE 60
           ++           Q+ T    + +       T      +  +L      ++ +    G  
Sbjct: 308 LIAQLGAGPLGRPQATTTTAASPSPAT---PTGAPDQALLAALGQGA-SLEQLAQALGRS 363

Query: 61  APVVYLVLLELDLAGRLCHHPE 82
              +   LL L+LAGR+   P 
Sbjct: 364 GAELATQLLHLELAGRVRAEPG 385


>gi|261400041|ref|ZP_05986166.1| putative DNA processing protein DprA [Neisseria lactamica ATCC
           23970]
 gi|269210264|gb|EEZ76719.1| putative DNA processing protein DprA [Neisseria lactamica ATCC
           23970]
          Length = 397

 Score = 46.8 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 15/84 (17%), Positives = 27/84 (32%)

Query: 4   PQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPV 63
           P+       +      +    +             I   +   P+H D +     + A  
Sbjct: 311 PEKRITAVQTAYAPPPSPEGKMPSEGAACGTAHGSILDKMGFDPVHPDVLAGQLAMPAAD 370

Query: 64  VYLVLLELDLAGRLCHHPEGKVSL 87
           +Y  LLEL+L G +   P G+   
Sbjct: 371 LYAALLELELDGSVAAMPGGRYQR 394


>gi|289578442|ref|YP_003477069.1| DNA protecting protein DprA [Thermoanaerobacter italicus Ab9]
 gi|289528155|gb|ADD02507.1| DNA protecting protein DprA [Thermoanaerobacter italicus Ab9]
          Length = 362

 Score = 46.8 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 13/55 (23%), Positives = 21/55 (38%)

Query: 31  YTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
               E   +   +   P  I++I  H  I+   V ++L  L L G +   P  K 
Sbjct: 303 SLTEEEKEVYDFICEAPRDIEEIAGHVKIKISKVNVILSSLMLKGMIEKLPGNKY 357


>gi|260910931|ref|ZP_05917572.1| conserved hypothetical protein [Prevotella sp. oral taxon 472 str.
           F0295]
 gi|260634922|gb|EEX52971.1| conserved hypothetical protein [Prevotella sp. oral taxon 472 str.
           F0295]
          Length = 375

 Score = 46.8 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 13/72 (18%), Positives = 26/72 (36%), Gaps = 2/72 (2%)

Query: 17  TNHTKNINITHYPEYTQCERVRIKQSLNNV-PIHIDDIIHHTGIEAPVVYLVLLELDLAG 75
               + I    +P+    E   + Q+L       I+ +     I    + ++L +L++ G
Sbjct: 303 QATRQGIERQLFPQ-LSNEEQAVVQALEKQNDQAINQLSLTANIPISRLTVLLFQLEMKG 361

Query: 76  RLCHHPEGKVSL 87
            L     G   L
Sbjct: 362 ILKLLAGGCYHL 373


>gi|332519518|ref|ZP_08395985.1| SMF family protein [Lacinutrix algicola 5H-3-7-4]
 gi|332045366|gb|EGI81559.1| SMF family protein [Lacinutrix algicola 5H-3-7-4]
          Length = 367

 Score = 46.8 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 10/58 (17%), Positives = 20/58 (34%), Gaps = 1/58 (1%)

Query: 31  YTQCERVRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
                   I   L +N    +D I  +  +    +  +LL ++L G +   P     +
Sbjct: 309 ELDANEKVIYNYLKDNDKQMLDVIALNCNMPIYKLAGILLNMELKGIVRPLPGKLFEV 366


>gi|219871700|ref|YP_002476075.1| Smf protein, Rossmann fold nucleotide-binding protein involved in
           DNA uptake [Haemophilus parasuis SH0165]
 gi|219691904|gb|ACL33127.1| Smf protein, Rossmann fold nucleotide-binding protein involved in
           DNA uptake [Haemophilus parasuis SH0165]
          Length = 375

 Score = 46.8 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 15/81 (18%), Positives = 30/81 (37%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVV 64
            I+ + F ++                     + ++ + ++  PI IDD+   T +     
Sbjct: 293 HIQPSLFDTKPKQAVKSEPKFAKNLPELTACQQQLFEQISLEPISIDDLAKATDMAVETA 352

Query: 65  YLVLLELDLAGRLCHHPEGKV 85
            + LL L+L G +     G V
Sbjct: 353 LIELLNLELLGVVKQVSGGYV 373


>gi|167843766|ref|ZP_02469274.1| DNA protecting protein DprA [Burkholderia pseudomallei B7210]
          Length = 396

 Score = 46.8 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 13/83 (15%), Positives = 34/83 (40%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVV 64
             E     ++   +                +  R+  ++   P+ ++ +   T + +  +
Sbjct: 292 LDEFGLDPARPVNSKRGAPTAASADADLDNDTRRLLDAIGYGPVPLELLAQRTSLPSGTL 351

Query: 65  YLVLLELDLAGRLCHHPEGKVSL 87
           + +LL+L+LAGR+   P G+ + 
Sbjct: 352 HRLLLQLELAGRVAALPGGRYTR 374


>gi|284044019|ref|YP_003394359.1| DeoR family transcriptional regulator [Conexibacter woesei DSM
          14684]
 gi|283948240|gb|ADB50984.1| transcriptional regulator, DeoR family [Conexibacter woesei DSM
          14684]
          Length = 254

 Score = 46.8 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 17/59 (28%), Positives = 24/59 (40%), Gaps = 1/59 (1%)

Query: 36 RVRIKQSLNNV-PIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHLPS 93
          + RI ++L    P  +  +    G+    V   LLEL+  GRL     G VS   H   
Sbjct: 7  QDRIARTLRAEGPAAVSTLAERLGVSQATVRRDLLELERQGRLTRVYGGAVSSAEHDEP 65


>gi|256425884|ref|YP_003126537.1| DNA protecting protein DprA [Chitinophaga pinensis DSM 2588]
 gi|256040792|gb|ACU64336.1| DNA protecting protein DprA [Chitinophaga pinensis DSM 2588]
          Length = 378

 Score = 46.8 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 11/56 (19%), Positives = 23/56 (41%)

Query: 32  TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
              E+  +     +   HID++   + +    V  ++L+L++   L   P  K  L
Sbjct: 321 DDAEKHIVTLFSGDAEKHIDELRKESHLPGSQVNSLVLKLEMRHVLKSLPGQKYQL 376


>gi|294671201|ref|ZP_06736055.1| hypothetical protein NEIELOOT_02909 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291307139|gb|EFE48382.1| hypothetical protein NEIELOOT_02909 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 405

 Score = 46.4 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 15/67 (22%), Positives = 25/67 (37%)

Query: 21  KNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHH 80
           +       P     +   + + +   PIH D +       A  +Y  LLEL+L G +   
Sbjct: 337 RPSETPLPPATASNDAAALLEKMGYGPIHPDTLAEQLNKNAADIYAALLELELGGLVAAM 396

Query: 81  PEGKVSL 87
           P G+   
Sbjct: 397 PGGRYQR 403


>gi|327403562|ref|YP_004344400.1| DNA protecting protein DprA [Fluviicola taffensis DSM 16823]
 gi|327319070|gb|AEA43562.1| DNA protecting protein DprA [Fluviicola taffensis DSM 16823]
          Length = 367

 Score = 46.4 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 10/58 (17%), Positives = 20/58 (34%), Gaps = 1/58 (1%)

Query: 31  YTQCERVRIKQSLNN-VPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
                  +I   +     + +D I + + +    V   LL L+  G +   P  +  L
Sbjct: 308 ELNPREEKIVSVMQTKTELTLDTIGYLSSLTVSEVSSDLLSLEFKGLVRSLPGRRFQL 365


>gi|182625879|ref|ZP_02953645.1| DNA protecting protein DprA [Clostridium perfringens D str.
           JGS1721]
 gi|177908913|gb|EDT71405.1| DNA protecting protein DprA [Clostridium perfringens D str.
           JGS1721]
          Length = 360

 Score = 46.4 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 16/56 (28%), Positives = 24/56 (42%)

Query: 30  EYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
           E        +   L N  +HIDDII  T I+  ++Y +L EL    ++   P    
Sbjct: 301 EENSEINQLLLSILENNILHIDDIIRVTNIDTSIIYELLCELQFENKIEVIPGDYY 356


>gi|168215353|ref|ZP_02640978.1| DNA protecting protein DprA [Clostridium perfringens CPE str.
           F4969]
 gi|170713271|gb|EDT25453.1| DNA protecting protein DprA [Clostridium perfringens CPE str.
           F4969]
          Length = 360

 Score = 46.4 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 16/56 (28%), Positives = 24/56 (42%)

Query: 30  EYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
           E        +   L N  +HIDDII  T I+  ++Y +L EL    ++   P    
Sbjct: 301 EENSEINQLLLSILENNILHIDDIIRVTNIDTSIIYELLCELQFENKIEVIPGDYY 356


>gi|168210690|ref|ZP_02636315.1| DNA protecting protein DprA [Clostridium perfringens B str. ATCC
           3626]
 gi|170711272|gb|EDT23454.1| DNA protecting protein DprA [Clostridium perfringens B str. ATCC
           3626]
          Length = 211

 Score = 46.4 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 16/56 (28%), Positives = 24/56 (42%)

Query: 30  EYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
           E        +   L N  +HIDDII  T I+  ++Y +L EL    ++   P    
Sbjct: 152 EENSEINQLLLSILENNILHIDDIIRVTNIDTSIIYELLCELQFENKIEVIPGDYY 207


>gi|168207946|ref|ZP_02633951.1| DNA protecting protein DprA [Clostridium perfringens E str.
           JGS1987]
 gi|170660755|gb|EDT13438.1| DNA protecting protein DprA [Clostridium perfringens E str.
           JGS1987]
          Length = 360

 Score = 46.4 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 16/56 (28%), Positives = 24/56 (42%)

Query: 30  EYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
           E        +   L N  +HIDDII  T I+  ++Y +L EL    ++   P    
Sbjct: 301 EENSEINQLLLSILENNILHIDDIIRVTNIDTSIIYELLCELQFENKIEVIPGDYY 356


>gi|110803784|ref|YP_698990.1| DNA protecting protein DprA [Clostridium perfringens SM101]
 gi|110684285|gb|ABG87655.1| DNA protecting protein DprA [Clostridium perfringens SM101]
          Length = 360

 Score = 46.4 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 16/56 (28%), Positives = 24/56 (42%)

Query: 30  EYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
           E        +   L N  +HIDDII  T I+  ++Y +L EL    ++   P    
Sbjct: 301 EENSEINQLLLSILENNILHIDDIIRVTNIDTSIIYELLCELQFENKIEVIPGDYY 356


>gi|110799380|ref|YP_696390.1| DNA protecting protein DprA [Clostridium perfringens ATCC 13124]
 gi|168216990|ref|ZP_02642615.1| DNA protecting protein DprA [Clostridium perfringens NCTC 8239]
 gi|110674027|gb|ABG83014.1| DNA protecting protein DprA [Clostridium perfringens ATCC 13124]
 gi|182380904|gb|EDT78383.1| DNA protecting protein DprA [Clostridium perfringens NCTC 8239]
          Length = 360

 Score = 46.4 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 16/56 (28%), Positives = 24/56 (42%)

Query: 30  EYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
           E        +   L N  +HIDDII  T I+  ++Y +L EL    ++   P    
Sbjct: 301 EENSEINQLLLSILENNILHIDDIIRVTNIDTSIIYELLCELQFENKIEVIPGDYY 356


>gi|18310685|ref|NP_562619.1| DNA protecting protein DprA [Clostridium perfringens str. 13]
 gi|18145366|dbj|BAB81409.1| Smf protein DNA processing chain A [Clostridium perfringens str.
           13]
          Length = 360

 Score = 46.4 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 16/56 (28%), Positives = 24/56 (42%)

Query: 30  EYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
           E        +   L N  +HIDDII  T I+  ++Y +L EL    ++   P    
Sbjct: 301 EENSEINQLLLSILENNILHIDDIIRVTNIDTSIIYELLCELQFENKIEVIPGDYY 356


>gi|189485676|ref|YP_001956617.1| DprA-like DNA processing protein [uncultured Termite group 1
           bacterium phylotype Rs-D17]
 gi|170287635|dbj|BAG14156.1| DprA-like DNA processing protein [uncultured Termite group 1
           bacterium phylotype Rs-D17]
          Length = 364

 Score = 46.4 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 12/73 (16%), Positives = 22/73 (30%), Gaps = 2/73 (2%)

Query: 18  NHTKNINITHYPEYTQCERVRIKQSLNNVP--IHIDDIIHHTGIEAPVVYLVLLELDLAG 75
                I+ T+         + +   + N    +  D I     I       VLL+L++ G
Sbjct: 291 TSKDKISKTNKLPSLDKLELEVLSLIENDSAGLPPDLIAQKLNIGISETAPVLLKLEING 350

Query: 76  RLCHHPEGKVSLT 88
            +   P       
Sbjct: 351 LIKTTPGQIYVRA 363


>gi|261878856|ref|ZP_06005283.1| conserved hypothetical protein [Prevotella bergensis DSM 17361]
 gi|270334535|gb|EFA45321.1| conserved hypothetical protein [Prevotella bergensis DSM 17361]
          Length = 377

 Score = 46.4 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 11/59 (18%), Positives = 22/59 (37%), Gaps = 1/59 (1%)

Query: 30  EYTQCERVRIKQSLNN-VPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
                E  ++   L     I ++ I   T I    +  +LL +++ G +  +  G   L
Sbjct: 317 PDLSPEEAKVVALLRKMNDIQLNIISVRTDIPVGKLTSLLLGMEMKGIVKPYAGGTYHL 375


>gi|152994061|ref|YP_001338896.1| DNA protecting protein DprA [Marinomonas sp. MWYL1]
 gi|150834985|gb|ABR68961.1| DNA protecting protein DprA [Marinomonas sp. MWYL1]
          Length = 442

 Score = 46.4 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 13/52 (25%), Positives = 25/52 (48%), Gaps = 2/52 (3%)

Query: 29  PEYTQCERVRIKQSLNNV--PIHIDDIIHHTGIEAPVVYLVLLELDLAGRLC 78
           PE T      +   +     P+  D +I  + ++A ++  VL+EL+L G + 
Sbjct: 382 PESTSDNAKAVIAIMEQEAQPMDFDALIRQSKMDAGLMMQVLMELELYGCVE 433


>gi|146305098|ref|YP_001185563.1| DNA protecting protein DprA [Pseudomonas mendocina ymp]
 gi|145573299|gb|ABP82831.1| DNA protecting protein DprA [Pseudomonas mendocina ymp]
          Length = 368

 Score = 46.4 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 13/74 (17%), Positives = 25/74 (33%), Gaps = 3/74 (4%)

Query: 14  QSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDL 73
           +     +        P     E+  +   L+  P   + + H +G     V   L EL+L
Sbjct: 296 RGWQTPSGQQASAAQP---GAEQHPLLTLLHAAPHSSEALAHSSGWPLAQVLAALTELEL 352

Query: 74  AGRLCHHPEGKVSL 87
            G +C      ++ 
Sbjct: 353 DGLVCCEAGRWLAR 366


>gi|167855660|ref|ZP_02478418.1| Protein smf (DNA-processing chain A) [Haemophilus parasuis 29755]
 gi|167853232|gb|EDS24488.1| Protein smf (DNA-processing chain A) [Haemophilus parasuis 29755]
          Length = 375

 Score = 46.4 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 15/81 (18%), Positives = 31/81 (38%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVV 64
            I+ + F ++       +             + ++ + ++  PI IDD+   T +     
Sbjct: 293 HIQPSLFDTKPKQAVKSDPKFAKNLPELTACQQQLFEQISLEPISIDDLAKATDMAVETT 352

Query: 65  YLVLLELDLAGRLCHHPEGKV 85
            + LL L+L G +     G V
Sbjct: 353 LIELLNLELLGVVKQVSGGYV 373


>gi|326560687|gb|EGE11055.1| DNA protecting protein DprA [Moraxella catarrhalis 46P47B1]
 gi|326573495|gb|EGE23461.1| DNA protecting protein DprA [Moraxella catarrhalis O35E]
 gi|326574348|gb|EGE24291.1| DNA protecting protein DprA [Moraxella catarrhalis CO72]
          Length = 414

 Score = 46.4 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 12/90 (13%), Positives = 32/90 (35%), Gaps = 9/90 (10%)

Query: 3   HPQIEQNF-----FSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHT 57
           HP    +       + ++  +H +  + +        +      +L N P  +D ++  +
Sbjct: 329 HPSQAPDTNTLASPNPKTAVHHLQPASRSTCVPEHLAD----LYALMNEPCDLDQLVFSS 384

Query: 58  GIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
             +   +   L+EL++ G +         L
Sbjct: 385 QKDTGSLLAELMELEILGLIEQVGGRYGRL 414


>gi|296114104|ref|YP_003628042.1| DNA protecting protein DprA [Moraxella catarrhalis RH4]
 gi|295921798|gb|ADG62149.1| DNA protecting protein DprA [Moraxella catarrhalis RH4]
          Length = 414

 Score = 46.4 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 12/90 (13%), Positives = 32/90 (35%), Gaps = 9/90 (10%)

Query: 3   HPQIEQNF-----FSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHT 57
           HP    +       + ++  +H +  + +        +      +L N P  +D ++  +
Sbjct: 329 HPSQAPDTNTLASPNPKTAVHHLQPASRSTCVPEHLAD----LYALMNEPCDLDQLVFSS 384

Query: 58  GIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
             +   +   L+EL++ G +         L
Sbjct: 385 QKDTGSLLAELMELEILGLIEQVGGRYGRL 414


>gi|229826296|ref|ZP_04452365.1| hypothetical protein GCWU000182_01668 [Abiotrophia defectiva ATCC
           49176]
 gi|229789166|gb|EEP25280.1| hypothetical protein GCWU000182_01668 [Abiotrophia defectiva ATCC
           49176]
          Length = 366

 Score = 46.4 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 13/48 (27%), Positives = 24/48 (50%)

Query: 32  TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCH 79
            +     +  +L   P HI +I+  TG++   ++ VLLEL+  G +  
Sbjct: 306 LESHEKIVYATLCLTPKHISEILSETGLDEGELFKVLLELEFKGYVRR 353


>gi|304383998|ref|ZP_07366454.1| SMF family DNA processing protein [Prevotella marshii DSM 16973]
 gi|304334890|gb|EFM01164.1| SMF family DNA processing protein [Prevotella marshii DSM 16973]
          Length = 375

 Score = 46.4 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 8/54 (14%), Positives = 19/54 (35%), Gaps = 1/54 (1%)

Query: 30  EYTQCERVRIKQSLNNV-PIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPE 82
                E  ++   L     + I+ +   +GI    +  +L  L++ G +     
Sbjct: 315 PDLSPEEQQVVTVLQTTNDLPINMLTIQSGIAVSKLTAILFTLEMKGVVRMMAG 368


>gi|160895226|ref|ZP_02075998.1| hypothetical protein CLOL250_02786 [Clostridium sp. L2-50]
 gi|156863105|gb|EDO56536.1| hypothetical protein CLOL250_02786 [Clostridium sp. L2-50]
          Length = 366

 Score = 46.4 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 9/50 (18%), Positives = 17/50 (34%)

Query: 30  EYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCH 79
           E        I   L    ++I+DI         +V   L +++  G +  
Sbjct: 306 EQLDLPEQEIFACLGRDVVYIEDICSRVDQPPALVLSTLFDMEKKGYIRQ 355


>gi|289677572|ref|ZP_06498462.1| SMF protein [Pseudomonas syringae pv. syringae FF5]
          Length = 110

 Score = 46.4 bits (109), Expect = 0.002,   Method: Composition-based stats.
 Identities = 12/71 (16%), Positives = 21/71 (29%), Gaps = 3/71 (4%)

Query: 18  NHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRL 77
             + +      P         +   L+  P   + +    G   P V   L EL+L GR+
Sbjct: 42  APSVDPVTPAKPGPCD---HPLLALLHAAPHTSEGLSVSCGWPLPKVLAGLTELELDGRI 98

Query: 78  CHHPEGKVSLT 88
                   +  
Sbjct: 99  SCEAGRWFARA 109


>gi|331085946|ref|ZP_08335029.1| hypothetical protein HMPREF0987_01332 [Lachnospiraceae bacterium
           9_1_43BFAA]
 gi|330406869|gb|EGG86374.1| hypothetical protein HMPREF0987_01332 [Lachnospiraceae bacterium
           9_1_43BFAA]
          Length = 376

 Score = 46.4 bits (109), Expect = 0.002,   Method: Composition-based stats.
 Identities = 11/56 (19%), Positives = 24/56 (42%)

Query: 32  TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
            + E+  +   L+  P  I  I+  T +  P +   L+ L++ G++    +G    
Sbjct: 318 LETEQNIVYSCLDLNPKSIGQILAETKLSIPELMRQLVSLEMNGKIKEISKGYYVR 373


>gi|325662148|ref|ZP_08150766.1| hypothetical protein HMPREF0490_01504 [Lachnospiraceae bacterium
           4_1_37FAA]
 gi|325471597|gb|EGC74817.1| hypothetical protein HMPREF0490_01504 [Lachnospiraceae bacterium
           4_1_37FAA]
          Length = 376

 Score = 46.4 bits (109), Expect = 0.002,   Method: Composition-based stats.
 Identities = 11/56 (19%), Positives = 24/56 (42%)

Query: 32  TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
            + E+  +   L+  P  I  I+  T +  P +   L+ L++ G++    +G    
Sbjct: 318 LETEQNIVYSCLDLNPKSIGQILAETKLSIPELMRQLVSLEMNGKIKEISKGYYVR 373


>gi|308447376|ref|XP_003087416.1| hypothetical protein CRE_14455 [Caenorhabditis remanei]
 gi|308256659|gb|EFP00612.1| hypothetical protein CRE_14455 [Caenorhabditis remanei]
          Length = 561

 Score = 46.0 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 11/75 (14%), Positives = 27/75 (36%), Gaps = 1/75 (1%)

Query: 13  SQSDTNHTKNINITHYPEYTQCERV-RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLEL 71
           +     H    + +  P     E + ++ Q L+ +   +D +     ++   +   L+EL
Sbjct: 296 ALPTQWHCAQQSESRSPMPEIPEHLFKLYQLLDWIGQDLDTLAQSANLDIAQLTSDLMEL 355

Query: 72  DLAGRLCHHPEGKVS 86
           +L G         + 
Sbjct: 356 ELLGHCIQQSGRYLR 370


>gi|15805160|ref|NP_293846.1| smf protein [Deinococcus radiodurans R1]
 gi|6457785|gb|AAF09710.1|AE001874_7 smf protein [Deinococcus radiodurans R1]
          Length = 370

 Score = 46.0 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 13/58 (22%), Positives = 22/58 (37%), Gaps = 1/58 (1%)

Query: 25  ITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPE 82
                     E+ R+ ++L   P  +DD+   TG+  P +   L+ L L G       
Sbjct: 310 PAPAVPDLPPEQARVLRALQ-TPATLDDLAATTGLSIPELQTALVMLQLQGLAYEVGG 366


>gi|225568716|ref|ZP_03777741.1| hypothetical protein CLOHYLEM_04795 [Clostridium hylemonae DSM
           15053]
 gi|225162215|gb|EEG74834.1| hypothetical protein CLOHYLEM_04795 [Clostridium hylemonae DSM
           15053]
          Length = 362

 Score = 46.0 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 9/56 (16%), Positives = 20/56 (35%)

Query: 32  TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
            +     +   L   P  +  ++  TG+ A  +   L+ L+L G +    +     
Sbjct: 304 LESPENMVYSCLGLCPKSVSQLVKETGLPAGELLERLVTLELQGYIREISKNYYVR 359


>gi|330937248|gb|EGH41264.1| SMF protein [Pseudomonas syringae pv. pisi str. 1704B]
          Length = 372

 Score = 46.0 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 12/71 (16%), Positives = 21/71 (29%), Gaps = 3/71 (4%)

Query: 18  NHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRL 77
             + +      P         +   L+  P   + +    G   P V   L EL+L GR+
Sbjct: 304 APSVDPVTPAKPGPCD---HPLLALLHAAPHTSEGLSVSCGWPLPKVLAGLTELELDGRI 360

Query: 78  CHHPEGKVSLT 88
                   +  
Sbjct: 361 SCEAGRWFARA 371


>gi|326389491|ref|ZP_08211058.1| DNA protecting protein DprA [Thermoanaerobacter ethanolicus JW 200]
 gi|325994496|gb|EGD52921.1| DNA protecting protein DprA [Thermoanaerobacter ethanolicus JW 200]
          Length = 362

 Score = 46.0 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 12/56 (21%), Positives = 20/56 (35%)

Query: 30  EYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
                E   +   +   P  I++I  +  I+   V  +L  L L G +   P  K 
Sbjct: 302 SSLTEEEKEVYDFICEAPRDIEEIAGYVKIKISKVNAILSSLMLKGMIEKLPGNKY 357


>gi|307264857|ref|ZP_07546419.1| DNA protecting protein DprA [Thermoanaerobacter wiegelii Rt8.B1]
 gi|306920115|gb|EFN50327.1| DNA protecting protein DprA [Thermoanaerobacter wiegelii Rt8.B1]
          Length = 362

 Score = 46.0 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 12/56 (21%), Positives = 20/56 (35%)

Query: 30  EYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
                E   +   +   P  I++I  +  I+   V  +L  L L G +   P  K 
Sbjct: 302 SSLTEEEKEVYDFICEAPRDIEEIAGYVKIKISKVNAILSSLMLKGMIEKLPGNKY 357


>gi|256750729|ref|ZP_05491614.1| DNA protecting protein DprA [Thermoanaerobacter ethanolicus CCSD1]
 gi|256750312|gb|EEU63331.1| DNA protecting protein DprA [Thermoanaerobacter ethanolicus CCSD1]
          Length = 362

 Score = 46.0 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 12/56 (21%), Positives = 20/56 (35%)

Query: 30  EYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
                E   +   +   P  I++I  +  I+   V  +L  L L G +   P  K 
Sbjct: 302 SSLTEEEKEVYDFICEAPRDIEEIAGYVKIKISKVNAILSSLMLKGMIEKLPGNKY 357


>gi|167037677|ref|YP_001665255.1| DNA protecting protein DprA [Thermoanaerobacter pseudethanolicus
           ATCC 33223]
 gi|320116092|ref|YP_004186251.1| DNA protecting protein DprA [Thermoanaerobacter brockii subsp.
           finnii Ako-1]
 gi|166856511|gb|ABY94919.1| DNA protecting protein DprA [Thermoanaerobacter pseudethanolicus
           ATCC 33223]
 gi|319929183|gb|ADV79868.1| DNA protecting protein DprA [Thermoanaerobacter brockii subsp.
           finnii Ako-1]
          Length = 362

 Score = 46.0 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 12/56 (21%), Positives = 20/56 (35%)

Query: 30  EYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
                E   +   +   P  I++I  +  I+   V  +L  L L G +   P  K 
Sbjct: 302 SSLTEEEKEVYDFICEAPRDIEEIAGYVKIKISKVNAILSSLMLKGMIEKLPGNKY 357


>gi|170694016|ref|ZP_02885172.1| DNA protecting protein DprA [Burkholderia graminis C4D1M]
 gi|170141088|gb|EDT09260.1| DNA protecting protein DprA [Burkholderia graminis C4D1M]
          Length = 431

 Score = 46.0 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 17/79 (21%), Positives = 34/79 (43%), Gaps = 3/79 (3%)

Query: 12  SSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLEL 71
             Q      +  N+   P     +  ++  +L + P  ++ +   T +E  V+   LL+L
Sbjct: 355 EPQPIAAEARAPNVRDVP---DPDAQKLLAALGHAPTSLEILATRTEMEYAVLQTTLLQL 411

Query: 72  DLAGRLCHHPEGKVSLTMH 90
           +LAG +   P G+ +   H
Sbjct: 412 ELAGHVSALPGGRYTRASH 430


>gi|88606798|ref|YP_505506.1| putative DNA processing protein DprA [Anaplasma phagocytophilum HZ]
 gi|88597861|gb|ABD43331.1| putative DNA processing protein DprA [Anaplasma phagocytophilum HZ]
          Length = 344

 Score = 46.0 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 19/67 (28%), Positives = 33/67 (49%)

Query: 21  KNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHH 80
                T     T   +  I ++L+  P +IDD++    ++  V+   LLEL+LAGR+   
Sbjct: 273 DTQKRTSKNTTTTPVQDLILKNLSISPTNIDDLVICCNLDVSVLLAALLELELAGRVERL 332

Query: 81  PEGKVSL 87
           P  + +L
Sbjct: 333 PGNRFAL 339


>gi|253583758|ref|ZP_04860956.1| smf protein [Fusobacterium varium ATCC 27725]
 gi|251834330|gb|EES62893.1| smf protein [Fusobacterium varium ATCC 27725]
          Length = 352

 Score = 46.0 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 11/52 (21%), Positives = 25/52 (48%), Gaps = 1/52 (1%)

Query: 36  RVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
             +I   L     ++D++I  T ++A  +  +L++L++   +   P GK   
Sbjct: 300 EEKIFFLLEKE-KNLDELILGTSLKASEILSILMDLEIKHIIVSIPGGKYRR 350


>gi|225012503|ref|ZP_03702939.1| DNA protecting protein DprA [Flavobacteria bacterium MS024-2A]
 gi|225003480|gb|EEG41454.1| DNA protecting protein DprA [Flavobacteria bacterium MS024-2A]
          Length = 365

 Score = 46.0 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 9/55 (16%), Positives = 22/55 (40%), Gaps = 1/55 (1%)

Query: 32  TQCERVRIKQSLNNVP-IHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
              E  ++    +    IH+D +    GI+      +L+++++ G +   P    
Sbjct: 308 LTEEERQLFTQFSKEGKIHLDHLAFSVGIKVSTTASLLMQMEMKGMVRALPGKYF 362


>gi|332976017|gb|EGK12888.1| DNA processing chain A [Psychrobacter sp. 1501(2011)]
          Length = 434

 Score = 46.0 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 14/84 (16%), Positives = 31/84 (36%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVV 64
              Q+ F++ +  ++ K +               +   +      +D +I  T ++ P +
Sbjct: 350 LFNQSSFTAFASNDNAKPVLKEKKSATISKHLQPLWVHIEFDFQDLDALIIKTKLDTPSL 409

Query: 65  YLVLLELDLAGRLCHHPEGKVSLT 88
              L+EL+L G +         LT
Sbjct: 410 LSQLMELELLGVITQVGGRYQRLT 433


>gi|297623876|ref|YP_003705310.1| DNA protecting protein DprA [Truepera radiovictrix DSM 17093]
 gi|297165056|gb|ADI14767.1| DNA protecting protein DprA [Truepera radiovictrix DSM 17093]
          Length = 372

 Score = 46.0 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 14/82 (17%), Positives = 30/82 (36%), Gaps = 3/82 (3%)

Query: 7   EQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSL--NNVPIHIDDIIHHTGIEAPVV 64
             +   S+       +                +  ++     P+ +DD++  TG  AP +
Sbjct: 290 RADDILSELGWRRAPSAPPKRDAPELTGLPQELLTAIRQGGEPL-LDDLVTATGRAAPEL 348

Query: 65  YLVLLELDLAGRLCHHPEGKVS 86
              L+ L+L G +   P G+ +
Sbjct: 349 LSALMTLELKGLVRSLPSGRYA 370


>gi|225175754|ref|ZP_03729747.1| DNA protecting protein DprA [Dethiobacter alkaliphilus AHT 1]
 gi|225168678|gb|EEG77479.1| DNA protecting protein DprA [Dethiobacter alkaliphilus AHT 1]
          Length = 361

 Score = 45.6 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 7/56 (12%), Positives = 18/56 (32%)

Query: 31  YTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
                  +I + + +  + I+ +              L  ++L G++   P G   
Sbjct: 304 EDSAYERQIIELIGSEEVSIEKLALSFTENRKSFLEALSVMELEGKVKRMPGGMYR 359


>gi|304316916|ref|YP_003852061.1| DNA protecting protein DprA [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302778418|gb|ADL68977.1| DNA protecting protein DprA [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 362

 Score = 45.6 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 9/54 (16%), Positives = 20/54 (37%)

Query: 32  TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
              E  ++  ++ + P  I++++         V  +L  L   G +   P  K 
Sbjct: 304 LSSEEKKLYMAIVDCPRDIEELVEIMKFPVSKVNYLLSSLLFKGLIVRLPGNKY 357


>gi|152989517|ref|YP_001345418.1| DNA-processing protein smf chain A [Pseudomonas aeruginosa PA7]
 gi|150964675|gb|ABR86700.1| protein smf (DNA-processing chain A) [Pseudomonas aeruginosa PA7]
          Length = 362

 Score = 45.6 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 12/72 (16%), Positives = 20/72 (27%)

Query: 17  TNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGR 76
                                 + + L   P   + +   +G   P V   L EL+L GR
Sbjct: 290 EALRGWTQAGPAEAPVASLDHPLLELLRVAPYSSEGLAAASGWALPEVLAALTELELDGR 349

Query: 77  LCHHPEGKVSLT 88
           +       V  +
Sbjct: 350 VACEAGTWVHRS 361


>gi|295699664|ref|YP_003607557.1| DEAD/H associated domain protein [Burkholderia sp. CCGE1002]
 gi|295438877|gb|ADG18046.1| DEAD/H associated domain protein [Burkholderia sp. CCGE1002]
          Length = 1509

 Score = 45.6 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 16/78 (20%), Positives = 29/78 (37%), Gaps = 3/78 (3%)

Query: 2    VHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEA 61
            ++P IE+N +    +       + +         R R+       P+ +D I    G+ A
Sbjct: 1022 LYPAIERNRYEPPLNAPKGYTESWSADDALVDVLRARLT---GFGPLTVDAIARPLGLPA 1078

Query: 62   PVVYLVLLELDLAGRLCH 79
              +   LL L+  G L  
Sbjct: 1079 GRIEPALLRLETEGYLLR 1096


>gi|330976424|gb|EGH76480.1| SMF protein [Pseudomonas syringae pv. aptata str. DSM 50252]
          Length = 372

 Score = 45.6 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 12/71 (16%), Positives = 21/71 (29%), Gaps = 3/71 (4%)

Query: 18  NHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRL 77
             + +      P         +   L+  P   + +    G   P V   L EL+L GR+
Sbjct: 304 APSVDPVTPAKPGPCD---HPLLALLHAAPHTSEGLSVSCGWPLPKVLAGLTELELDGRI 360

Query: 78  CHHPEGKVSLT 88
                   +  
Sbjct: 361 SCEAGRWFARA 371


>gi|237736954|ref|ZP_04567435.1| topoisomerase [Fusobacterium mortiferum ATCC 9817]
 gi|229420816|gb|EEO35863.1| topoisomerase [Fusobacterium mortiferum ATCC 9817]
          Length = 356

 Score = 45.6 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 12/52 (23%), Positives = 25/52 (48%), Gaps = 1/52 (1%)

Query: 36  RVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
             +I  +L     ++D+II  T ++A  V  +L++L++   +     GK   
Sbjct: 304 EKKIYNTLVKE-KNLDEIIEETSMKASEVLSILMDLEVKKIIVSIAGGKYRR 354


>gi|294678614|ref|YP_003579229.1| DNA protecting protein DprA [Rhodobacter capsulatus SB 1003]
 gi|294477434|gb|ADE86822.1| DNA protecting protein DprA [Rhodobacter capsulatus SB 1003]
          Length = 383

 Score = 45.6 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 12/43 (27%), Positives = 21/43 (48%)

Query: 45  NVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
             P   D +I   GI+A  +   ++ L++ G +  HP G +S 
Sbjct: 340 PAPTPEDTVIRDLGIDAATLSREVIGLEIEGEITRHPGGLLSR 382


>gi|330500989|ref|YP_004377858.1| DNA protecting protein DprA [Pseudomonas mendocina NK-01]
 gi|328915275|gb|AEB56106.1| DNA protecting protein DprA [Pseudomonas mendocina NK-01]
          Length = 372

 Score = 45.6 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 10/67 (14%), Positives = 23/67 (34%)

Query: 22  NINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHP 81
             +        +     +   L+  P   + ++  +G     V   L EL+L G +C+  
Sbjct: 305 PASAPLSDASLKRVEHPLLHLLHAAPHSTEALVQASGWPLAQVLAALTELELDGLVCNEA 364

Query: 82  EGKVSLT 88
              ++  
Sbjct: 365 GRWLARN 371


>gi|291522666|emb|CBK80959.1| DNA protecting protein DprA [Coprococcus catus GD/7]
          Length = 359

 Score = 45.6 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 11/57 (19%), Positives = 24/57 (42%)

Query: 32  TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
                  +  S+  VP   D+I   TG++   +   L+ ++L G +    + +  L+
Sbjct: 302 LDNSEKVVYASICLVPRSADEIAALTGMDVQCIIHCLVRMELKGIIHRVGKNQYVLS 358


>gi|187930744|ref|YP_001901231.1| DNA protecting protein DprA [Ralstonia pickettii 12J]
 gi|187727634|gb|ACD28799.1| DNA protecting protein DprA [Ralstonia pickettii 12J]
          Length = 402

 Score = 45.6 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 15/62 (24%), Positives = 25/62 (40%)

Query: 24  NITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEG 83
            +T            +  +L   P+ +D +   TG  A  +   LL L+L GR+   P G
Sbjct: 337 PVTVAGPAPSASEAALLDALGFDPVDLDTLCERTGQGAAALSAQLLALELDGRVERRPGG 396

Query: 84  KV 85
           + 
Sbjct: 397 RF 398


>gi|295093364|emb|CBK82455.1| DNA protecting protein DprA [Coprococcus sp. ART55/1]
          Length = 359

 Score = 45.6 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 12/55 (21%), Positives = 18/55 (32%)

Query: 34  CERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
               ++   +     HIDDI   TGI    V  +L EL+    +           
Sbjct: 305 PAEKKVYSCVRLESRHIDDICFETGISVSEVTQILYELEQKRLIKQLVRNYYVRA 359


>gi|169342679|ref|ZP_02863720.1| DNA protecting protein DprA [Clostridium perfringens C str.
           JGS1495]
 gi|169299185|gb|EDS81255.1| DNA protecting protein DprA [Clostridium perfringens C str.
           JGS1495]
          Length = 360

 Score = 45.6 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 15/49 (30%), Positives = 23/49 (46%)

Query: 37  VRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
             +   L N  +HIDDII  T I+  ++Y +L EL    ++   P    
Sbjct: 308 QLLLSILENNILHIDDIIRVTNIDTSIIYELLCELQFENKIEVIPGDYY 356


>gi|310828090|ref|YP_003960447.1| DNA protecting protein DprA [Eubacterium limosum KIST612]
 gi|308739824|gb|ADO37484.1| DNA protecting protein DprA [Eubacterium limosum KIST612]
          Length = 368

 Score = 45.6 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 10/56 (17%), Positives = 21/56 (37%)

Query: 32  TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
              E+ +I   +      +D+++  +G+    V   L  L+L  R+         L
Sbjct: 313 EDPEQKKILNYVAGGYTTVDELVAVSGMGIGAVNGALSMLELDDRVKVEYGKVYIL 368


>gi|20807897|ref|NP_623068.1| Rossmann-fold nucleotide-binding protein involved in DNA uptake
           [Thermoanaerobacter tengcongensis MB4]
 gi|254479480|ref|ZP_05092805.1| DNA protecting protein DprA, putative [Carboxydibrachium pacificum
           DSM 12653]
 gi|20516463|gb|AAM24672.1| predicted Rossmann-fold nucleotide-binding protein involved in DNA
           uptake [Thermoanaerobacter tengcongensis MB4]
 gi|214034584|gb|EEB75333.1| DNA protecting protein DprA, putative [Carboxydibrachium pacificum
           DSM 12653]
          Length = 362

 Score = 45.6 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 8/55 (14%), Positives = 21/55 (38%)

Query: 31  YTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
               +   + + +   P  +++I +   ++   +  +L  L L G +   P  K 
Sbjct: 303 SLTEDEKVVYEFIKEAPRDVEEISYTLNMKMSKLNSILTSLMLKGLIDRLPGNKY 357


>gi|260892472|ref|YP_003238569.1| DNA protecting protein DprA [Ammonifex degensii KC4]
 gi|260864613|gb|ACX51719.1| DNA protecting protein DprA [Ammonifex degensii KC4]
          Length = 375

 Score = 45.6 bits (107), Expect = 0.003,   Method: Composition-based stats.
 Identities = 10/57 (17%), Positives = 20/57 (35%)

Query: 32  TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
              E   I   L    + +++++    +       +L  L+L G +     G   LT
Sbjct: 302 LNPEEEEIVSLLAAGFLSLEELVERGKMPVDACLSLLSMLELKGVVRPGGGGTYLLT 358


>gi|300858734|ref|YP_003783717.1| hypothetical protein cpfrc_01317 [Corynebacterium
           pseudotuberculosis FRC41]
 gi|300686188|gb|ADK29110.1| hypothetical protein cpfrc_01317 [Corynebacterium
           pseudotuberculosis FRC41]
 gi|302206441|gb|ADL10783.1| SMF DNA recombination-mediator protein A [Corynebacterium
           pseudotuberculosis C231]
 gi|302330997|gb|ADL21191.1| Rossmann-fold nucleotide-binding protein/SMF [Corynebacterium
           pseudotuberculosis 1002]
 gi|308276683|gb|ADO26582.1| Rossmann-fold nucleotide-binding protein/SMF [Corynebacterium
           pseudotuberculosis I19]
          Length = 391

 Score = 45.6 bits (107), Expect = 0.003,   Method: Composition-based stats.
 Identities = 13/59 (22%), Positives = 22/59 (37%)

Query: 25  ITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEG 83
             +  +      +RI  SL   P   + I   +G+   +   +LLEL   G +     G
Sbjct: 323 APNAVQKLSRNELRIYDSLGAEPEVTEVIARRSGVSIGLAVHLLLELSNKGMVQREGAG 381


>gi|304388917|ref|ZP_07370964.1| DNA protecting protein DprA [Neisseria meningitidis ATCC 13091]
 gi|304337051|gb|EFM03238.1| DNA protecting protein DprA [Neisseria meningitidis ATCC 13091]
          Length = 395

 Score = 45.6 bits (107), Expect = 0.003,   Method: Composition-based stats.
 Identities = 15/74 (20%), Positives = 25/74 (33%)

Query: 14  QSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDL 73
           Q+         +             I   +   P+H D +     + A  +Y  LLEL+L
Sbjct: 319 QTAYAPPPAAKMPSEAAAGGTAHGGILDKMGFDPVHPDVLAEQLAMPAADLYAALLELEL 378

Query: 74  AGRLCHHPEGKVSL 87
            G +   P G+   
Sbjct: 379 DGSVAAMPGGRYQR 392


>gi|225849802|ref|YP_002730036.1| protein smf (DNA-processing chain A) [Persephonella marina EX-H1]
 gi|225645083|gb|ACO03269.1| protein smf (DNA-processing chain A) [Persephonella marina EX-H1]
          Length = 352

 Score = 45.6 bits (107), Expect = 0.003,   Method: Composition-based stats.
 Identities = 11/51 (21%), Positives = 20/51 (39%), Gaps = 1/51 (1%)

Query: 32  TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPE 82
                 +I   L+  P HID I     I    + ++L +++L G +     
Sbjct: 297 LSEIEKKILFILS-SPEHIDIISEKMNISVSDLMVILFDMELKGLITSENG 346


>gi|326562328|gb|EGE12654.1| DNA protecting protein DprA [Moraxella catarrhalis 103P14B1]
 gi|326575532|gb|EGE25457.1| DNA protecting protein DprA [Moraxella catarrhalis 101P30B1]
          Length = 414

 Score = 45.2 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 13/90 (14%), Positives = 33/90 (36%), Gaps = 9/90 (10%)

Query: 3   HPQIEQNF-----FSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHT 57
           HP    +       +S++  +H +  + +        +      +L N P  +D ++  +
Sbjct: 329 HPSQAPDTNTLASLNSKTAVHHLQPASRSTCVPEHLAD----LYALMNEPCDLDQLVFSS 384

Query: 58  GIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
             +   +   L+EL++ G +         L
Sbjct: 385 QKDTGSLLAELMELEILGLIEQVGGRYGRL 414


>gi|161870938|ref|YP_001600118.1| DNA processing chain A [Neisseria meningitidis 053442]
 gi|161596491|gb|ABX74151.1| DNA processing chain A [Neisseria meningitidis 053442]
          Length = 395

 Score = 45.2 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 15/74 (20%), Positives = 25/74 (33%)

Query: 14  QSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDL 73
           Q+         +             I   +   P+H D +     + A  +Y  LLEL+L
Sbjct: 319 QTAYAPPPAAKMPSEAAAGGTAHGGILDKMGFDPVHPDVLAEQLAMPAADLYAALLELEL 378

Query: 74  AGRLCHHPEGKVSL 87
            G +   P G+   
Sbjct: 379 DGSVAAMPGGRYQR 392


>gi|332653525|ref|ZP_08419270.1| DNA processing protein DprA [Ruminococcaceae bacterium D16]
 gi|332518671|gb|EGJ48274.1| DNA processing protein DprA [Ruminococcaceae bacterium D16]
          Length = 410

 Score = 45.2 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 13/89 (14%), Positives = 30/89 (33%), Gaps = 6/89 (6%)

Query: 4   PQIEQNFFSSQSDTNHT------KNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHT 57
           P+  +     +              I+++   E    +++ +  ++       D ++  T
Sbjct: 314 PKEHKEEPKPEPQQEEPKEKAGRPKISLSEQRERFTDDQLVVLHAMLEGADTADVLVDRT 373

Query: 58  GIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
            I A  V   L  L + G     P G+ +
Sbjct: 374 QIPARRVLSALTMLQVDGAAEQRPGGRYA 402


>gi|325135225|gb|EGC57850.1| putative DNA processing protein DprA [Neisseria meningitidis
           M13399]
          Length = 397

 Score = 45.2 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 14/72 (19%), Positives = 25/72 (34%)

Query: 16  DTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAG 75
               +    +         +   I   +   P+H D +     + A  +Y  LLEL+L G
Sbjct: 323 APPPSPEGKMPSEGAACGTDPGGILDKMGFDPVHPDVLAEQLAMPAADLYAALLELELDG 382

Query: 76  RLCHHPEGKVSL 87
            +   P G+   
Sbjct: 383 SVAAMPGGRYQR 394


>gi|254671143|emb|CBA08189.1| DNA processing chain A [Neisseria meningitidis alpha153]
          Length = 395

 Score = 45.2 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 15/74 (20%), Positives = 25/74 (33%)

Query: 14  QSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDL 73
           Q+         +             I   +   P+H D +     + A  +Y  LLEL+L
Sbjct: 319 QTAYAPPPAAKMPSEAAAGGTAHGGILDKMGFDPVHPDVLAEQLAMPAADLYAALLELEL 378

Query: 74  AGRLCHHPEGKVSL 87
            G +   P G+   
Sbjct: 379 DGSVAAMPGGRYQR 392


>gi|325145438|gb|EGC67714.1| putative DNA processing protein DprA [Neisseria meningitidis
           M01-240013]
 gi|325205209|gb|ADZ00662.1| putative DNA processing protein DprA [Neisseria meningitidis
           M04-240196]
          Length = 397

 Score = 45.2 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 14/72 (19%), Positives = 25/72 (34%)

Query: 16  DTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAG 75
               +    +         +   I   +   P+H D +     + A  +Y  LLEL+L G
Sbjct: 323 APPPSPEGKMPSEGAACGTDPGGILDKMGFDPVHPDVLAEQLAMPAADLYAALLELELDG 382

Query: 76  RLCHHPEGKVSL 87
            +   P G+   
Sbjct: 383 SVAAMPGGRYQR 394


>gi|325133183|gb|EGC55854.1| putative DNA processing protein DprA [Neisseria meningitidis M6190]
          Length = 395

 Score = 45.2 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 15/74 (20%), Positives = 25/74 (33%)

Query: 14  QSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDL 73
           Q+         +             I   +   P+H D +     + A  +Y  LLEL+L
Sbjct: 319 QTAYAPPPAAKMPSEAAAGGTAHGGILDKMGFDPVHPDVLAEQLAMPAADLYAALLELEL 378

Query: 74  AGRLCHHPEGKVSL 87
            G +   P G+   
Sbjct: 379 DGSVAAMPGGRYQR 392


>gi|86608165|ref|YP_476927.1| DNA protecting protein DprA [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|86556707|gb|ABD01664.1| DNA protecting protein DprA [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 385

 Score = 45.2 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 9/58 (15%), Positives = 23/58 (39%)

Query: 31  YTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
            +  ++  + Q L    + +D +   + ++   +   LL ++L G L   P  +    
Sbjct: 327 PSDPQQQLLWQLLGEGILSLDALAQASQMDIATLSSTLLLMELEGWLVQLPGMRYQRA 384


>gi|66043292|ref|YP_233133.1| SMF protein [Pseudomonas syringae pv. syringae B728a]
 gi|63253999|gb|AAY35095.1| SMF protein [Pseudomonas syringae pv. syringae B728a]
          Length = 372

 Score = 45.2 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 12/64 (18%), Positives = 19/64 (29%)

Query: 25  ITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGK 84
               P         +   L+  P   + +    G   P V   L EL+L GR+       
Sbjct: 308 DPVTPAKPVPCDHPLLALLHAAPHTSEGLSVSCGWPLPKVLAGLTELELDGRISCEAGRW 367

Query: 85  VSLT 88
            +  
Sbjct: 368 FARA 371


>gi|149369266|ref|ZP_01889118.1| Smf protein DNA processing chain A [unidentified eubacterium SCB49]
 gi|149356693|gb|EDM45248.1| Smf protein DNA processing chain A [unidentified eubacterium SCB49]
          Length = 380

 Score = 45.2 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 12/83 (14%), Positives = 21/83 (25%), Gaps = 1/83 (1%)

Query: 7   EQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSL-NNVPIHIDDIIHHTGIEAPVVY 65
            ++           K    T        E   +   L       +D I     I      
Sbjct: 298 AEDIIFHLGWQVENKKPQQTSLFVELTDEEKIVFNYLKGKEKELLDIIAIECKIPTYKAA 357

Query: 66  LVLLELDLAGRLCHHPEGKVSLT 88
            +LL +++ G +   P     L 
Sbjct: 358 TLLLNMEIKGVIRPLPGKLFQLA 380


>gi|319945033|ref|ZP_08019295.1| DNA processing SMF protein [Lautropia mirabilis ATCC 51599]
 gi|319741603|gb|EFV94028.1| DNA processing SMF protein [Lautropia mirabilis ATCC 51599]
          Length = 424

 Score = 45.2 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 11/70 (15%), Positives = 24/70 (34%)

Query: 15  SDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLA 74
           +D            PE    +   +   L   P+  + +    G     + + +  L+L 
Sbjct: 350 ADQESGAVEQAPSRPEPPDDDSRDLFTILAASPMSAEALASRLGWPIDRILITIQLLELG 409

Query: 75  GRLCHHPEGK 84
           G +  H +G+
Sbjct: 410 GYIGRHVDGR 419


>gi|258648286|ref|ZP_05735755.1| smf protein [Prevotella tannerae ATCC 51259]
 gi|260852205|gb|EEX72074.1| smf protein [Prevotella tannerae ATCC 51259]
          Length = 368

 Score = 44.8 bits (105), Expect = 0.003,   Method: Composition-based stats.
 Identities = 11/68 (16%), Positives = 23/68 (33%), Gaps = 1/68 (1%)

Query: 21  KNINITHYPEYTQCERVRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCH 79
           +    T           ++   L  +    +D +     +   VV  +L +L++ G +  
Sbjct: 299 EASPATDLFADLTRNEQKLIAVLKQHDCRTLDQLAAEADLAHSVVASLLFDLNMRGFVKT 358

Query: 80  HPEGKVSL 87
            P G   L
Sbjct: 359 LPGGAYRL 366


>gi|225019249|ref|ZP_03708441.1| hypothetical protein CLOSTMETH_03202 [Clostridium methylpentosum
           DSM 5476]
 gi|224947880|gb|EEG29089.1| hypothetical protein CLOSTMETH_03202 [Clostridium methylpentosum
           DSM 5476]
          Length = 369

 Score = 44.8 bits (105), Expect = 0.004,   Method: Composition-based stats.
 Identities = 10/72 (13%), Positives = 28/72 (38%)

Query: 13  SQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELD 72
           S + T   +    +        + V + +++ + P+    +   TG+    +  +L +L+
Sbjct: 294 SVAATLPEEGTAHSPDLSELSSQEVELYRAMPDDPVDTGYLSAKTGLLVSDLMQMLTKLE 353

Query: 73  LAGRLCHHPEGK 84
           L+G +       
Sbjct: 354 LSGAVRKTAGRY 365


>gi|261407992|ref|YP_003244233.1| DNA protecting protein DprA [Paenibacillus sp. Y412MC10]
 gi|261284455|gb|ACX66426.1| DNA protecting protein DprA [Paenibacillus sp. Y412MC10]
          Length = 391

 Score = 44.8 bits (105), Expect = 0.004,   Method: Composition-based stats.
 Identities = 11/71 (15%), Positives = 23/71 (32%)

Query: 17  TNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGR 76
                             +  +I   L   P  +D++I  T  +   ++ VLL L +  +
Sbjct: 320 ERRAPRQERPDELAGLTNDERQIYHMLEQGPGSLDEMIECTRWDFGHLHSVLLSLIIKKQ 379

Query: 77  LCHHPEGKVSL 87
           +   P     +
Sbjct: 380 ITQLPGAIYKI 390


>gi|254820364|ref|ZP_05225365.1| smf family protein [Mycobacterium intracellulare ATCC 13950]
          Length = 267

 Score = 44.8 bits (105), Expect = 0.004,   Method: Composition-based stats.
 Identities = 11/64 (17%), Positives = 21/64 (32%), Gaps = 1/64 (1%)

Query: 20  TKNINITHYPEYTQCERVRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLC 78
                     +       R+ ++L       +D+I   +G+    V   L  L+LAG + 
Sbjct: 185 PDEPRPVTPLDGLSEAERRVYEALPGRGAATVDEIAVASGLVPEQVLGPLAMLELAGLVQ 244

Query: 79  HHPE 82
               
Sbjct: 245 RQDG 248


>gi|163816842|ref|ZP_02208205.1| hypothetical protein COPEUT_03032 [Coprococcus eutactus ATCC 27759]
 gi|158448099|gb|EDP25094.1| hypothetical protein COPEUT_03032 [Coprococcus eutactus ATCC 27759]
          Length = 360

 Score = 44.8 bits (105), Expect = 0.004,   Method: Composition-based stats.
 Identities = 9/55 (16%), Positives = 16/55 (29%)

Query: 34  CERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
               ++   +     HIDDI    G+       +L EL+    +           
Sbjct: 306 PAEKKVYSCVRLESRHIDDICFEAGMTVSETAQILFELEKKRLVKQLVRNYYCRA 360


>gi|291563109|emb|CBL41925.1| DNA protecting protein DprA [butyrate-producing bacterium SS3/4]
          Length = 368

 Score = 44.8 bits (105), Expect = 0.004,   Method: Composition-based stats.
 Identities = 10/42 (23%), Positives = 22/42 (52%)

Query: 36  RVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRL 77
              +  S+++ P ++++I    G+        LL+L+LAG +
Sbjct: 315 ENLVYASVDSRPRYLEEIAALCGLSVTECMEALLKLELAGLV 356


>gi|255319593|ref|ZP_05360805.1| DNA protecting protein DprA [Acinetobacter radioresistens SK82]
 gi|262380779|ref|ZP_06073932.1| DNA protecting protein DprA [Acinetobacter radioresistens SH164]
 gi|255303348|gb|EET82553.1| DNA protecting protein DprA [Acinetobacter radioresistens SK82]
 gi|262297727|gb|EEY85643.1| DNA protecting protein DprA [Acinetobacter radioresistens SH164]
          Length = 376

 Score = 44.8 bits (105), Expect = 0.004,   Method: Composition-based stats.
 Identities = 15/76 (19%), Positives = 29/76 (38%), Gaps = 2/76 (2%)

Query: 13  SQSDTNHTKNINITHYPEYTQCERV--RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLE 70
           +     H++   ++  PE  Q       + Q L+ V + +D I     + A  +   L+E
Sbjct: 296 ALPTQWHSQQQKVSSVPEPAQVPEHLFELYQQLDWVGLDLDQIALKLPLSAAELTGHLME 355

Query: 71  LDLAGRLCHHPEGKVS 86
           L+L G         + 
Sbjct: 356 LELLGLCVQQSGRYLR 371


>gi|322436363|ref|YP_004218575.1| DNA protecting protein DprA [Acidobacterium sp. MP5ACTX9]
 gi|321164090|gb|ADW69795.1| DNA protecting protein DprA [Acidobacterium sp. MP5ACTX9]
          Length = 404

 Score = 44.8 bits (105), Expect = 0.004,   Method: Composition-based stats.
 Identities = 11/55 (20%), Positives = 24/55 (43%), Gaps = 4/55 (7%)

Query: 36  RVRIKQSLNN-VPIHIDDIIHH--TGIEAPVVYLVLLELDLAGRLCHHPE-GKVS 86
              +   + +   I +D+++      + +  ++  L EL+LAGR+   P    V 
Sbjct: 348 ERLVFARIRHDEAIQLDELMEQMEAELASAEIFTALFELELAGRVKALPGKNYVR 402


>gi|237801644|ref|ZP_04590105.1| DNA processing protein DprA [Pseudomonas syringae pv. oryzae str.
           1_6]
 gi|331024503|gb|EGI04559.1| DNA processing protein DprA [Pseudomonas syringae pv. oryzae str.
           1_6]
          Length = 371

 Score = 44.8 bits (105), Expect = 0.004,   Method: Composition-based stats.
 Identities = 12/63 (19%), Positives = 20/63 (31%)

Query: 26  THYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
              P         +   L+  P   + +   +G   P V   L EL+L GR+        
Sbjct: 308 APEPVRAAPCNHPLLALLHAAPHTSEGLSVSSGWPLPKVLAGLTELELDGRISSEAGRWF 367

Query: 86  SLT 88
           +  
Sbjct: 368 ARA 370


>gi|71066689|ref|YP_265416.1| DNA processing protein [Psychrobacter arcticus 273-4]
 gi|71039674|gb|AAZ19982.1| possible DNA processing protein [Psychrobacter arcticus 273-4]
          Length = 405

 Score = 44.8 bits (105), Expect = 0.004,   Method: Composition-based stats.
 Identities = 13/77 (16%), Positives = 28/77 (36%), Gaps = 1/77 (1%)

Query: 12  SSQSDTNHTKNINITHYPEYTQCER-VRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLE 70
              +    T++  I   P     E    + + L+     +D +I  T +    +   L+E
Sbjct: 329 PPTTSKKTTESHQIKPSPSINIPEHLTTLFEKLDWHGQDLDALILATNLAPAQLIGQLME 388

Query: 71  LDLAGRLCHHPEGKVSL 87
           L+L G +       + +
Sbjct: 389 LELVGAITVQGGRYLRI 405


>gi|262067707|ref|ZP_06027319.1| DNA protecting protein DprA [Fusobacterium periodonticum ATCC
           33693]
 gi|291378432|gb|EFE85950.1| DNA protecting protein DprA [Fusobacterium periodonticum ATCC
           33693]
          Length = 284

 Score = 44.4 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 11/51 (21%), Positives = 20/51 (39%), Gaps = 1/51 (1%)

Query: 36  RVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
           +  I  SL+      D I+  T I    +   L+ L++ G +     G+  
Sbjct: 232 QDLILNSLSTE-KSFDQILEETKIAQTEILSELINLEIMGLIKSIAGGRYK 281


>gi|319408534|emb|CBI82187.1| DNA processing chain A [Bartonella schoenbuchensis R1]
          Length = 404

 Score = 44.4 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 26/90 (28%), Positives = 45/90 (50%), Gaps = 3/90 (3%)

Query: 8   QNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLV 67
              F  +  +      + +        ER+ +  +L+  PI +D +  H+ I    +YL+
Sbjct: 314 PIQFQQEGFSLPNTETDKSAS-TRNDSERLAVLSALSTTPIDLDTLSSHSNIPLQNLYLL 372

Query: 68  LLELDLAGRLCHHPEGKVSLTMHLP--SPQ 95
           L+EL+LAG+L  H +G VSL+   P  +PQ
Sbjct: 373 LVELELAGKLIRHSDGCVSLSALNPPQAPQ 402


>gi|154500973|ref|ZP_02039011.1| hypothetical protein BACCAP_04659 [Bacteroides capillosus ATCC
           29799]
 gi|150269997|gb|EDM97516.1| hypothetical protein BACCAP_04659 [Bacteroides capillosus ATCC
           29799]
          Length = 408

 Score = 44.4 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 13/67 (19%), Positives = 22/67 (32%)

Query: 19  HTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLC 78
             +   IT        +   I  +L    +  DD++  T I A  V   L  L + G + 
Sbjct: 333 PDEMAYITLEDGALTDDERDILLALEGRGLRTDDLVELTQIPARRVSSALTMLQIHGYVE 392

Query: 79  HHPEGKV 85
                + 
Sbjct: 393 EKAGRRF 399


>gi|134102480|ref|YP_001108141.1| DNA processing chain A [Saccharopolyspora erythraea NRRL 2338]
 gi|291004129|ref|ZP_06562102.1| DNA processing chain A [Saccharopolyspora erythraea NRRL 2338]
 gi|133915103|emb|CAM05216.1| DNA processing chain A [Saccharopolyspora erythraea NRRL 2338]
          Length = 389

 Score = 44.4 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 11/73 (15%), Positives = 24/73 (32%), Gaps = 1/73 (1%)

Query: 8   QNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVP-IHIDDIIHHTGIEAPVVYL 66
           +   S       T         +       ++  +L++      D++   +G+    V  
Sbjct: 307 REVLSPLGVGPTTDLPVPAKATDSLDRVAKQLHDALSDSAATSADELARDSGLPLRKVRA 366

Query: 67  VLLELDLAGRLCH 79
           +L  L+LAG    
Sbjct: 367 LLPALELAGLAVR 379


>gi|16126686|ref|NP_421250.1| dprA protein [Caulobacter crescentus CB15]
 gi|221235465|ref|YP_002517902.1| DNA processing protein [Caulobacter crescentus NA1000]
 gi|13423992|gb|AAK24418.1| dprA protein [Caulobacter crescentus CB15]
 gi|220964638|gb|ACL95994.1| DNA processing protein [Caulobacter crescentus NA1000]
          Length = 365

 Score = 44.4 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 18/85 (21%), Positives = 31/85 (36%), Gaps = 5/85 (5%)

Query: 7   EQNFFSSQSDTNHTKNINITHYPEYT-----QCERVRIKQSLNNVPIHIDDIIHHTGIEA 61
            ++   S S   H +  +  +             R R+   L+  P+  +D++      A
Sbjct: 279 AEDVLRSLSGQTHLREQDRAYEALPDMDIDHDALRERVAALLSPTPVSRNDLVRAAAAPA 338

Query: 62  PVVYLVLLELDLAGRLCHHPEGKVS 86
             V   L+EL LA R      G V+
Sbjct: 339 SAVMAALVELSLARRAELLDGGMVA 363


>gi|169831256|ref|YP_001717238.1| selenocysteine-specific translation elongation factor [Candidatus
           Desulforudis audaxviator MP104C]
 gi|169638100|gb|ACA59606.1| selenocysteine-specific translation elongation factor [Candidatus
           Desulforudis audaxviator MP104C]
          Length = 635

 Score = 44.4 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 12/40 (30%), Positives = 19/40 (47%)

Query: 44  NNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEG 83
              P++ +++   TG+E   V  V  EL+  G L   P G
Sbjct: 391 GPAPLNENEVAQGTGLEPDTVAAVCRELEAGGALRRLPGG 430


>gi|258405017|ref|YP_003197759.1| DNA protecting protein DprA [Desulfohalobium retbaense DSM 5692]
 gi|257797244|gb|ACV68181.1| DNA protecting protein DprA [Desulfohalobium retbaense DSM 5692]
          Length = 395

 Score = 44.4 bits (104), Expect = 0.006,   Method: Composition-based stats.
 Identities = 9/90 (10%), Positives = 22/90 (24%), Gaps = 3/90 (3%)

Query: 2   VHPQIEQNFFSS--QSDTNHTKNINITHYPEYTQCERVRIKQSLNNVP-IHIDDIIHHTG 58
           + P +                                  +   L+    +H+D  +    
Sbjct: 298 LGPMVSVTSPRPGALPLDPPQDRSASELTWRGGSALENAVVARLSEEDRVHVDVFLRELA 357

Query: 59  IEAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
             +  +   LL L++   +   P    +L 
Sbjct: 358 DSSQAINHALLMLEMQEVVEKLPGMYYALA 387


>gi|300865695|ref|ZP_07110461.1| DNA processing protein [Oscillatoria sp. PCC 6506]
 gi|300336291|emb|CBN55611.1| DNA processing protein [Oscillatoria sp. PCC 6506]
          Length = 369

 Score = 44.4 bits (104), Expect = 0.006,   Method: Composition-based stats.
 Identities = 12/83 (14%), Positives = 31/83 (37%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVV 64
                  S+Q ++    ++   + P   + +  ++ +++       D I+   G+    V
Sbjct: 286 LDSAQLDSAQLNSPQQLSLFPENPPPILEPDLAKVLEAIPFESTVFDLIVERAGLAPGEV 345

Query: 65  YLVLLELDLAGRLCHHPEGKVSL 87
              LL+L+L   +   P  +   
Sbjct: 346 SSALLQLELLELVSQLPGMRYQR 368


>gi|317478243|ref|ZP_07937408.1| DNA recombination-mediator protein A [Bacteroides sp. 4_1_36]
 gi|316905550|gb|EFV27339.1| DNA recombination-mediator protein A [Bacteroides sp. 4_1_36]
          Length = 372

 Score = 44.1 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 14/77 (18%), Positives = 26/77 (33%), Gaps = 2/77 (2%)

Query: 13  SQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELD 72
            Q         N+       +   VRI     +  +HI+ ++    I    +  +L EL+
Sbjct: 298 EQPARTEGIQRNLFPELTEEEELVVRILMRQGD--LHINAMVVEADIPVNRMSALLFELE 355

Query: 73  LAGRLCHHPEGKVSLTM 89
           + G +     G   L  
Sbjct: 356 MKGVVKAMVGGVYHLLT 372


>gi|120403195|ref|YP_953024.1| transcriptional regulator, TrmB [Mycobacterium vanbaalenii PYR-1]
 gi|119956013|gb|ABM13018.1| DNA protecting protein DprA [Mycobacterium vanbaalenii PYR-1]
          Length = 379

 Score = 44.1 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 10/60 (16%), Positives = 22/60 (36%), Gaps = 1/60 (1%)

Query: 25  ITHYPEYTQCERVRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEG 83
                +     +  + ++L       +D+I   +G+ A  V   L  L++ G +  H   
Sbjct: 309 PVRPLDGLSGVQRLVYEALPARGARTVDEIGRDSGVPAAQVLGPLTILEIDGLVERHEGK 368


>gi|160891697|ref|ZP_02072700.1| hypothetical protein BACUNI_04152 [Bacteroides uniformis ATCC 8492]
 gi|156859104|gb|EDO52535.1| hypothetical protein BACUNI_04152 [Bacteroides uniformis ATCC 8492]
          Length = 372

 Score = 44.1 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 14/77 (18%), Positives = 26/77 (33%), Gaps = 2/77 (2%)

Query: 13  SQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELD 72
            Q         N+       +   VRI     +  +HI+ ++    I    +  +L EL+
Sbjct: 298 EQPARTEGIQRNLFPELTEEEELVVRILMRQGD--LHINAMVVEADIPVNRMSALLFELE 355

Query: 73  LAGRLCHHPEGKVSLTM 89
           + G +     G   L  
Sbjct: 356 MKGVVKAMVGGVYHLLT 372


>gi|220904239|ref|YP_002479551.1| DNA protecting protein DprA [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
 gi|219868538|gb|ACL48873.1| DNA protecting protein DprA [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
          Length = 442

 Score = 44.1 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 11/52 (21%), Positives = 24/52 (46%), Gaps = 1/52 (1%)

Query: 36  RVRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
           R  +   L    P+  DD+     I    + ++L+ L++ G++C  P  + +
Sbjct: 380 RAALLDCLRQRGPMQADDLACALDISVADLNVMLVGLEMLGQVCRLPGARYA 431


>gi|86131171|ref|ZP_01049770.1| Smf protein DNA processing chain A [Dokdonia donghaensis MED134]
 gi|85818582|gb|EAQ39742.1| Smf protein DNA processing chain A [Dokdonia donghaensis MED134]
          Length = 367

 Score = 44.1 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 9/58 (15%), Positives = 22/58 (37%), Gaps = 1/58 (1%)

Query: 31  YTQCERVRIKQSLNNVPIHI-DDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
               E   + + L +    + D I  +  +    +  +LL+++L G +   P     +
Sbjct: 309 ELTDEEKLVWRFLKDNGKELMDIIALNCKLPTYKIASILLQMELKGVIRPLPGKLFEI 366


>gi|313496441|gb|ADR57807.1| DprA [Pseudomonas putida BIRD-1]
          Length = 365

 Score = 44.1 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 11/62 (17%), Positives = 20/62 (32%)

Query: 27  HYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
             P         +   L+  P   + + H +      V   L EL+L GR+ +      +
Sbjct: 303 LPPAVMDRFDHPLLALLHAAPQTSESLAHCSEQPLADVLAQLTELELEGRVSNEAGRWFA 362

Query: 87  LT 88
             
Sbjct: 363 RA 364


>gi|94499924|ref|ZP_01306460.1| Smf protein [Oceanobacter sp. RED65]
 gi|94428125|gb|EAT13099.1| Smf protein [Oceanobacter sp. RED65]
          Length = 391

 Score = 44.1 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 12/54 (22%), Positives = 28/54 (51%)

Query: 29  PEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPE 82
           PE  Q E  ++ + L+   + ++ +I HTG+    +  +LL+++L   + +   
Sbjct: 327 PEGMQPEHYQVYRFLDQGGVGMEQLIQHTGLSVSKLNELLLDMELNMWVTNEQG 380


>gi|331011870|gb|EGH91926.1| DNA processing protein DprA [Pseudomonas syringae pv. tabaci ATCC
           11528]
          Length = 123

 Score = 44.1 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 11/55 (20%), Positives = 19/55 (34%)

Query: 34  CERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
                +   L+  P   + +   +G   P V   L EL+L GR+        +  
Sbjct: 68  PCDHPLLALLHAAPHTSEGLSVSSGWPLPKVLAGLTELELDGRISCEAGRWFARA 122


>gi|209524259|ref|ZP_03272809.1| DNA protecting protein DprA [Arthrospira maxima CS-328]
 gi|209495350|gb|EDZ95655.1| DNA protecting protein DprA [Arthrospira maxima CS-328]
          Length = 376

 Score = 44.1 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 12/88 (13%), Positives = 31/88 (35%)

Query: 1   MVHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIE 60
           ++          + +  +  +             +  +I  ++ + P   D I+  +G++
Sbjct: 289 LLEQLGAIPQLDTPTQLSILEQTKPRPESPNLDPDLAKILNAIASQPTPFDLIVEQSGMD 348

Query: 61  APVVYLVLLELDLAGRLCHHPEGKVSLT 88
           A  V   LL+L+L   +   P  +    
Sbjct: 349 AATVSSQLLQLELLELVTQLPGMRYQRA 376


>gi|317063578|ref|ZP_07928063.1| conserved hypothetical protein [Fusobacterium ulcerans ATCC 49185]
 gi|313689254|gb|EFS26089.1| conserved hypothetical protein [Fusobacterium ulcerans ATCC 49185]
          Length = 355

 Score = 44.1 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 10/52 (19%), Positives = 24/52 (46%), Gaps = 1/52 (1%)

Query: 36  RVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
             +I   L     ++D++I  +  +A  +  +L++L++   +   P GK   
Sbjct: 303 EEKIFFLLEKE-KNLDELILESSFKAGEILSILMDLEIKHAIVSIPGGKYRR 353


>gi|257469331|ref|ZP_05633425.1| Smf protein [Fusobacterium ulcerans ATCC 49185]
          Length = 352

 Score = 44.1 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 10/52 (19%), Positives = 24/52 (46%), Gaps = 1/52 (1%)

Query: 36  RVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
             +I   L     ++D++I  +  +A  +  +L++L++   +   P GK   
Sbjct: 300 EEKIFFLLEKE-KNLDELILESSFKAGEILSILMDLEIKHAIVSIPGGKYRR 350


>gi|229829215|ref|ZP_04455284.1| hypothetical protein GCWU000342_01302 [Shuttleworthia satelles DSM
           14600]
 gi|229792378|gb|EEP28492.1| hypothetical protein GCWU000342_01302 [Shuttleworthia satelles DSM
           14600]
          Length = 385

 Score = 44.1 bits (103), Expect = 0.007,   Method: Composition-based stats.
 Identities = 10/53 (18%), Positives = 22/53 (41%)

Query: 19  HTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLEL 71
           H +             E+ ++ Q L+  P+ +D ++  + ++      VL EL
Sbjct: 315 HFQPREDLRRLPPLTREQEKLYQCLDFYPMDLDQLVKRSELDYLQAVRVLTEL 367


>gi|160947178|ref|ZP_02094345.1| hypothetical protein PEPMIC_01111 [Parvimonas micra ATCC 33270]
 gi|158446312|gb|EDP23307.1| hypothetical protein PEPMIC_01111 [Parvimonas micra ATCC 33270]
          Length = 364

 Score = 44.1 bits (103), Expect = 0.007,   Method: Composition-based stats.
 Identities = 11/56 (19%), Positives = 19/56 (33%)

Query: 32  TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
              + + I   +N  P   + I   TG        +L  L+L G +     G   +
Sbjct: 308 LDAKELLIYNLINEEPKSQNKISTITGFSIIETNTILTALELKGFIKELNGGIFVV 363


>gi|254370427|ref|ZP_04986432.1| predicted protein [Francisella tularensis subsp. tularensis FSC033]
 gi|151568670|gb|EDN34324.1| predicted protein [Francisella tularensis subsp. tularensis FSC033]
          Length = 139

 Score = 44.1 bits (103), Expect = 0.007,   Method: Composition-based stats.
 Identities = 11/47 (23%), Positives = 18/47 (38%)

Query: 31  YTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRL 77
                   I  S++     ID II  + +    V  +L EL+L   +
Sbjct: 81  SLNESERIILGSIDRELTTIDKIIIKSKLPYNQVTSILFELELKSLI 127


>gi|120437576|ref|YP_863262.1| Smf family protein [Gramella forsetii KT0803]
 gi|117579726|emb|CAL68195.1| Smf family protein [Gramella forsetii KT0803]
          Length = 366

 Score = 44.1 bits (103), Expect = 0.007,   Method: Composition-based stats.
 Identities = 8/58 (13%), Positives = 20/58 (34%), Gaps = 1/58 (1%)

Query: 31  YTQCERVRIKQSLNNVP-IHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
             + +  R+ + L       +D +  +          +LL ++L G +   P     +
Sbjct: 308 ELEEDEQRLYEFLKLQGKTELDMVALNCNFPTFKTASLLLNMELKGAIRPLPGKLFEV 365


>gi|85711004|ref|ZP_01042065.1| Predicted Rossmann fold nucleotide-binding protein involved in DNA
           uptake [Idiomarina baltica OS145]
 gi|85695408|gb|EAQ33345.1| Predicted Rossmann fold nucleotide-binding protein involved in DNA
           uptake [Idiomarina baltica OS145]
          Length = 347

 Score = 44.1 bits (103), Expect = 0.007,   Method: Composition-based stats.
 Identities = 14/68 (20%), Positives = 30/68 (44%)

Query: 20  TKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCH 79
           ++    T            +  +++N P+ +D+++  TG+    V   LL L+L G +  
Sbjct: 277 SEPSQQTRCTIPKHLANNPLFANVSNDPVSLDELVERTGLSVAEVSEQLLLLELEGLITA 336

Query: 80  HPEGKVSL 87
            P G + +
Sbjct: 337 IPGGYIKV 344


>gi|326793338|ref|YP_004311158.1| DNA protecting protein DprA [Marinomonas mediterranea MMB-1]
 gi|326544102|gb|ADZ89322.1| DNA protecting protein DprA [Marinomonas mediterranea MMB-1]
          Length = 442

 Score = 44.1 bits (103), Expect = 0.007,   Method: Composition-based stats.
 Identities = 12/60 (20%), Positives = 25/60 (41%), Gaps = 2/60 (3%)

Query: 29  PEYTQCERVRIKQSLNNVPI--HIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
           P+Y   +   +   L+   +    D++I  T   AP +   L+EL+L   + +     + 
Sbjct: 382 PDYLSEDAKTVFSHLDRERVGLDFDELIRLTNWPAPNLMQTLMELELNSLISNQQGMYLK 441


>gi|254430794|ref|ZP_05044497.1| bacterial regulatory protein, ArsR family [Cyanobium sp. PCC
          7001]
 gi|197625247|gb|EDY37806.1| bacterial regulatory protein, ArsR family [Cyanobium sp. PCC
          7001]
          Length = 101

 Score = 44.1 bits (103), Expect = 0.007,   Method: Composition-based stats.
 Identities = 13/62 (20%), Positives = 31/62 (50%), Gaps = 1/62 (1%)

Query: 33 QCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHP-EGKVSLTMHL 91
          +  R+ + ++L + P+++  ++  TG+   +V   L  L +AG +   P    V   ++ 
Sbjct: 13 EPNRLAVLEALRHGPLNVTAVVERTGLSQALVSKHLKLLTIAGVVQRRPEGALVYYAVND 72

Query: 92 PS 93
          P+
Sbjct: 73 PA 74


>gi|26986814|ref|NP_742239.1| DNA protecting protein DprA [Pseudomonas putida KT2440]
 gi|24981411|gb|AAN65703.1|AE016197_1 smf protein [Pseudomonas putida KT2440]
          Length = 365

 Score = 44.1 bits (103), Expect = 0.007,   Method: Composition-based stats.
 Identities = 11/62 (17%), Positives = 20/62 (32%)

Query: 27  HYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
             P         +   L+  P   + + H +      V   L EL+L GR+ +      +
Sbjct: 303 LPPAVVDKFDHPLLALLHAAPQTSESLAHCSEQPLADVLAQLTELELEGRVSNEAGRWFA 362

Query: 87  LT 88
             
Sbjct: 363 RA 364


>gi|210610054|ref|ZP_03288233.1| hypothetical protein CLONEX_00419 [Clostridium nexile DSM 1787]
 gi|210152665|gb|EEA83671.1| hypothetical protein CLONEX_00419 [Clostridium nexile DSM 1787]
          Length = 358

 Score = 44.1 bits (103), Expect = 0.007,   Method: Composition-based stats.
 Identities = 13/74 (17%), Positives = 29/74 (39%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVV 64
              ++     S     K   +T      +     +   L+  P +++++   TG+  P +
Sbjct: 274 LSPEDLLEELSFVCEEKVKKLTENKIALESPENLVYSCLDLYPKNLNELADLTGLTIPAL 333

Query: 65  YLVLLELDLAGRLC 78
             VL+ L+L G + 
Sbjct: 334 MDVLVSLELQGYIR 347


>gi|254519203|ref|ZP_05131259.1| SMF family protein [Clostridium sp. 7_2_43FAA]
 gi|226912952|gb|EEH98153.1| SMF family protein [Clostridium sp. 7_2_43FAA]
          Length = 348

 Score = 43.7 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 11/51 (21%), Positives = 26/51 (50%)

Query: 39  IKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTM 89
           + + ++N P H+DDII    ++  V++ +L E+     +   P    + ++
Sbjct: 298 LLKVIDNEPKHLDDIIESVNVDRKVLFELLFEMQNRNEIICLPGNYYAKSL 348


>gi|157283995|ref|YP_001468263.1| hypothetical protein Krad_4681 [Kineococcus radiotolerans SRS30216]
 gi|151363137|gb|ABS06139.1| hypothetical protein Krad_4681 [Kineococcus radiotolerans SRS30216]
          Length = 147

 Score = 43.7 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 14/68 (20%), Positives = 20/68 (29%), Gaps = 1/68 (1%)

Query: 15  SDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLA 74
                         P        RI   L+  PI    ++  TGI+   +   LL+L   
Sbjct: 74  EPEGARGTFEPPAAPLPADTL-DRIVGCLHRDPIAFGVLVERTGIDVDTLRAGLLQLQKQ 132

Query: 75  GRLCHHPE 82
           GR      
Sbjct: 133 GRADIDYG 140


>gi|310816234|ref|YP_003964198.1| DNA processing protein DprA, putative [Ketogulonicigenium vulgare
           Y25]
 gi|308754969|gb|ADO42898.1| DNA processing protein DprA, putative [Ketogulonicigenium vulgare
           Y25]
          Length = 358

 Score = 43.7 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 16/72 (22%), Positives = 28/72 (38%)

Query: 16  DTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAG 75
           D    +       P        RI   ++  P+    +    GI+A  + L L++L+L G
Sbjct: 282 DAPPPQAALALSAPLSLADPSARILAQISASPVPEHVLRDTLGIDARSLSLALIDLELDG 341

Query: 76  RLCHHPEGKVSL 87
            +     G V+L
Sbjct: 342 AIHRPSSGLVAL 353


>gi|310641535|ref|YP_003946293.1| DNA protecting protein dpra [Paenibacillus polymyxa SC2]
 gi|309246485|gb|ADO56052.1| DNA protecting protein DprA [Paenibacillus polymyxa SC2]
          Length = 409

 Score = 43.7 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 13/62 (20%), Positives = 26/62 (41%)

Query: 26  THYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
           +   E    E  R+   L    + +D+++  T  +  +++ VLL L +  R+      K 
Sbjct: 347 SKASESETSEEKRVVLLLEQGTMTLDELLDATAWDFGLLHAVLLSLIIKKRIAQLAGTKY 406

Query: 86  SL 87
            L
Sbjct: 407 KL 408


>gi|325286330|ref|YP_004262120.1| DNA protecting protein DprA [Cellulophaga lytica DSM 7489]
 gi|324321784|gb|ADY29249.1| DNA protecting protein DprA [Cellulophaga lytica DSM 7489]
          Length = 366

 Score = 43.7 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 9/51 (17%), Positives = 15/51 (29%), Gaps = 1/51 (1%)

Query: 36  RVRIKQSLNNVPIHI-DDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
             +I   L      + D I     I        LL +++ G +   P    
Sbjct: 313 EQQIHSFLQTEGKQLLDTIALACNIPVFKTSSTLLNMEMKGAIRPLPGKLF 363


>gi|313678964|ref|YP_004056703.1| DNA protecting protein dpra [Oceanithermus profundus DSM 14977]
 gi|313151679|gb|ADR35530.1| DNA protecting protein DprA [Oceanithermus profundus DSM 14977]
          Length = 341

 Score = 43.7 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 13/64 (20%), Positives = 25/64 (39%), Gaps = 2/64 (3%)

Query: 23  INITHYPEYTQCERVRIKQSLNNVPIHI-DDIIHHTGIEAPVVYLVLLELDLAGRLCHHP 81
                 PE        + ++L      + DD+     + A  V  +L +L+L+G +   P
Sbjct: 275 APRPDRPEPEGAA-GALWEALRRRGEALPDDLALDLNLGAAEVLGLLTQLELSGHVRALP 333

Query: 82  EGKV 85
            G+ 
Sbjct: 334 GGRY 337


>gi|328907959|gb|EGG27719.1| DNA protecting protein DprA [Propionibacterium sp. P08]
          Length = 391

 Score = 43.7 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 9/76 (11%), Positives = 25/76 (32%), Gaps = 1/76 (1%)

Query: 15  SDTNHTKNINITHYPEYTQCERVRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLLELDL 73
                 +    +   +      + + ++L  +    +D++    G+        L  L+ 
Sbjct: 311 LAPEPERPAGRSLPTDILDATELAVHEALPAHGSCGLDELAALAGVPIAQCSAALTVLEQ 370

Query: 74  AGRLCHHPEGKVSLTM 89
            G      +G  S+T+
Sbjct: 371 LGMAACCLDGTWSVTL 386


>gi|253579631|ref|ZP_04856900.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39B_FAA]
 gi|251849132|gb|EES77093.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39BFAA]
          Length = 305

 Score = 43.7 bits (102), Expect = 0.009,   Method: Composition-based stats.
 Identities = 12/44 (27%), Positives = 19/44 (43%)

Query: 35  ERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLC 78
           +   +   L+  P + D I+  TG     V   L+EL L G + 
Sbjct: 251 DLNMVYSCLDLRPKNPDYIVRKTGFSPAQVSNCLVELTLRGLIR 294


>gi|148545342|ref|YP_001265444.1| DNA protecting protein DprA [Pseudomonas putida F1]
 gi|148509400|gb|ABQ76260.1| DNA protecting protein DprA [Pseudomonas putida F1]
          Length = 365

 Score = 43.7 bits (102), Expect = 0.009,   Method: Composition-based stats.
 Identities = 11/62 (17%), Positives = 20/62 (32%)

Query: 27  HYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
             P         +   L+  P   + + H +      V   L EL+L GR+ +      +
Sbjct: 303 LPPAVVDRFDHPLLALLHAAPQTSESLAHCSEQPLADVLAQLTELELEGRVSNEAGRWFA 362

Query: 87  LT 88
             
Sbjct: 363 RA 364


>gi|304404235|ref|ZP_07385897.1| DNA protecting protein DprA [Paenibacillus curdlanolyticus YK9]
 gi|304347213|gb|EFM13045.1| DNA protecting protein DprA [Paenibacillus curdlanolyticus YK9]
          Length = 370

 Score = 43.7 bits (102), Expect = 0.009,   Method: Composition-based stats.
 Identities = 9/58 (15%), Positives = 24/58 (41%)

Query: 30  EYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           E    +   + + L + P   D++   TG+    ++ VL+ L +  ++        ++
Sbjct: 312 ESLSEDERSVYEILLDQPCSADELHELTGMSLGHLHAVLINLCINRKVQQQHGATYTV 369


>gi|167767275|ref|ZP_02439328.1| hypothetical protein CLOSS21_01794 [Clostridium sp. SS2/1]
 gi|317497303|ref|ZP_07955626.1| DNA protecting protein DprA [Lachnospiraceae bacterium 5_1_63FAA]
 gi|167711250|gb|EDS21829.1| hypothetical protein CLOSS21_01794 [Clostridium sp. SS2/1]
 gi|291559414|emb|CBL38214.1| DNA protecting protein DprA [butyrate-producing bacterium SSC/2]
 gi|316895372|gb|EFV17531.1| DNA protecting protein DprA [Lachnospiraceae bacterium 5_1_63FAA]
          Length = 360

 Score = 43.7 bits (102), Expect = 0.009,   Method: Composition-based stats.
 Identities = 11/61 (18%), Positives = 22/61 (36%)

Query: 25  ITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGK 84
             H  +       R+   L+  P +ID+I+  +      V   L +L+  G +    +  
Sbjct: 296 PKHSAKSLAKAEKRVYDMLSLKPKYIDEILSTSQDSYEEVIQALFQLEAKGYIKQIHQNL 355

Query: 85  V 85
            
Sbjct: 356 Y 356


>gi|118617634|ref|YP_905966.1| hypothetical protein MUL_2062 [Mycobacterium ulcerans Agy99]
 gi|118569744|gb|ABL04495.1| conserved hypothetical membrane protein [Mycobacterium ulcerans
           Agy99]
          Length = 391

 Score = 43.7 bits (102), Expect = 0.009,   Method: Composition-based stats.
 Identities = 14/82 (17%), Positives = 29/82 (35%), Gaps = 2/82 (2%)

Query: 7   EQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSL-NNVPIHIDDIIHHTGIEAPVVY 65
           E      +      +    T   +       ++ ++L     + +D+I   +G+ A  V 
Sbjct: 293 EIVELVGRIGELSLEQSRPTSVLDGLSQSESQVYEALPGRGAMSVDEIAVASGLVAEQVM 352

Query: 66  LVLLELDLAGRLCHHPEGKVSL 87
             L  L++AG       G+  L
Sbjct: 353 GRLAILEVAGLAERD-GGRWRL 373


>gi|310288071|ref|YP_003939330.1| transcription regulator ArsR [Bifidobacterium bifidum S17]
 gi|309252008|gb|ADO53756.1| transcription regulator ArsR [Bifidobacterium bifidum S17]
          Length = 201

 Score = 43.7 bits (102), Expect = 0.009,   Method: Composition-based stats.
 Identities = 14/71 (19%), Positives = 26/71 (36%), Gaps = 1/71 (1%)

Query: 12 SSQSDTNHTKNINITHYPEYTQCERVRIKQSLNN-VPIHIDDIIHHTGIEAPVVYLVLLE 70
          +     N     +       +   R+RI   +++  P+ +  I    G  A  V   L +
Sbjct: 12 TPPRRDNPATVTDTNRLKALSHPTRLRILTVMSDTEPVTVGQIAEQLGESAGTVSYHLKQ 71

Query: 71 LDLAGRLCHHP 81
          L+ AG +   P
Sbjct: 72 LEKAGFVTQTP 82


>gi|169630293|ref|YP_001703942.1| hypothetical protein MAB_3212c [Mycobacterium abscessus ATCC 19977]
 gi|169242260|emb|CAM63288.1| Conserved hypothetical protein [Mycobacterium abscessus]
          Length = 378

 Score = 43.7 bits (102), Expect = 0.010,   Method: Composition-based stats.
 Identities = 7/73 (9%), Positives = 22/73 (30%), Gaps = 1/73 (1%)

Query: 11  FSSQSDTNHTKNINITHYPEYTQCERVRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLL 69
            + +               +    +  R+ ++L       + +++  +G+    V   L 
Sbjct: 295 LAGRLGEFTAAPDRPGSVIDGLGDDEKRVYEALPGRGSTTVRELVRESGLSVGRVQGALA 354

Query: 70  ELDLAGRLCHHPE 82
            L+L   +     
Sbjct: 355 ILELEQLVIDVAG 367


>gi|260438814|ref|ZP_05792630.1| DNA processing protein DprA [Butyrivibrio crossotus DSM 2876]
 gi|292808803|gb|EFF68008.1| DNA processing protein DprA [Butyrivibrio crossotus DSM 2876]
          Length = 360

 Score = 43.7 bits (102), Expect = 0.010,   Method: Composition-based stats.
 Identities = 7/45 (15%), Positives = 20/45 (44%), Gaps = 1/45 (2%)

Query: 35  ERVRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLC 78
           +   +   L +  P  ++ +++ +G+    V   L  L++ G + 
Sbjct: 305 DEKMLYSLLLDFTPKSLETLVNDSGMSPAEVLRSLTCLEIKGIIR 349


>gi|331090295|ref|ZP_08339180.1| hypothetical protein HMPREF1025_02763 [Lachnospiraceae bacterium
           3_1_46FAA]
 gi|330401581|gb|EGG81163.1| hypothetical protein HMPREF1025_02763 [Lachnospiraceae bacterium
           3_1_46FAA]
          Length = 160

 Score = 43.7 bits (102), Expect = 0.010,   Method: Composition-based stats.
 Identities = 12/74 (16%), Positives = 28/74 (37%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVV 64
            +    F  +   +  K        +  + +   +   L   P  +++I+  T +E   V
Sbjct: 77  LLSPEMFLEELGLSGKKTEKEGKNKKMLETQEELLYSCLGLYPKSVEEILKETKLEVRQV 136

Query: 65  YLVLLELDLAGRLC 78
             +L+ L+L G + 
Sbjct: 137 MEILVSLELRGYIR 150


>gi|240129161|ref|ZP_04741822.1| DprA [Neisseria gonorrhoeae SK-93-1035]
 gi|268687544|ref|ZP_06154406.1| DNA processing chain A [Neisseria gonorrhoeae SK-93-1035]
 gi|268627828|gb|EEZ60228.1| DNA processing chain A [Neisseria gonorrhoeae SK-93-1035]
          Length = 398

 Score = 43.7 bits (102), Expect = 0.010,   Method: Composition-based stats.
 Identities = 15/74 (20%), Positives = 25/74 (33%)

Query: 14  QSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDL 73
           Q+         +             I   +   P+H D +     + A  +Y  LLEL+L
Sbjct: 322 QTAYAPPPAAKMPSEGAAGGTAVGGILDKMGFDPVHPDVLAGQLAMPAADLYAALLELEL 381

Query: 74  AGRLCHHPEGKVSL 87
            G +   P G+   
Sbjct: 382 DGSVAAMPGGRYQR 395


>gi|288870966|ref|ZP_06115945.2| DNA processing protein DprA [Clostridium hathewayi DSM 13479]
 gi|288865235|gb|EFC97533.1| DNA processing protein DprA [Clostridium hathewayi DSM 13479]
          Length = 367

 Score = 43.7 bits (102), Expect = 0.010,   Method: Composition-based stats.
 Identities = 9/44 (20%), Positives = 20/44 (45%)

Query: 36  RVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCH 79
              +   L+  P  +++I+  +G+        LL+L+L G +  
Sbjct: 314 EKMVYSCLDLQPKGLEEIVILSGLSVSECIGTLLDLELGGYVVQ 357


>gi|115379506|ref|ZP_01466600.1| topoisomerase [Stigmatella aurantiaca DW4/3-1]
 gi|310822350|ref|YP_003954708.1| smf family protein [Stigmatella aurantiaca DW4/3-1]
 gi|115363484|gb|EAU62625.1| topoisomerase [Stigmatella aurantiaca DW4/3-1]
 gi|309395422|gb|ADO72881.1| SMF family protein [Stigmatella aurantiaca DW4/3-1]
          Length = 373

 Score = 43.7 bits (102), Expect = 0.010,   Method: Composition-based stats.
 Identities = 13/58 (22%), Positives = 24/58 (41%)

Query: 30  EYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           E    E     + L+ VP   ++++    +    +   L+EL+L+G L  HP      
Sbjct: 315 EVLSAEAKGAYEVLDRVPRTFEEVLAAVRLSPAALASALVELELSGLLIQHPGRLFER 372


>gi|291286767|ref|YP_003503583.1| DNA protecting protein DprA [Denitrovibrio acetiphilus DSM 12809]
 gi|290883927|gb|ADD67627.1| DNA protecting protein DprA [Denitrovibrio acetiphilus DSM 12809]
          Length = 379

 Score = 43.3 bits (101), Expect = 0.010,   Method: Composition-based stats.
 Identities = 12/65 (18%), Positives = 29/65 (44%)

Query: 22  NINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHP 81
           +   T   E+   E+ ++   L    ++ D++   +G +   V + L +++L G +    
Sbjct: 298 DKQETSVLEFGSPEQAKLFDLLMRGTLNPDELSAMSGFDIESVVINLAQMELEGYVFREI 357

Query: 82  EGKVS 86
           +GK  
Sbjct: 358 DGKYR 362


>gi|146296271|ref|YP_001180042.1| DNA protecting protein DprA [Caldicellulosiruptor saccharolyticus
           DSM 8903]
 gi|145409847|gb|ABP66851.1| DNA protecting protein DprA [Caldicellulosiruptor saccharolyticus
           DSM 8903]
          Length = 380

 Score = 43.3 bits (101), Expect = 0.010,   Method: Composition-based stats.
 Identities = 10/50 (20%), Positives = 22/50 (44%), Gaps = 2/50 (4%)

Query: 38  RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           ++  S+     HI+++I  T   A  V  V+  L++ G++       +  
Sbjct: 332 KLLDSVGEA--HIENLILLTNWSAGKVASVITSLEIKGKVVRERGNVIVR 379


>gi|108805606|ref|YP_645543.1| putative transcriptional regulator [Rubrobacter xylanophilus DSM
          9941]
 gi|108766849|gb|ABG05731.1| putative transcriptional regulator [Rubrobacter xylanophilus DSM
          9941]
          Length = 216

 Score = 43.3 bits (101), Expect = 0.010,   Method: Composition-based stats.
 Identities = 13/61 (21%), Positives = 19/61 (31%), Gaps = 2/61 (3%)

Query: 34 CERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHLPS 93
            R RI   L      +D++    G+    V   L  L+  G +     G V        
Sbjct: 12 STRGRIVVLLRRASRRVDELARELGLTDNAVRAHLAALERDGVVRQ--GGTVRRGRGAGK 69

Query: 94 P 94
          P
Sbjct: 70 P 70


>gi|309378540|emb|CBX22812.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 397

 Score = 43.3 bits (101), Expect = 0.011,   Method: Composition-based stats.
 Identities = 14/72 (19%), Positives = 25/72 (34%)

Query: 16  DTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAG 75
               +    +         +   I   +   P+H D +     + A  +Y  LLEL+L G
Sbjct: 323 APPPSPEGKMPSEGAACGTDPGGILDKMGFDPVHPDVLAGQLAMPAADLYAALLELELDG 382

Query: 76  RLCHHPEGKVSL 87
            +   P G+   
Sbjct: 383 SVAAMPGGRYQR 394


>gi|319411401|emb|CBY91812.1| Smf protein (DNA processing chain A) [Neisseria meningitidis WUE
           2594]
          Length = 395

 Score = 43.3 bits (101), Expect = 0.011,   Method: Composition-based stats.
 Identities = 16/74 (21%), Positives = 25/74 (33%)

Query: 14  QSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDL 73
           Q+         +             I   +   PIH D +     + A  +Y  LLEL+L
Sbjct: 319 QTAYAPPPAAKMPSEAAAGGTAVGGILDKMGFDPIHPDVLAGQLAMPAADLYAALLELEL 378

Query: 74  AGRLCHHPEGKVSL 87
            G +   P G+   
Sbjct: 379 DGSVAAMPGGRYQR 392


>gi|261391654|emb|CAX49102.1| Smf protein (DNA processing chain A) [Neisseria meningitidis 8013]
          Length = 395

 Score = 43.3 bits (101), Expect = 0.011,   Method: Composition-based stats.
 Identities = 16/74 (21%), Positives = 25/74 (33%)

Query: 14  QSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDL 73
           Q+         +             I   +   PIH D +     + A  +Y  LLEL+L
Sbjct: 319 QTAYAPPPAAKMPSEGAAGGTAVGGILDKMGFDPIHPDVLAGQLAMPAADLYAALLELEL 378

Query: 74  AGRLCHHPEGKVSL 87
            G +   P G+   
Sbjct: 379 DGSVAAMPGGRYQR 392


>gi|326204632|ref|ZP_08194488.1| DNA protecting protein DprA [Clostridium papyrosolvens DSM 2782]
 gi|325985199|gb|EGD46039.1| DNA protecting protein DprA [Clostridium papyrosolvens DSM 2782]
          Length = 374

 Score = 43.3 bits (101), Expect = 0.011,   Method: Composition-based stats.
 Identities = 10/56 (17%), Positives = 25/56 (44%)

Query: 32  TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
              + ++I + +     +ID+I+  + I A     +L  L++ G +  +P     +
Sbjct: 317 LTTDEIKILKVILMGAHNIDEILVRSNISAKDANSILFMLEMKGIIGQNPGKSFEV 372


>gi|182412005|ref|YP_001817071.1| DNA protecting protein DprA [Opitutus terrae PB90-1]
 gi|177839219|gb|ACB73471.1| DNA protecting protein DprA [Opitutus terrae PB90-1]
          Length = 382

 Score = 43.3 bits (101), Expect = 0.011,   Method: Composition-based stats.
 Identities = 12/81 (14%), Positives = 25/81 (30%), Gaps = 1/81 (1%)

Query: 6   IEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSL-NNVPIHIDDIIHHTGIEAPVV 64
           +       +  +   ++            E   I +       +  D II  T + +P V
Sbjct: 298 LRPAAIPPKEGSADPESALGVTPSTALTPEEAAIWECFRGGAMLTPDAIIAQTRLGSPQV 357

Query: 65  YLVLLELDLAGRLCHHPEGKV 85
              L+ L+L   +    +G  
Sbjct: 358 SAALMMLELKRLIAKRSDGAF 378


>gi|294101717|ref|YP_003553575.1| transcriptional regulator, IclR family [Aminobacterium
          colombiense DSM 12261]
 gi|293616697|gb|ADE56851.1| transcriptional regulator, IclR family [Aminobacterium
          colombiense DSM 12261]
          Length = 259

 Score = 43.3 bits (101), Expect = 0.011,   Method: Composition-based stats.
 Identities = 15/54 (27%), Positives = 25/54 (46%), Gaps = 3/54 (5%)

Query: 39 IKQSLNNV--PIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEG-KVSLTM 89
          I ++L     P+ I +I   TG+     + ++L L+  G L   P+  K  L M
Sbjct: 17 IVEALGKEKTPLGIGEISRLTGLSKSTTHRLVLTLESRGWLKRLPDNDKYCLGM 70


>gi|297565482|ref|YP_003684454.1| DNA protecting protein DprA [Meiothermus silvanus DSM 9946]
 gi|296849931|gb|ADH62946.1| DNA protecting protein DprA [Meiothermus silvanus DSM 9946]
          Length = 338

 Score = 43.3 bits (101), Expect = 0.011,   Method: Composition-based stats.
 Identities = 12/62 (19%), Positives = 20/62 (32%), Gaps = 1/62 (1%)

Query: 25  ITHYPEYTQCERVRIKQ-SLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEG 83
             + P   +     + +  L       DD+     +    V  VL  L+L G     P G
Sbjct: 274 PRNPPVALEGREASVYRTLLEMGETLPDDLALSLDLPLSEVLAVLSMLELKGHALSLPGG 333

Query: 84  KV 85
           + 
Sbjct: 334 RY 335


>gi|89889674|ref|ZP_01201185.1| Smf protein, DNA processing chain A [Flavobacteria bacterium BBFL7]
 gi|89517947|gb|EAS20603.1| Smf protein, DNA  processing chain A [Flavobacteria bacterium
           BBFL7]
          Length = 364

 Score = 43.3 bits (101), Expect = 0.011,   Method: Composition-based stats.
 Identities = 9/38 (23%), Positives = 16/38 (42%)

Query: 50  IDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           +D I  +    A  V  +L+ ++L G +   P     L
Sbjct: 326 LDIIAININKPAHQVASLLMSMELKGVIKPLPGKMFML 363


>gi|332289297|ref|YP_004420149.1| DNA protecting protein DprA [Gallibacterium anatis UMN179]
 gi|330432193|gb|AEC17252.1| DNA protecting protein DprA [Gallibacterium anatis UMN179]
          Length = 398

 Score = 43.3 bits (101), Expect = 0.011,   Method: Composition-based stats.
 Identities = 10/54 (18%), Positives = 20/54 (37%), Gaps = 1/54 (1%)

Query: 34  CERVRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
            +   + Q L +   I  D++          +   LLEL++ G +     G + 
Sbjct: 342 PQHQALMQQLNSATAISPDELSTALNRPIDQILTDLLELEILGAVQQIQGGYIK 395


>gi|254494747|ref|ZP_05107918.1| DNA processing chain A [Neisseria gonorrhoeae 1291]
 gi|226513787|gb|EEH63132.1| DNA processing chain A [Neisseria gonorrhoeae 1291]
          Length = 395

 Score = 43.3 bits (101), Expect = 0.011,   Method: Composition-based stats.
 Identities = 15/74 (20%), Positives = 25/74 (33%)

Query: 14  QSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDL 73
           Q+         +             I   +   P+H D +     + A  +Y  LLEL+L
Sbjct: 319 QTAYAPPPAAKMPSEGAAGGTAVGGILDKMGFDPVHPDVLAGQLAMPAADLYAALLELEL 378

Query: 74  AGRLCHHPEGKVSL 87
            G +   P G+   
Sbjct: 379 DGSVAAMPGGRYQR 392


>gi|59802185|ref|YP_208897.1| hypothetical protein NGO1865 [Neisseria gonorrhoeae FA 1090]
 gi|293398230|ref|ZP_06642435.1| DNA processing protein [Neisseria gonorrhoeae F62]
 gi|59719080|gb|AAW90485.1| putative DNA processing chain A [Neisseria gonorrhoeae FA 1090]
 gi|291611493|gb|EFF40563.1| DNA processing protein [Neisseria gonorrhoeae F62]
          Length = 395

 Score = 43.3 bits (101), Expect = 0.011,   Method: Composition-based stats.
 Identities = 15/74 (20%), Positives = 25/74 (33%)

Query: 14  QSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDL 73
           Q+         +             I   +   P+H D +     + A  +Y  LLEL+L
Sbjct: 319 QTAYAPPPAAKMPSEGAAGGTAVGGILDKMGFDPVHPDVLAGQLAMPAADLYAALLELEL 378

Query: 74  AGRLCHHPEGKVSL 87
            G +   P G+   
Sbjct: 379 DGSVAAMPGGRYQR 392


>gi|331091326|ref|ZP_08340166.1| hypothetical protein HMPREF9477_00809 [Lachnospiraceae bacterium
           2_1_46FAA]
 gi|330404487|gb|EGG84031.1| hypothetical protein HMPREF9477_00809 [Lachnospiraceae bacterium
           2_1_46FAA]
          Length = 361

 Score = 43.3 bits (101), Expect = 0.011,   Method: Composition-based stats.
 Identities = 10/81 (12%), Positives = 27/81 (33%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVV 64
              Q+       +               + E   +   L+  P +++ ++  T +E P +
Sbjct: 277 LSPQDLLDELRISTKEDVKKKLKSKISLETEENMVYSCLDLYPKNVNQLMMETKMEIPQL 336

Query: 65  YLVLLELDLAGRLCHHPEGKV 85
              L+ L++ G +    +   
Sbjct: 337 INQLVSLEMQGYIREISKNYY 357


>gi|325138795|gb|EGC61347.1| putative DNA processing protein DprA [Neisseria meningitidis
           ES14902]
          Length = 395

 Score = 43.3 bits (101), Expect = 0.011,   Method: Composition-based stats.
 Identities = 16/74 (21%), Positives = 25/74 (33%)

Query: 14  QSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDL 73
           Q+         +             I   +   PIH D +     + A  +Y  LLEL+L
Sbjct: 319 QTAYAPPPAAKMPSEGAAGGTAVGGILDKMGFDPIHPDVLAGQLAMPAADLYAALLELEL 378

Query: 74  AGRLCHHPEGKVSL 87
            G +   P G+   
Sbjct: 379 DGSVAAMPGGRYQR 392


>gi|240124486|ref|ZP_04737442.1| DprA [Neisseria gonorrhoeae PID332]
 gi|317165352|gb|ADV08893.1| DprA [Neisseria gonorrhoeae TCDC-NG08107]
          Length = 398

 Score = 43.3 bits (101), Expect = 0.011,   Method: Composition-based stats.
 Identities = 16/74 (21%), Positives = 25/74 (33%)

Query: 14  QSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDL 73
           Q+         +             I   +   PIH D +     + A  +Y  LLEL+L
Sbjct: 322 QTAYAPPPAAKMPSEGAAGGTAVGGILDKMGFDPIHPDVLAGQLAMPAADLYAALLELEL 381

Query: 74  AGRLCHHPEGKVSL 87
            G +   P G+   
Sbjct: 382 DGSVAAMPGGRYQR 395


>gi|240116726|ref|ZP_04730788.1| DprA [Neisseria gonorrhoeae PID18]
 gi|268602397|ref|ZP_06136564.1| DNA processing chain A [Neisseria gonorrhoeae PID18]
 gi|268586528|gb|EEZ51204.1| DNA processing chain A [Neisseria gonorrhoeae PID18]
          Length = 398

 Score = 43.3 bits (101), Expect = 0.011,   Method: Composition-based stats.
 Identities = 16/74 (21%), Positives = 25/74 (33%)

Query: 14  QSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDL 73
           Q+         +             I   +   PIH D +     + A  +Y  LLEL+L
Sbjct: 322 QTAYAPPPAAKMPSEGAAGGTAVGGILDKMGFDPIHPDVLAGQLAMPAADLYAALLELEL 381

Query: 74  AGRLCHHPEGKVSL 87
            G +   P G+   
Sbjct: 382 DGSVAAMPGGRYQR 395


>gi|239997897|ref|ZP_04717821.1| DprA [Neisseria gonorrhoeae 35/02]
          Length = 398

 Score = 43.3 bits (101), Expect = 0.011,   Method: Composition-based stats.
 Identities = 16/74 (21%), Positives = 25/74 (33%)

Query: 14  QSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDL 73
           Q+         +             I   +   PIH D +     + A  +Y  LLEL+L
Sbjct: 322 QTAYAPPPAAKMPSEGAAGGTAVGGILDKMGFDPIHPDVLAGQLAMPAADLYAALLELEL 381

Query: 74  AGRLCHHPEGKVSL 87
            G +   P G+   
Sbjct: 382 DGSVAAMPGGRYQR 395


>gi|197303737|ref|ZP_03168774.1| hypothetical protein RUMLAC_02466 [Ruminococcus lactaris ATCC
           29176]
 gi|197297257|gb|EDY31820.1| hypothetical protein RUMLAC_02466 [Ruminococcus lactaris ATCC
           29176]
          Length = 366

 Score = 43.3 bits (101), Expect = 0.011,   Method: Composition-based stats.
 Identities = 10/54 (18%), Positives = 24/54 (44%)

Query: 32  TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
            + E   +   +   P +++ ++  TG+E   +  VL+ L+L G +    +   
Sbjct: 310 LESEDELVYSCVGLYPKNVEHLVLETGLEIRKLMRVLVSLELQGYIKEVSKNYY 363


>gi|194099892|ref|YP_002003029.1| DprA [Neisseria gonorrhoeae NCCP11945]
 gi|240015122|ref|ZP_04722035.1| DprA [Neisseria gonorrhoeae DGI18]
 gi|240017572|ref|ZP_04724112.1| DprA [Neisseria gonorrhoeae FA6140]
 gi|240113990|ref|ZP_04728480.1| DprA [Neisseria gonorrhoeae MS11]
 gi|240122193|ref|ZP_04735155.1| DprA [Neisseria gonorrhoeae PID24-1]
 gi|268600055|ref|ZP_06134222.1| DNA processing chain A [Neisseria gonorrhoeae MS11]
 gi|193935182|gb|ACF31006.1| DprA [Neisseria gonorrhoeae NCCP11945]
 gi|268584186|gb|EEZ48862.1| DNA processing chain A [Neisseria gonorrhoeae MS11]
          Length = 398

 Score = 43.3 bits (101), Expect = 0.011,   Method: Composition-based stats.
 Identities = 16/74 (21%), Positives = 25/74 (33%)

Query: 14  QSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDL 73
           Q+         +             I   +   PIH D +     + A  +Y  LLEL+L
Sbjct: 322 QTAYAPPPAAKMPSEGAAGGTAVGGILDKMGFDPIHPDVLAGQLAMPAADLYAALLELEL 381

Query: 74  AGRLCHHPEGKVSL 87
            G +   P G+   
Sbjct: 382 DGSVAAMPGGRYQR 395


>gi|240118948|ref|ZP_04733010.1| DprA [Neisseria gonorrhoeae PID1]
          Length = 398

 Score = 43.3 bits (101), Expect = 0.012,   Method: Composition-based stats.
 Identities = 16/74 (21%), Positives = 25/74 (33%)

Query: 14  QSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDL 73
           Q+         +             I   +   PIH D +     + A  +Y  LLEL+L
Sbjct: 322 QTAYAPPPAAKMPSEGAAGGTAVGGILDKMGFDPIHPDVLAGQLAMPAADLYAALLELEL 381

Query: 74  AGRLCHHPEGKVSL 87
            G +   P G+   
Sbjct: 382 DGSVAAMPGGRYQR 395


>gi|313836671|gb|EFS74385.1| DNA protecting protein DprA [Propionibacterium acnes HL037PA2]
 gi|314928178|gb|EFS92009.1| DNA protecting protein DprA [Propionibacterium acnes HL044PA1]
 gi|314972177|gb|EFT16274.1| DNA protecting protein DprA [Propionibacterium acnes HL037PA3]
          Length = 377

 Score = 43.3 bits (101), Expect = 0.012,   Method: Composition-based stats.
 Identities = 9/76 (11%), Positives = 25/76 (32%), Gaps = 1/76 (1%)

Query: 15  SDTNHTKNINITHYPEYTQCERVRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLLELDL 73
                 +    +   +      + + ++L  +    +D++    G+        L  L+ 
Sbjct: 297 LAPEPERPAGRSLPTDILDATELAVHEALPAHGSCGLDELAALAGVPIAQCSAALTVLEQ 356

Query: 74  AGRLCHHPEGKVSLTM 89
            G      +G  S+T+
Sbjct: 357 LGMAACCLDGTWSVTL 372


>gi|325262840|ref|ZP_08129576.1| DNA processing protein DprA [Clostridium sp. D5]
 gi|324031934|gb|EGB93213.1| DNA processing protein DprA [Clostridium sp. D5]
          Length = 360

 Score = 43.3 bits (101), Expect = 0.012,   Method: Composition-based stats.
 Identities = 9/54 (16%), Positives = 19/54 (35%)

Query: 32  TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
            +     +   L   P ++  +   T + A  V   L+ L+L G +    +   
Sbjct: 303 LESGENMVYSRLGLYPKNLSQLTEETMLPANEVLERLVSLELKGYIREVSKNYY 356


>gi|260439513|ref|ZP_05793329.1| DprA [Neisseria gonorrhoeae DGI2]
 gi|291042750|ref|ZP_06568491.1| DNA protecting protein DprA [Neisseria gonorrhoeae DGI2]
 gi|291013184|gb|EFE05150.1| DNA protecting protein DprA [Neisseria gonorrhoeae DGI2]
          Length = 395

 Score = 43.3 bits (101), Expect = 0.012,   Method: Composition-based stats.
 Identities = 16/74 (21%), Positives = 25/74 (33%)

Query: 14  QSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDL 73
           Q+         +             I   +   PIH D +     + A  +Y  LLEL+L
Sbjct: 319 QTAYAPPPAAKMPSEGAAGGTAVGGILDKMGFDPIHPDVLAGQLAMPAADLYAALLELEL 378

Query: 74  AGRLCHHPEGKVSL 87
            G +   P G+   
Sbjct: 379 DGSVAAMPGGRYQR 392


>gi|87124524|ref|ZP_01080373.1| Bacterial regulatory proteins, ArsR family protein [Synechococcus
          sp. RS9917]
 gi|86168096|gb|EAQ69354.1| Bacterial regulatory proteins, ArsR family protein [Synechococcus
          sp. RS9917]
          Length = 101

 Score = 43.3 bits (101), Expect = 0.012,   Method: Composition-based stats.
 Identities = 14/51 (27%), Positives = 28/51 (54%)

Query: 33 QCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEG 83
          +  R+ + ++L + PI++  ++  TG+   +V   L  L +AG +   PEG
Sbjct: 13 EPNRLAVLEALRDGPINVTAVVEKTGLSQALVSKHLKLLTIAGVVERRPEG 63


>gi|325197405|gb|ADY92861.1| putative DNA processing protein DprA [Neisseria meningitidis G2136]
          Length = 395

 Score = 43.3 bits (101), Expect = 0.012,   Method: Composition-based stats.
 Identities = 16/74 (21%), Positives = 25/74 (33%)

Query: 14  QSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDL 73
           Q+         +             I   +   PIH D +     + A  +Y  LLEL+L
Sbjct: 319 QTAYAPPPAAKMPSEGAAGGTAVGGILDKMGFDPIHPDVLAGQLAMPAADLYAALLELEL 378

Query: 74  AGRLCHHPEGKVSL 87
            G +   P G+   
Sbjct: 379 DGSVAAMPGGRYQR 392


>gi|240081714|ref|ZP_04726257.1| DprA [Neisseria gonorrhoeae FA19]
 gi|268597812|ref|ZP_06131979.1| DNA processing chain A [Neisseria gonorrhoeae FA19]
 gi|268604659|ref|ZP_06138826.1| DNA processing chain A [Neisseria gonorrhoeae PID1]
 gi|268551600|gb|EEZ46619.1| DNA processing chain A [Neisseria gonorrhoeae FA19]
 gi|268588790|gb|EEZ53466.1| DNA processing chain A [Neisseria gonorrhoeae PID1]
          Length = 395

 Score = 43.3 bits (101), Expect = 0.012,   Method: Composition-based stats.
 Identities = 16/74 (21%), Positives = 25/74 (33%)

Query: 14  QSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDL 73
           Q+         +             I   +   PIH D +     + A  +Y  LLEL+L
Sbjct: 319 QTAYAPPPAAKMPSEGAAGGTAVGGILDKMGFDPIHPDVLAGQLAMPAADLYAALLELEL 378

Query: 74  AGRLCHHPEGKVSL 87
            G +   P G+   
Sbjct: 379 DGSVAAMPGGRYQR 392


>gi|325203235|gb|ADY98688.1| putative DNA processing protein DprA [Neisseria meningitidis
           M01-240355]
          Length = 395

 Score = 43.3 bits (101), Expect = 0.012,   Method: Composition-based stats.
 Identities = 16/74 (21%), Positives = 25/74 (33%)

Query: 14  QSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDL 73
           Q+         +             I   +   PIH D +     + A  +Y  LLEL+L
Sbjct: 319 QTAYAPPPAAKMPSEGAAGGTAVGGILDKMGFDPIHPDVLAGQLAMPAADLYAALLELEL 378

Query: 74  AGRLCHHPEGKVSL 87
            G +   P G+   
Sbjct: 379 DGSVAAMPGGRYQR 392


>gi|183981827|ref|YP_001850118.1| hypothetical protein MMAR_1814 [Mycobacterium marinum M]
 gi|183175153|gb|ACC40263.1| conserved hypothetical membrane protein [Mycobacterium marinum M]
          Length = 391

 Score = 43.3 bits (101), Expect = 0.012,   Method: Composition-based stats.
 Identities = 14/82 (17%), Positives = 29/82 (35%), Gaps = 2/82 (2%)

Query: 7   EQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSL-NNVPIHIDDIIHHTGIEAPVVY 65
           E      +      +    T   +       ++ ++L     + +D+I   +G+ A  V 
Sbjct: 293 EIVELVGRIGELSLEQSRPTSVLDGLSQSESQVYEALPGRGAMSVDEIAVASGLVAEQVM 352

Query: 66  LVLLELDLAGRLCHHPEGKVSL 87
             L  L++AG       G+  L
Sbjct: 353 GRLAILEVAGLAERD-GGRWRL 373


>gi|87307031|ref|ZP_01089177.1| DNA processing chain A [Blastopirellula marina DSM 3645]
 gi|87290404|gb|EAQ82292.1| DNA processing chain A [Blastopirellula marina DSM 3645]
          Length = 407

 Score = 43.3 bits (101), Expect = 0.012,   Method: Composition-based stats.
 Identities = 13/84 (15%), Positives = 28/84 (33%), Gaps = 3/84 (3%)

Query: 9   NFFSSQSDTNHTKNINITHYPEYTQCER--VRIKQSLNN-VPIHIDDIIHHTGIEAPVVY 65
                 +    T++    H P   Q       I Q+L +  P  +D ++  +G+    V 
Sbjct: 324 EELGPLTRPAKTEDGKTIHAPIELQLNEMETAIMQALADGQPTDMDSVVSRSGLPIQNVL 383

Query: 66  LVLLELDLAGRLCHHPEGKVSLTM 89
             +  L++   +       V   +
Sbjct: 384 STICVLEMRRLVRRLSGVSVQRAV 407


>gi|329894844|ref|ZP_08270644.1| Rossmann fold nucleotide-binding protein Smf possibly involved in
           DNA uptake [gamma proteobacterium IMCC3088]
 gi|328922738|gb|EGG30072.1| Rossmann fold nucleotide-binding protein Smf possibly involved in
           DNA uptake [gamma proteobacterium IMCC3088]
          Length = 373

 Score = 43.3 bits (101), Expect = 0.012,   Method: Composition-based stats.
 Identities = 14/66 (21%), Positives = 24/66 (36%)

Query: 22  NINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHP 81
             + T        +  R+ + + + P+   D+          V   LLEL+LA  +    
Sbjct: 308 PEDQTVLTAVLSPDCKRLLRLMGDTPVSSVDLSARVKKPVTWVQEHLLELELANCITVSG 367

Query: 82  EGKVSL 87
            G V L
Sbjct: 368 FGYVRL 373


>gi|268683117|ref|ZP_06149979.1| DNA processing chain A [Neisseria gonorrhoeae PID332]
 gi|268623401|gb|EEZ55801.1| DNA processing chain A [Neisseria gonorrhoeae PID332]
          Length = 395

 Score = 43.3 bits (101), Expect = 0.012,   Method: Composition-based stats.
 Identities = 16/74 (21%), Positives = 25/74 (33%)

Query: 14  QSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDL 73
           Q+         +             I   +   PIH D +     + A  +Y  LLEL+L
Sbjct: 319 QTAYAPPPAAKMPSEGAAGGTAVGGILDKMGFDPIHPDVLAGQLAMPAADLYAALLELEL 378

Query: 74  AGRLCHHPEGKVSL 87
            G +   P G+   
Sbjct: 379 DGSVAAMPGGRYQR 392


>gi|254672820|emb|CBA06971.1| DNA processing chain A [Neisseria meningitidis alpha275]
          Length = 395

 Score = 43.3 bits (101), Expect = 0.012,   Method: Composition-based stats.
 Identities = 16/74 (21%), Positives = 25/74 (33%)

Query: 14  QSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDL 73
           Q+         +             I   +   PIH D +     + A  +Y  LLEL+L
Sbjct: 319 QTAYAPPPAAKMPSEGAAGGTAVGGILDKMGFDPIHPDVLAGQLAMPAADLYAALLELEL 378

Query: 74  AGRLCHHPEGKVSL 87
            G +   P G+   
Sbjct: 379 DGSVAAMPGGRYQR 392


>gi|268593749|ref|ZP_06127916.1| DNA processing chain A [Neisseria gonorrhoeae 35/02]
 gi|268547138|gb|EEZ42556.1| DNA processing chain A [Neisseria gonorrhoeae 35/02]
          Length = 395

 Score = 43.3 bits (101), Expect = 0.012,   Method: Composition-based stats.
 Identities = 16/74 (21%), Positives = 25/74 (33%)

Query: 14  QSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDL 73
           Q+         +             I   +   PIH D +     + A  +Y  LLEL+L
Sbjct: 319 QTAYAPPPAAKMPSEGAAGGTAVGGILDKMGFDPIHPDVLAGQLAMPAADLYAALLELEL 378

Query: 74  AGRLCHHPEGKVSL 87
            G +   P G+   
Sbjct: 379 DGSVAAMPGGRYQR 392


>gi|291531139|emb|CBK96724.1| Predicted Rossmann fold nucleotide-binding protein involved in DNA
           uptake [Eubacterium siraeum 70/3]
          Length = 500

 Score = 43.3 bits (101), Expect = 0.012,   Method: Composition-based stats.
 Identities = 11/99 (11%), Positives = 32/99 (32%), Gaps = 12/99 (12%)

Query: 1   MVHPQIEQN-----FFSSQSDTNH------TKNINITHYPEYTQCERVRIKQSL-NNVPI 48
           ++ P  E +          +DT         + +               I   + N+  +
Sbjct: 397 IIAPIAETDNTDVSEAEPVTDTEEKQSGQIAEAVENASGAAENASGAAEILGIIANSDGV 456

Query: 49  HIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
             D ++    +    +  +L +L+++G +     G  ++
Sbjct: 457 TFDTLLSACSLSFGELSEILADLEISGAVSCGAGGIYTV 495


>gi|190571736|ref|YP_001976094.1| DNA processing chain A [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|213019224|ref|ZP_03335031.1| DNA processing chain A [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|190358008|emb|CAQ55476.1| DNA processing chain A [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|212995333|gb|EEB55974.1| DNA processing chain A [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 361

 Score = 43.3 bits (101), Expect = 0.012,   Method: Composition-based stats.
 Identities = 18/49 (36%), Positives = 31/49 (63%)

Query: 39  IKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           I   +N+VP+ ID++I  +G+ A +  + LLEL+L  ++   P  K+SL
Sbjct: 311 IVDHINSVPVDIDELILASGLSANIALMALLELELENKIERSPGNKISL 359


>gi|254474217|ref|ZP_05087608.1| DNA processing chain A [Pseudovibrio sp. JE062]
 gi|211956747|gb|EEA91956.1| DNA processing chain A [Pseudovibrio sp. JE062]
          Length = 397

 Score = 43.3 bits (101), Expect = 0.013,   Method: Composition-based stats.
 Identities = 26/96 (27%), Positives = 47/96 (48%), Gaps = 9/96 (9%)

Query: 1   MVHPQIEQNFFSSQSDTNHTKN-----INITHYPEYT----QCERVRIKQSLNNVPIHID 51
           ++ P+I  +    Q     T N        T+ P       + +R+ +  +L+  PI  D
Sbjct: 296 IMEPKISMSLPLHQGIEEPTSNWPKLDSPDTNSPSPPLNANEQDRLAVIDALSETPIDQD 355

Query: 52  DIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           +++  TG+    + L+LLE++LAGRL  H   K+S+
Sbjct: 356 ELLRFTGVSLQTLQLILLEIELAGRLERHKPNKLSM 391


>gi|308388334|gb|ADO30654.1| SMF-family protein [Neisseria meningitidis alpha710]
 gi|325131151|gb|EGC53872.1| putative DNA processing protein DprA [Neisseria meningitidis
           OX99.30304]
 gi|325137175|gb|EGC59770.1| putative DNA processing protein DprA [Neisseria meningitidis M0579]
 gi|325203049|gb|ADY98503.1| putative DNA processing protein DprA [Neisseria meningitidis
           M01-240149]
 gi|325207153|gb|ADZ02605.1| putative DNA processing protein DprA [Neisseria meningitidis
           NZ-05/33]
          Length = 395

 Score = 42.9 bits (100), Expect = 0.013,   Method: Composition-based stats.
 Identities = 16/74 (21%), Positives = 25/74 (33%)

Query: 14  QSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDL 73
           Q+         +             I   +   PIH D +     + A  +Y  LLEL+L
Sbjct: 319 QTAYAPPPAAKMPSEGAAGGTAVGGILDKMGFDPIHPDVLAGQLAMPAADLYAALLELEL 378

Query: 74  AGRLCHHPEGKVSL 87
            G +   P G+   
Sbjct: 379 DGSVAAMPGGRYQR 392


>gi|209521901|ref|ZP_03270572.1| DEAD/H associated domain protein [Burkholderia sp. H160]
 gi|209497659|gb|EDZ97843.1| DEAD/H associated domain protein [Burkholderia sp. H160]
          Length = 1313

 Score = 42.9 bits (100), Expect = 0.013,   Method: Composition-based stats.
 Identities = 15/78 (19%), Positives = 28/78 (35%), Gaps = 3/78 (3%)

Query: 2    VHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEA 61
            ++P I +N ++           + +         R R+       P+ +D I    G+ A
Sbjct: 1019 LYPDIPRNRYTPPLSAPKGYTDSWSADDALVDVLRARLT---GFGPLTVDAIARPLGLPA 1075

Query: 62   PVVYLVLLELDLAGRLCH 79
              V   L+ L+  G L  
Sbjct: 1076 DRVEPALIRLEAEGYLLR 1093


>gi|317401308|gb|EFV81948.1| smf protein [Achromobacter xylosoxidans C54]
          Length = 158

 Score = 42.9 bits (100), Expect = 0.013,   Method: Composition-based stats.
 Identities = 14/79 (17%), Positives = 29/79 (36%)

Query: 9   NFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVL 68
           +           +       P         + ++L   P+H+D +    G++   +   L
Sbjct: 78  DELGGGPQPGTRRPPEPADDPGDADNPTHPVLEALGFDPLHLDALQARCGLDTATLQAQL 137

Query: 69  LELDLAGRLCHHPEGKVSL 87
           LEL+LA R+    +G+   
Sbjct: 138 LELELAARVARLDDGRFQR 156


>gi|217967909|ref|YP_002353415.1| DNA protecting protein DprA [Dictyoglomus turgidum DSM 6724]
 gi|217337008|gb|ACK42801.1| DNA protecting protein DprA [Dictyoglomus turgidum DSM 6724]
          Length = 364

 Score = 42.9 bits (100), Expect = 0.013,   Method: Composition-based stats.
 Identities = 10/56 (17%), Positives = 24/56 (42%)

Query: 31  YTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
               E   +   L   PI I+D++ +  I+   +  +++ L   G +  +P  + +
Sbjct: 300 ELTEEEKLVLNFLGLEPIFIEDLMKNLNIDLSRLMFIIISLQGKGFVEEYPGLRYA 355


>gi|311064945|ref|YP_003971671.1| transcriptional regulator [Bifidobacterium bifidum PRL2010]
 gi|310867265|gb|ADP36634.1| Putative transcriptional regulator [Bifidobacterium bifidum
          PRL2010]
          Length = 201

 Score = 42.9 bits (100), Expect = 0.014,   Method: Composition-based stats.
 Identities = 14/71 (19%), Positives = 26/71 (36%), Gaps = 1/71 (1%)

Query: 12 SSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNV-PIHIDDIIHHTGIEAPVVYLVLLE 70
          +     N     +       +   R+RI   +++  P+ +  I    G  A  V   L +
Sbjct: 12 TPPRRDNPATVTDTNRLKALSHPTRLRILTVMSDTKPVTVGQIAEQLGESAGTVSYHLKQ 71

Query: 71 LDLAGRLCHHP 81
          L+ AG +   P
Sbjct: 72 LEKAGFVTQTP 82


>gi|224283664|ref|ZP_03646986.1| transcription regulator ArsR [Bifidobacterium bifidum NCIMB
          41171]
 gi|313140820|ref|ZP_07803013.1| ArsR-family transcriptional regulator [Bifidobacterium bifidum
          NCIMB 41171]
 gi|313133330|gb|EFR50947.1| ArsR-family transcriptional regulator [Bifidobacterium bifidum
          NCIMB 41171]
          Length = 201

 Score = 42.9 bits (100), Expect = 0.014,   Method: Composition-based stats.
 Identities = 14/71 (19%), Positives = 26/71 (36%), Gaps = 1/71 (1%)

Query: 12 SSQSDTNHTKNINITHYPEYTQCERVRIKQSLNN-VPIHIDDIIHHTGIEAPVVYLVLLE 70
          +     N     +       +   R+RI   +++  P+ +  I    G  A  V   L +
Sbjct: 12 TPPRRDNPATVTDTNRLKALSHPTRLRILTVMSDTEPVTVGQIAEQLGESAGTVSYHLKQ 71

Query: 71 LDLAGRLCHHP 81
          L+ AG +   P
Sbjct: 72 LEKAGFVTQTP 82


>gi|282856249|ref|ZP_06265532.1| DNA protecting protein DprA [Pyramidobacter piscolens W5455]
 gi|282586008|gb|EFB91293.1| DNA protecting protein DprA [Pyramidobacter piscolens W5455]
          Length = 355

 Score = 42.9 bits (100), Expect = 0.014,   Method: Composition-based stats.
 Identities = 12/58 (20%), Positives = 24/58 (41%), Gaps = 1/58 (1%)

Query: 28  YPEYTQCERVRIKQSLNNVP-IHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGK 84
            P     +  R+   L++   + +D I   TGI A  +  ++ EL +   +     G+
Sbjct: 292 APLELGDDERRVLDCLSDQGDLTLDQISKRTGISAVELMRLISELQVQSLIYTSGGGR 349


>gi|257485582|ref|ZP_05639623.1| DNA processing protein DprA [Pseudomonas syringae pv. tabaci ATCC
           11528]
 gi|330985721|gb|EGH83824.1| DNA processing protein DprA [Pseudomonas syringae pv. lachrymans
           str. M301315]
          Length = 372

 Score = 42.9 bits (100), Expect = 0.014,   Method: Composition-based stats.
 Identities = 11/55 (20%), Positives = 19/55 (34%)

Query: 34  CERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
                +   L+  P   + +   +G   P V   L EL+L GR+        +  
Sbjct: 317 PCDHPLLALLHAAPHTSEGLSVSSGWPLPKVLAGLTELELDGRISCEAGRWFARA 371


>gi|291296459|ref|YP_003507857.1| transcriptional regulator TrmB [Meiothermus ruber DSM 1279]
 gi|290471418|gb|ADD28837.1| transcriptional regulator, TrmB [Meiothermus ruber DSM 1279]
          Length = 337

 Score = 42.9 bits (100), Expect = 0.015,   Method: Composition-based stats.
 Identities = 12/54 (22%), Positives = 24/54 (44%), Gaps = 1/54 (1%)

Query: 32  TQCERVRIKQSLNNVPIHI-DDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGK 84
            +    ++ ++L  +P  + DD+   TG+    V  VL+ L+L G +       
Sbjct: 281 LEGSEAKVYRALLELPEALPDDLAQSTGLSTGEVLSVLMMLELKGLVQSSAGRY 334


>gi|71736684|ref|YP_272337.1| DNA processing protein DprA [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|71557237|gb|AAZ36448.1| DNA processing protein DprA [Pseudomonas syringae pv. phaseolicola
           1448A]
          Length = 372

 Score = 42.9 bits (100), Expect = 0.015,   Method: Composition-based stats.
 Identities = 11/55 (20%), Positives = 19/55 (34%)

Query: 34  CERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
                +   L+  P   + +   +G   P V   L EL+L GR+        +  
Sbjct: 317 PCDHPLLALLHAAPHTSEGLSVSSGWPLPKVLAGLTELELDGRISCEAGRWFARA 371


>gi|312897996|ref|ZP_07757405.1| DNA protecting protein DprA [Megasphaera micronuciformis F0359]
 gi|310620921|gb|EFQ04472.1| DNA protecting protein DprA [Megasphaera micronuciformis F0359]
          Length = 367

 Score = 42.9 bits (100), Expect = 0.015,   Method: Composition-based stats.
 Identities = 9/75 (12%), Positives = 22/75 (29%), Gaps = 1/75 (1%)

Query: 4   PQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSL-NNVPIHIDDIIHHTGIEAP 62
           P +                               RI + +  +  +  +++   T +   
Sbjct: 281 PLLSGKELLETYGWQEEVKKRGRKALPPLSKGAGRIYKLMQGDRSVSYEELCAETALSPA 340

Query: 63  VVYLVLLELDLAGRL 77
            +   L EL++AG +
Sbjct: 341 CLASSLTELEMAGLI 355


>gi|88807796|ref|ZP_01123307.1| SMF family protein [Synechococcus sp. WH 7805]
 gi|88787835|gb|EAR18991.1| SMF family protein [Synechococcus sp. WH 7805]
          Length = 333

 Score = 42.9 bits (100), Expect = 0.015,   Method: Composition-based stats.
 Identities = 11/78 (14%), Positives = 27/78 (34%), Gaps = 1/78 (1%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVV 64
            ++   F            +    P      + R+ Q +N+    ++ +      +   +
Sbjct: 251 LVDLGAFIDALGPGPVPCQDSMVSPTGLDPSKERLLQQVNDGAT-LEQMARCLQEDPQHI 309

Query: 65  YLVLLELDLAGRLCHHPE 82
              L++L+LAG +   P 
Sbjct: 310 AQTLMQLELAGVVMPMPG 327


>gi|254361451|ref|ZP_04977591.1| SMF family Rossmann fold nucleotide-binding protein [Mannheimia
           haemolytica PHL213]
 gi|153092961|gb|EDN73987.1| SMF family Rossmann fold nucleotide-binding protein [Mannheimia
           haemolytica PHL213]
          Length = 382

 Score = 42.9 bits (100), Expect = 0.017,   Method: Composition-based stats.
 Identities = 18/83 (21%), Positives = 35/83 (42%), Gaps = 1/83 (1%)

Query: 4   PQIEQNFFS-SQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAP 62
           P  +++  + S S      +             + +I Q ++  P+ IDD+   T +   
Sbjct: 295 PLFDESKPTVSTSLQAVKNSEKFAKNLPSLTACQQQIYQHISLEPMAIDDLAKVTELTIE 354

Query: 63  VVYLVLLELDLAGRLCHHPEGKV 85
           ++ + LL L+LAG +     G V
Sbjct: 355 ILLVELLGLELAGVIKQVSGGYV 377


>gi|297566316|ref|YP_003685288.1| IclR family transcriptional regulator [Meiothermus silvanus DSM
           9946]
 gi|296850765|gb|ADH63780.1| transcriptional regulator, IclR family [Meiothermus silvanus DSM
           9946]
          Length = 233

 Score = 42.5 bits (99), Expect = 0.017,   Method: Composition-based stats.
 Identities = 16/70 (22%), Positives = 26/70 (37%), Gaps = 6/70 (8%)

Query: 20  TKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVY---LVLLELDLAGR 76
           T  ++ +  P        ++   L+  P+    +   TG+    VY     LLE   AG 
Sbjct: 160 TDRMSSSTQPGKPDERVEQLLAVLSGQPLGPSALARRTGLPKTTVYRLTARLLE---AGL 216

Query: 77  LCHHPEGKVS 86
           +   P G V 
Sbjct: 217 IAQTPGGYVR 226


>gi|212224105|ref|YP_002307341.1| hypothetical protein TON_0956 [Thermococcus onnurineus NA1]
 gi|212009062|gb|ACJ16444.1| Hypothetical protein TON_0956 [Thermococcus onnurineus NA1]
          Length = 315

 Score = 42.5 bits (99), Expect = 0.018,   Method: Composition-based stats.
 Identities = 11/63 (17%), Positives = 25/63 (39%)

Query: 22  NINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHP 81
                   E+ + +  +I   L   P+   ++    G+    V ++L E++  G +    
Sbjct: 245 ERKREKEMEFLRGDEEKIMAILREGPVLQSELAEKLGVSKAKVSIILREMEEKGLITRVK 304

Query: 82  EGK 84
           EG+
Sbjct: 305 EGR 307


>gi|167750872|ref|ZP_02422999.1| hypothetical protein EUBSIR_01856 [Eubacterium siraeum DSM 15702]
 gi|167656051|gb|EDS00181.1| hypothetical protein EUBSIR_01856 [Eubacterium siraeum DSM 15702]
          Length = 500

 Score = 42.5 bits (99), Expect = 0.018,   Method: Composition-based stats.
 Identities = 12/99 (12%), Positives = 34/99 (34%), Gaps = 12/99 (12%)

Query: 1   MVHPQIEQN-----FFSSQSDTNHTKNINITHYPEYTQCE------RVRIKQSL-NNVPI 48
           ++ P  E +          +D    ++  I    E              I   + N+  +
Sbjct: 397 IIAPIAETDNTDVSEAEPVTDKEEKQSGQIAEAAENASGAVGNASGAAEILGIIANSDGV 456

Query: 49  HIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
            +D ++    +    +  +L +L+++G +     G  ++
Sbjct: 457 TLDALLSACSLSFGELSEILADLEISGTISCGAGGIYTV 495


>gi|166031219|ref|ZP_02234048.1| hypothetical protein DORFOR_00906 [Dorea formicigenerans ATCC
           27755]
 gi|166029066|gb|EDR47823.1| hypothetical protein DORFOR_00906 [Dorea formicigenerans ATCC
           27755]
          Length = 364

 Score = 42.5 bits (99), Expect = 0.018,   Method: Composition-based stats.
 Identities = 10/83 (12%), Positives = 29/83 (34%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVV 64
              + F           +  +    +  +     +   L+  P ++ +I   TG++A ++
Sbjct: 277 ISPEEFLKELQIEVSENSTELLKNEKMLETTEKVVYSCLDLFPRNVSEIQVKTGLDARIL 336

Query: 65  YLVLLELDLAGRLCHHPEGKVSL 87
              L+ L++ G +    +     
Sbjct: 337 METLMTLEMEGYIKETAKNYYVR 359


>gi|28867415|ref|NP_790034.1| DNA processing protein DprA [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|28850649|gb|AAO53729.1| DNA processing protein DprA, putative [Pseudomonas syringae pv.
           tomato str. DC3000]
          Length = 394

 Score = 42.5 bits (99), Expect = 0.018,   Method: Composition-based stats.
 Identities = 12/67 (17%), Positives = 21/67 (31%), Gaps = 3/67 (4%)

Query: 20  TKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCH 79
               +    P         +   L+  P   + +   +G   P V   L EL+L GR+  
Sbjct: 328 PSADSSNTEPAPCD---HPLLALLHAAPHTSEGLSVSSGWPLPKVLAGLTELELDGRISC 384

Query: 80  HPEGKVS 86
                 +
Sbjct: 385 EAGRWFA 391


>gi|218885875|ref|YP_002435196.1| DNA protecting protein DprA [Desulfovibrio vulgaris str. 'Miyazaki
           F']
 gi|218756829|gb|ACL07728.1| DNA protecting protein DprA [Desulfovibrio vulgaris str. 'Miyazaki
           F']
          Length = 553

 Score = 42.5 bits (99), Expect = 0.018,   Method: Composition-based stats.
 Identities = 13/52 (25%), Positives = 21/52 (40%), Gaps = 1/52 (1%)

Query: 37  VRIKQSLNNVP-IHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
             I   L+  P  H+DDI     + A  V   L+ L++ G +   P  +   
Sbjct: 501 DAILTFLHGRPGAHVDDICRALSMGAADVSCRLVLLEVKGGVRRLPGMRYER 552


>gi|229815418|ref|ZP_04445750.1| hypothetical protein COLINT_02466 [Collinsella intestinalis DSM
           13280]
 gi|229808951|gb|EEP44721.1| hypothetical protein COLINT_02466 [Collinsella intestinalis DSM
           13280]
          Length = 308

 Score = 42.5 bits (99), Expect = 0.018,   Method: Composition-based stats.
 Identities = 10/67 (14%), Positives = 29/67 (43%)

Query: 22  NINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHP 81
           +       +       R+   L   P+ +DD+    G++      ++ +L++ G +    
Sbjct: 228 SRPDARGLDGLDTNGRRMVDMLLANPMRVDDLASALGVDPLACLQLIGDLEVHGVVERLV 287

Query: 82  EGKVSLT 88
           +G+++L+
Sbjct: 288 DGRLALS 294


>gi|238028946|ref|YP_002913177.1| DNA processing protein DprA [Burkholderia glumae BGR1]
 gi|237878140|gb|ACR30473.1| DNA processing protein DprA, putative [Burkholderia glumae BGR1]
          Length = 445

 Score = 42.5 bits (99), Expect = 0.019,   Method: Composition-based stats.
 Identities = 19/85 (22%), Positives = 33/85 (38%)

Query: 9   NFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVL 68
           N  +     + T         E    E + +  +L + P+  D +    G+ A  +  +L
Sbjct: 333 NEAAQSPGRDGTGAAPDCAGVESLPPEALALLDALGHGPVPADLLASRAGLAADTLPHLL 392

Query: 69  LELDLAGRLCHHPEGKVSLTMHLPS 93
           L L+LAGR+   P  +       PS
Sbjct: 393 LRLELAGRVASLPGDRYQRLDPPPS 417


>gi|15676044|ref|NP_273174.1| DNA processing chain A [Neisseria meningitidis MC58]
 gi|7225332|gb|AAF40575.1| DNA processing chain A [Neisseria meningitidis MC58]
 gi|316985962|gb|EFV64901.1| DNA protecting protein DprA [Neisseria meningitidis H44/76]
 gi|325141261|gb|EGC63760.1| putative DNA processing protein DprA [Neisseria meningitidis CU385]
 gi|325199330|gb|ADY94785.1| putative DNA processing protein DprA [Neisseria meningitidis
           H44/76]
          Length = 397

 Score = 42.5 bits (99), Expect = 0.019,   Method: Composition-based stats.
 Identities = 17/84 (20%), Positives = 29/84 (34%)

Query: 4   PQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPV 63
           P+       + SD        +       +     I   +   P+H D +     + A  
Sbjct: 311 PEKRITAVQTASDQLSLPEGKMPSEKTENRPVGGSILDRMGFDPVHPDVLAGQLAMPAAD 370

Query: 64  VYLVLLELDLAGRLCHHPEGKVSL 87
           +Y  LLEL+L G +   P G+   
Sbjct: 371 LYAALLELELDGSVAAMPGGRYQR 394


>gi|206900964|ref|YP_002251236.1| DNA processing protein DprA [Dictyoglomus thermophilum H-6-12]
 gi|206740067|gb|ACI19125.1| DNA processing protein DprA [Dictyoglomus thermophilum H-6-12]
          Length = 364

 Score = 42.5 bits (99), Expect = 0.019,   Method: Composition-based stats.
 Identities = 11/54 (20%), Positives = 26/54 (48%)

Query: 34  CERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
            E   +   LN+ PI I+D++ +  I+   +  +++ L   G +  +P  + + 
Sbjct: 303 PEEKFVLSFLNSEPIFIEDLMKNLNIDLSTLMFIIISLQGKGLVEEYPGLRYAR 356


>gi|88802025|ref|ZP_01117553.1| Smf protein DNA processing chain A [Polaribacter irgensii 23-P]
 gi|88782683|gb|EAR13860.1| Smf protein DNA processing chain A [Polaribacter irgensii 23-P]
          Length = 367

 Score = 42.5 bits (99), Expect = 0.019,   Method: Composition-based stats.
 Identities = 12/57 (21%), Positives = 20/57 (35%), Gaps = 1/57 (1%)

Query: 32  TQCERVRIKQSLNNVPIHI-DDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
                 +I   L++    I D I     I    +  +LL+++L G     P     L
Sbjct: 310 LNENEQKIHDFLHDKGKQILDVISLECNIPMYKLASILLQMELKGVSKPLPGKMFEL 366


>gi|303248293|ref|ZP_07334555.1| DNA protecting protein DprA [Desulfovibrio fructosovorans JJ]
 gi|302490318|gb|EFL50230.1| DNA protecting protein DprA [Desulfovibrio fructosovorans JJ]
          Length = 420

 Score = 42.5 bits (99), Expect = 0.019,   Method: Composition-based stats.
 Identities = 12/102 (11%), Positives = 25/102 (24%), Gaps = 14/102 (13%)

Query: 3   HPQIEQNFFSSQSDTNHTKNIN-------------ITHYPEYTQCERVRIKQSLNNVP-I 48
            P +      + S      +                   P         I   L +    
Sbjct: 318 APPVAPKRAPAASKRAPASSNKPSVPPAPPVAPCAPVAPPSDLSPLEAAIVGLLADGSKR 377

Query: 49  HIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMH 90
           HID +       +  +   L+ L++ G +   P    +  + 
Sbjct: 378 HIDALARTLDAASGALSQALVLLEMKGLVRKWPGMYYTREVE 419


>gi|187250577|ref|YP_001875059.1| DNA protecting protein DprA [Elusimicrobium minutum Pei191]
 gi|186970737|gb|ACC97722.1| DNA protecting protein DprA (DNA processing chain A)
           [Elusimicrobium minutum Pei191]
          Length = 372

 Score = 42.5 bits (99), Expect = 0.021,   Method: Composition-based stats.
 Identities = 10/49 (20%), Positives = 18/49 (36%)

Query: 36  RVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGK 84
             +  + +      IDDI+     + P    VL E+++ G L       
Sbjct: 319 EKQFLEVIGPGEHTIDDIVEALATDVPSAAAVLFEMEIKGVLMCKDGKY 367


>gi|58696725|ref|ZP_00372270.1| DNA processing chain A [Wolbachia endosymbiont of Drosophila
           simulans]
 gi|225630004|ref|YP_002726795.1| DNA processing chain A [Wolbachia sp. wRi]
 gi|58537093|gb|EAL60213.1| DNA processing chain A [Wolbachia endosymbiont of Drosophila
           simulans]
 gi|225591985|gb|ACN95004.1| DNA processing chain A [Wolbachia sp. wRi]
          Length = 362

 Score = 42.5 bits (99), Expect = 0.021,   Method: Composition-based stats.
 Identities = 20/82 (24%), Positives = 40/82 (48%)

Query: 6   IEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVY 65
           +  +    Q +    ++  +    E  Q  +  I   +N+VP+ ID++I  +G+   +  
Sbjct: 279 VRFSLPPQQKNLFDVEHYAVNQKQEKLQQAKSVIVDHINSVPVDIDELILASGLSTNIAL 338

Query: 66  LVLLELDLAGRLCHHPEGKVSL 87
           + LLEL+L  ++   P  K+SL
Sbjct: 339 MALLELELENKIERSPGNKISL 360


>gi|302060149|ref|ZP_07251690.1| DNA processing protein DprA, putative [Pseudomonas syringae pv.
           tomato K40]
          Length = 372

 Score = 42.5 bits (99), Expect = 0.022,   Method: Composition-based stats.
 Identities = 12/67 (17%), Positives = 21/67 (31%), Gaps = 3/67 (4%)

Query: 20  TKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCH 79
               +    P         +   L+  P   + +   +G   P V   L EL+L GR+  
Sbjct: 306 PSADSSNTEPAPCD---HPLLALLHAAPHTSEGLSVSSGWPLPKVLAGLTELELDGRISC 362

Query: 80  HPEGKVS 86
                 +
Sbjct: 363 EAGRWFA 369


>gi|253573510|ref|ZP_04850853.1| DNA protecting protein DprA [Paenibacillus sp. oral taxon 786 str.
           D14]
 gi|251847038|gb|EES75043.1| DNA protecting protein DprA [Paenibacillus sp. oral taxon 786 str.
           D14]
          Length = 373

 Score = 42.5 bits (99), Expect = 0.022,   Method: Composition-based stats.
 Identities = 14/56 (25%), Positives = 21/56 (37%)

Query: 32  TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
              E  RI   L       DD++  TG +  +++ VLL L +       P     L
Sbjct: 317 LTDEERRIYHMLEQGITSFDDLLVQTGWDFGLLHSVLLSLIMKKTAVQLPGSVYQL 372


>gi|213968423|ref|ZP_03396566.1| DNA processing protein DprA [Pseudomonas syringae pv. tomato T1]
 gi|301384289|ref|ZP_07232707.1| DNA processing protein DprA, putative [Pseudomonas syringae pv.
           tomato Max13]
 gi|302130422|ref|ZP_07256412.1| DNA processing protein DprA, putative [Pseudomonas syringae pv.
           tomato NCPPB 1108]
 gi|213926711|gb|EEB60263.1| DNA processing protein DprA [Pseudomonas syringae pv. tomato T1]
 gi|331017685|gb|EGH97741.1| DNA processing protein DprA, putative [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 371

 Score = 42.5 bits (99), Expect = 0.022,   Method: Composition-based stats.
 Identities = 12/67 (17%), Positives = 21/67 (31%), Gaps = 3/67 (4%)

Query: 20  TKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCH 79
               +    P         +   L+  P   + +   +G   P V   L EL+L GR+  
Sbjct: 305 PSADSSNTEPAPCD---HPLLALLHAAPHTSEGLSVSSGWPLPKVLAGLTELELDGRISC 361

Query: 80  HPEGKVS 86
                 +
Sbjct: 362 EAGRWFA 368


>gi|291549900|emb|CBL26162.1| DNA protecting protein DprA [Ruminococcus torques L2-14]
          Length = 370

 Score = 42.5 bits (99), Expect = 0.022,   Method: Composition-based stats.
 Identities = 8/47 (17%), Positives = 20/47 (42%)

Query: 32  TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLC 78
            +     +   +   P ++D I   + +E   +  +L+ L+L G + 
Sbjct: 313 LESTDDLVYSCVGLYPKNVDQIAQESRVEIRKLMSILVTLELQGYIR 359


>gi|152997125|ref|YP_001341960.1| DeoR family transcriptional regulator [Marinomonas sp. MWYL1]
 gi|150838049|gb|ABR72025.1| transcriptional regulator, DeoR family [Marinomonas sp. MWYL1]
          Length = 252

 Score = 42.1 bits (98), Expect = 0.022,   Method: Composition-based stats.
 Identities = 6/36 (16%), Positives = 15/36 (41%)

Query: 48 IHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEG 83
            +D+++    +    V   L++L+  G +     G
Sbjct: 20 TTVDELVQTLNVSPATVRRDLIDLENQGVVRRTHGG 55


>gi|58698108|ref|ZP_00373031.1| DNA processing chain A [Wolbachia endosymbiont of Drosophila
           ananassae]
 gi|58535354|gb|EAL59430.1| DNA processing chain A [Wolbachia endosymbiont of Drosophila
           ananassae]
          Length = 346

 Score = 42.1 bits (98), Expect = 0.023,   Method: Composition-based stats.
 Identities = 20/82 (24%), Positives = 40/82 (48%)

Query: 6   IEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVY 65
           +  +    Q +    ++  +    E  Q  +  I   +N+VP+ ID++I  +G+   +  
Sbjct: 263 VRFSLPPQQKNLFDVEHYAVNQKQEKLQQAKSVIVDHINSVPVDIDELILASGLSTNIAL 322

Query: 66  LVLLELDLAGRLCHHPEGKVSL 87
           + LLEL+L  ++   P  K+SL
Sbjct: 323 MALLELELENKIERSPGNKISL 344


>gi|284051638|ref|ZP_06381848.1| DNA protecting protein DprA [Arthrospira platensis str. Paraca]
          Length = 377

 Score = 42.1 bits (98), Expect = 0.023,   Method: Composition-based stats.
 Identities = 13/80 (16%), Positives = 25/80 (31%)

Query: 8   QNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLV 67
               +                      +  +I  ++ + P   D I+   GI+A  V   
Sbjct: 297 PQLDTPTQLPLWQPQTKPLPESPNLDPDLAKILNAIASQPTPFDLIVEQCGIDAGTVSSQ 356

Query: 68  LLELDLAGRLCHHPEGKVSL 87
           LL+L+L   +   P  +   
Sbjct: 357 LLQLELLELVTQLPGMRYQR 376


>gi|56416598|ref|YP_153672.1| DNA processing protein, chain A [Anaplasma marginale str. St.
           Maries]
 gi|222474964|ref|YP_002563379.1| DNA processing protein, chain A dprA (smf) [Anaplasma marginale
           str. Florida]
 gi|56387830|gb|AAV86417.1| DNA processing protein, chain A [Anaplasma marginale str. St.
           Maries]
 gi|222419100|gb|ACM49123.1| DNA processing protein, chain A dprA (smf) [Anaplasma marginale
           str. Florida]
          Length = 377

 Score = 42.1 bits (98), Expect = 0.023,   Method: Composition-based stats.
 Identities = 17/90 (18%), Positives = 36/90 (40%), Gaps = 3/90 (3%)

Query: 2   VHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEA 61
           ++P        + +   H    ++      +   R  I Q L+  P  I+D+   T I  
Sbjct: 291 LNPSARP---IAANSLRHAARQDVATDGAGSAAIRRAILQQLSVSPTDIEDLAACTKIGT 347

Query: 62  PVVYLVLLELDLAGRLCHHPEGKVSLTMHL 91
             +   L+EL+L  ++   P  + +L++  
Sbjct: 348 STLLAELIELELLRKVHRFPGNRFALSLEN 377


>gi|291571641|dbj|BAI93913.1| DNA processing protein [Arthrospira platensis NIES-39]
          Length = 377

 Score = 42.1 bits (98), Expect = 0.023,   Method: Composition-based stats.
 Identities = 13/80 (16%), Positives = 25/80 (31%)

Query: 8   QNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLV 67
               +                      +  +I  ++ + P   D I+   GI+A  V   
Sbjct: 297 PQLDTPTQLPLWQPQTKPLPESPNLDPDLAKILNAIASQPTPFDLIVEQCGIDAGTVSSQ 356

Query: 68  LLELDLAGRLCHHPEGKVSL 87
           LL+L+L   +   P  +   
Sbjct: 357 LLQLELLELVTQLPGMRYQR 376


>gi|295839594|ref|ZP_06826527.1| DeoR family transcriptional regulator [Streptomyces sp. SPB74]
 gi|197696826|gb|EDY43759.1| DeoR family transcriptional regulator [Streptomyces sp. SPB74]
          Length = 349

 Score = 42.1 bits (98), Expect = 0.023,   Method: Composition-based stats.
 Identities = 9/83 (10%), Positives = 23/83 (27%)

Query: 3   HPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAP 62
            P+       +               P   + +R  ++ +     + ++ +    G+   
Sbjct: 71  SPRARSRQPGASRADAPRSGTRGAERPGAPERQREIVRAAREGGSVEVNALAERLGVAKE 130

Query: 63  VVYLVLLELDLAGRLCHHPEGKV 85
            V   L  L+  G +     G  
Sbjct: 131 TVRRDLQALEDHGLVRRTHGGAY 153


>gi|210633134|ref|ZP_03297701.1| hypothetical protein COLSTE_01614 [Collinsella stercoris DSM 13279]
 gi|210159288|gb|EEA90259.1| hypothetical protein COLSTE_01614 [Collinsella stercoris DSM 13279]
          Length = 309

 Score = 42.1 bits (98), Expect = 0.024,   Method: Composition-based stats.
 Identities = 11/61 (18%), Positives = 24/61 (39%)

Query: 26  THYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
                       +    L   P+  +++  H  ++A     +L  L++AG +    +G+V
Sbjct: 233 APGLSGLDGAERKAMDMLVANPLRPEELAAHLRLDAIACLTMLSSLEVAGMVTRLSDGRV 292

Query: 86  S 86
           S
Sbjct: 293 S 293


>gi|42520001|ref|NP_965916.1| DNA processing chain A [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|42409738|gb|AAS13850.1| DNA processing chain A [Wolbachia endosymbiont of Drosophila
           melanogaster]
          Length = 362

 Score = 42.1 bits (98), Expect = 0.025,   Method: Composition-based stats.
 Identities = 21/82 (25%), Positives = 40/82 (48%)

Query: 6   IEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVY 65
           I  +    Q +    ++  +    E  Q  +  I   +N+VP+ ID++I  +G+   +  
Sbjct: 279 IRFSLPPQQKNLFDVEHHFVNQKQEKLQQAKSVIVDHINSVPVDIDELILASGLSTNIAL 338

Query: 66  LVLLELDLAGRLCHHPEGKVSL 87
           + LLEL+L  ++   P  K+SL
Sbjct: 339 MALLELELENKIERSPGNKISL 360


>gi|225677140|ref|ZP_03788139.1| DNA processing chain A [Wolbachia endosymbiont of Muscidifurax
           uniraptor]
 gi|225590807|gb|EEH12035.1| DNA processing chain A [Wolbachia endosymbiont of Muscidifurax
           uniraptor]
          Length = 362

 Score = 42.1 bits (98), Expect = 0.025,   Method: Composition-based stats.
 Identities = 21/82 (25%), Positives = 40/82 (48%)

Query: 6   IEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVY 65
           I  +    Q +    ++  +    E  Q  +  I   +N+VP+ ID++I  +G+   +  
Sbjct: 279 IRFSLPPQQKNLFDVEHHFVNQKQEKLQQAKSVIVDHINSVPVDIDELILASGLSTNIAL 338

Query: 66  LVLLELDLAGRLCHHPEGKVSL 87
           + LLEL+L  ++   P  K+SL
Sbjct: 339 MALLELELENKIERSPGNKISL 360


>gi|167725507|ref|ZP_02408743.1| DNA protecting protein DprA [Burkholderia pseudomallei DM98]
          Length = 236

 Score = 42.1 bits (98), Expect = 0.026,   Method: Composition-based stats.
 Identities = 12/51 (23%), Positives = 29/51 (56%)

Query: 37  VRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
            R+  ++   P+ ++ +   T + +  ++ +LL+L+LAGR+   P G+ + 
Sbjct: 164 RRLLDAIGYGPVPLELLAQRTSLPSGTLHRLLLQLELAGRVAALPGGRYTR 214


>gi|325129152|gb|EGC52000.1| putative DNA processing protein DprA [Neisseria meningitidis N1568]
          Length = 397

 Score = 42.1 bits (98), Expect = 0.026,   Method: Composition-based stats.
 Identities = 17/84 (20%), Positives = 29/84 (34%)

Query: 4   PQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPV 63
           P+       + SD        +       +     I   +   P+H D +     + A  
Sbjct: 311 PEKRITAVQTASDQLSLPEGKMPSEKTENRPVGGSILDRMGFDPVHPDVLAGQLAMPAAD 370

Query: 64  VYLVLLELDLAGRLCHHPEGKVSL 87
           +Y  LLEL+L G +   P G+   
Sbjct: 371 LYAALLELELDGSVAAMPGGRYQR 394


>gi|187734950|ref|YP_001877062.1| DNA protecting protein DprA [Akkermansia muciniphila ATCC BAA-835]
 gi|187425002|gb|ACD04281.1| DNA protecting protein DprA [Akkermansia muciniphila ATCC BAA-835]
          Length = 375

 Score = 42.1 bits (98), Expect = 0.026,   Method: Composition-based stats.
 Identities = 17/90 (18%), Positives = 28/90 (31%), Gaps = 11/90 (12%)

Query: 4   PQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQS--LNNVPIHIDDIIHHTGIEA 61
           P+     FS  S             P     E   I  +  L      ID +    G  A
Sbjct: 294 PEQGLPLFSPCSPAG-------ASTPPLPTLEEKEILHAIRLGFN--TIDTLCTSLGKAA 344

Query: 62  PVVYLVLLELDLAGRLCHHPEGKVSLTMHL 91
             +  +L ++ +AG++     G  S+    
Sbjct: 345 HTITPLLAKMQIAGQITPDAGGYFSINGRE 374


>gi|255002940|ref|ZP_05277904.1| DNA processing protein, chain A dprA (smf) [Anaplasma marginale
           str. Puerto Rico]
 gi|255004065|ref|ZP_05278866.1| DNA processing protein, chain A dprA (smf) [Anaplasma marginale
           str. Virginia]
          Length = 354

 Score = 42.1 bits (98), Expect = 0.027,   Method: Composition-based stats.
 Identities = 17/90 (18%), Positives = 36/90 (40%), Gaps = 3/90 (3%)

Query: 2   VHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEA 61
           ++P        + +   H    ++      +   R  I Q L+  P  I+D+   T I  
Sbjct: 268 LNPSARP---IAANSLRHAARQDVATDGAGSAAIRRAILQQLSVSPTDIEDLAACTKIGT 324

Query: 62  PVVYLVLLELDLAGRLCHHPEGKVSLTMHL 91
             +   L+EL+L  ++   P  + +L++  
Sbjct: 325 STLLAELIELELLRKVHRFPGNRFALSLEN 354


>gi|319953068|ref|YP_004164335.1| DNA protecting protein dpra [Cellulophaga algicola DSM 14237]
 gi|319421728|gb|ADV48837.1| DNA protecting protein DprA [Cellulophaga algicola DSM 14237]
          Length = 367

 Score = 42.1 bits (98), Expect = 0.028,   Method: Composition-based stats.
 Identities = 9/55 (16%), Positives = 14/55 (25%), Gaps = 1/55 (1%)

Query: 32  TQCERVRIKQ-SLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
                  I    L      +D I     I        LL +++ G +   P    
Sbjct: 310 LDDTEQAIHSYLLKEGKQGLDLIALTCNIPIFKASSSLLNMEMKGVIRPLPGKLF 364


>gi|330876382|gb|EGH10531.1| DNA processing protein DprA [Pseudomonas syringae pv. morsprunorum
           str. M302280PT]
 gi|330965120|gb|EGH65380.1| DNA processing protein DprA [Pseudomonas syringae pv. actinidiae
           str. M302091]
          Length = 371

 Score = 42.1 bits (98), Expect = 0.028,   Method: Composition-based stats.
 Identities = 12/59 (20%), Positives = 20/59 (33%), Gaps = 3/59 (5%)

Query: 28  YPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
            P         +   L+  P   + +   +G   P V   L EL+L GR+        +
Sbjct: 313 EPAPCD---HPLLALLHAAPHTSEGLSVSSGWPLPKVLAGLTELELDGRISCEAGRWFA 368


>gi|121633994|ref|YP_974239.1| SMF-family protein [Neisseria meningitidis FAM18]
 gi|120865700|emb|CAM09427.1| SMF-family protein [Neisseria meningitidis FAM18]
          Length = 397

 Score = 41.7 bits (97), Expect = 0.029,   Method: Composition-based stats.
 Identities = 17/84 (20%), Positives = 29/84 (34%)

Query: 4   PQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPV 63
           P+       + SD        +       +     I   +   P+H D +     + A  
Sbjct: 311 PEKRITAVQTASDQLSLPEGKMPSEKTENRPVGGSILDRMGFDPVHPDVLAGQLAMPAAD 370

Query: 64  VYLVLLELDLAGRLCHHPEGKVSL 87
           +Y  LLEL+L G +   P G+   
Sbjct: 371 LYAALLELELDGSVAAMPGGRYQR 394


>gi|262281297|ref|ZP_06059078.1| DNA protecting protein DprA [Acinetobacter calcoaceticus RUH2202]
 gi|262257123|gb|EEY75860.1| DNA protecting protein DprA [Acinetobacter calcoaceticus RUH2202]
          Length = 376

 Score = 41.7 bits (97), Expect = 0.030,   Method: Composition-based stats.
 Identities = 20/83 (24%), Positives = 30/83 (36%), Gaps = 3/83 (3%)

Query: 3   HPQ--IEQNFFSSQSDTNHTKNINITHYPEYTQCER-VRIKQSLNNVPIHIDDIIHHTGI 59
           HP+  IE     +Q  +                 E  V++ QSL+ V   ID +I H   
Sbjct: 287 HPEQIIEDLALPTQWQSQQQSQSETAETGAPEIPEHLVKLYQSLDWVGQDIDQLIVHHSQ 346

Query: 60  EAPVVYLVLLELDLAGRLCHHPE 82
               +   L+EL+L G       
Sbjct: 347 PVAELTSSLMELELLGLCMQQSG 369


>gi|33866509|ref|NP_898068.1| Smf family DNA processing protein [Synechococcus sp. WH 8102]
 gi|33633287|emb|CAE08492.1| putative DNA processing protein (Smf family) [Synechococcus sp. WH
           8102]
          Length = 354

 Score = 41.7 bits (97), Expect = 0.030,   Method: Composition-based stats.
 Identities = 13/80 (16%), Positives = 24/80 (30%), Gaps = 10/80 (12%)

Query: 3   HPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAP 62
            P +                 N T            + ++L      I+ +     + A 
Sbjct: 277 APLLSPKELVEHLGPGPFHRANATAP---------ALVKALGAGA-SIEQLQQTLKLPAG 326

Query: 63  VVYLVLLELDLAGRLCHHPE 82
            +   LLEL+LAG++     
Sbjct: 327 RLASDLLELELAGQVVCESG 346


>gi|251797454|ref|YP_003012185.1| DNA protecting protein DprA [Paenibacillus sp. JDR-2]
 gi|247545080|gb|ACT02099.1| DNA protecting protein DprA [Paenibacillus sp. JDR-2]
          Length = 371

 Score = 41.7 bits (97), Expect = 0.031,   Method: Composition-based stats.
 Identities = 12/66 (18%), Positives = 25/66 (37%)

Query: 17  TNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGR 76
              TK    +        E  +I   L + P+ I+++   T I    +  +L+ L +  +
Sbjct: 300 AALTKPKPASAVAASMSAEEQKIIDLLRDRPLTINELHQLTMIPFGHLSALLINLCIKRK 359

Query: 77  LCHHPE 82
           +   P 
Sbjct: 360 IEQQPG 365


>gi|311109640|ref|YP_003982493.1| DeoR-like helix-turn-helix domain-containing protein 2
          [Achromobacter xylosoxidans A8]
 gi|310764329|gb|ADP19778.1| DeoR-like helix-turn-helix domain protein 2 [Achromobacter
          xylosoxidans A8]
          Length = 253

 Score = 41.7 bits (97), Expect = 0.031,   Method: Composition-based stats.
 Identities = 16/58 (27%), Positives = 24/58 (41%), Gaps = 1/58 (1%)

Query: 36 RVRIKQSLNN-VPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHLP 92
            RI+  L++   +  D I+   G+    V   LLEL+  G L     G V +    P
Sbjct: 7  YQRIRALLSSLQQVSTDRIVGELGVSRETVRRDLLELEAMGELRRVHGGAVPVHSEPP 64


>gi|289426516|ref|ZP_06428259.1| DNA protecting protein DprA [Propionibacterium acnes SK187]
 gi|289153244|gb|EFD01962.1| DNA protecting protein DprA [Propionibacterium acnes SK187]
          Length = 391

 Score = 41.7 bits (97), Expect = 0.032,   Method: Composition-based stats.
 Identities = 9/76 (11%), Positives = 25/76 (32%), Gaps = 1/76 (1%)

Query: 15  SDTNHTKNINITHYPEYTQCERVRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLLELDL 73
                 +    +   +      + + ++L  +    +D++    G+        L  L+ 
Sbjct: 311 LAPEPERPAGRSLPTDILDAIELAVHEALPAHGSCGLDELAVLAGVPVAQCSAALSVLEQ 370

Query: 74  AGRLCHHPEGKVSLTM 89
            G      +G  S+T+
Sbjct: 371 LGMAACCLDGTWSVTL 386


>gi|269795658|ref|YP_003315113.1| DNA protecting protein DprA [Sanguibacter keddieii DSM 10542]
 gi|269097843|gb|ACZ22279.1| DNA protecting protein DprA [Sanguibacter keddieii DSM 10542]
          Length = 399

 Score = 41.7 bits (97), Expect = 0.032,   Method: Composition-based stats.
 Identities = 10/70 (14%), Positives = 24/70 (34%), Gaps = 1/70 (1%)

Query: 15  SDTNHTKNINITHYPEYTQCERVRIKQSLN-NVPIHIDDIIHHTGIEAPVVYLVLLELDL 73
           + T   ++   T   +           +L    P+ +D ++  +G+    +   L  L++
Sbjct: 320 AATGALRDDADTRETDGLDAPGKAAYDALPLRRPVPVDALVRSSGLAPHELMAALGVLEV 379

Query: 74  AGRLCHHPEG 83
            G       G
Sbjct: 380 RGLAVRSTGG 389


>gi|94967687|ref|YP_589735.1| DeoR family transcriptional regulator [Candidatus Koribacter
          versatilis Ellin345]
 gi|94549737|gb|ABF39661.1| transcriptional regulator, DeoR family [Candidatus Koribacter
          versatilis Ellin345]
          Length = 284

 Score = 41.7 bits (97), Expect = 0.032,   Method: Composition-based stats.
 Identities = 14/82 (17%), Positives = 30/82 (36%), Gaps = 7/82 (8%)

Query: 13 SQSDTNHTKNINITHYPE-YTQCERVR-----IKQSLNNVP-IHIDDIIHHTGIEAPVVY 65
            S      ++N+ ++PE     ++ +     I  +L     + +D +     +    + 
Sbjct: 4  PNSRQGSGSSLNVPNHPEIPGTQDKQQVRFTTILTALQQTGRVSVDTLSEQLDVSVVTIR 63

Query: 66 LVLLELDLAGRLCHHPEGKVSL 87
            L  L+  G L     G VS+
Sbjct: 64 RDLDALEQKGLLRRTHGGAVSI 85


>gi|94497602|ref|ZP_01304171.1| DNA processing chain A [Sphingomonas sp. SKA58]
 gi|94423019|gb|EAT08051.1| DNA processing chain A [Sphingomonas sp. SKA58]
          Length = 360

 Score = 41.7 bits (97), Expect = 0.032,   Method: Composition-based stats.
 Identities = 23/63 (36%), Positives = 31/63 (49%)

Query: 25  ITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGK 84
                +  Q ER  +   L      +D++I  +G+   VV  VLLEL+LAG L  H   K
Sbjct: 297 EPVSSDVAQSERAAVIGLLGPAAAPVDELIRLSGLSPAVVQTVLLELELAGALERHAGAK 356

Query: 85  VSL 87
           VSL
Sbjct: 357 VSL 359


>gi|297561408|ref|YP_003680382.1| DeoR family transcriptional regulator [Nocardiopsis dassonvillei
          subsp. dassonvillei DSM 43111]
 gi|296845856|gb|ADH67876.1| transcriptional regulator, DeoR family [Nocardiopsis dassonvillei
          subsp. dassonvillei DSM 43111]
          Length = 257

 Score = 41.7 bits (97), Expect = 0.033,   Method: Composition-based stats.
 Identities = 13/59 (22%), Positives = 24/59 (40%), Gaps = 6/59 (10%)

Query: 36 RVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHLPSP 94
             +  ++ +    ++D+    GI    V   L EL+ AG++     G V      P+P
Sbjct: 3  HQGLLDAVTDGVQRVEDLARELGISPSTVRRGLGELERAGKVVRTHGGAV------PAP 55


>gi|291533226|emb|CBL06339.1| DNA protecting protein DprA [Megamonas hypermegale ART12/1]
          Length = 368

 Score = 41.7 bits (97), Expect = 0.033,   Method: Composition-based stats.
 Identities = 14/62 (22%), Positives = 23/62 (37%), Gaps = 1/62 (1%)

Query: 31  YTQCERVRIKQSLNN-VPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTM 89
               E   I  SL+   P  ID+II+   I    +  +LL++ L G +           +
Sbjct: 304 SMTAEEQLIYDSLSFTEPKCIDEIIYKLRINVSNISFILLQMKLKGLVKETSPNFYIRAI 363

Query: 90  HL 91
             
Sbjct: 364 RE 365


>gi|282854572|ref|ZP_06263907.1| DNA protecting protein DprA [Propionibacterium acnes J139]
 gi|282582154|gb|EFB87536.1| DNA protecting protein DprA [Propionibacterium acnes J139]
 gi|314981836|gb|EFT25929.1| DNA protecting protein DprA [Propionibacterium acnes HL110PA3]
 gi|315090701|gb|EFT62677.1| DNA protecting protein DprA [Propionibacterium acnes HL110PA4]
          Length = 377

 Score = 41.7 bits (97), Expect = 0.034,   Method: Composition-based stats.
 Identities = 9/76 (11%), Positives = 25/76 (32%), Gaps = 1/76 (1%)

Query: 15  SDTNHTKNINITHYPEYTQCERVRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLLELDL 73
                 +    +   +      + + ++L  +    +D++    G+        L  L+ 
Sbjct: 297 LAPEPERPAGRSLPTDILDATELAVHEALPAHGSCGLDELAVLAGVPVAQCSAALSVLEQ 356

Query: 74  AGRLCHHPEGKVSLTM 89
            G      +G  S+T+
Sbjct: 357 LGMAACCLDGTWSVTL 372


>gi|119943869|ref|YP_941549.1| DNA protecting protein DprA [Psychromonas ingrahamii 37]
 gi|119862473|gb|ABM01950.1| DNA protecting protein DprA [Psychromonas ingrahamii 37]
          Length = 352

 Score = 41.7 bits (97), Expect = 0.034,   Method: Composition-based stats.
 Identities = 12/80 (15%), Positives = 34/80 (42%), Gaps = 4/80 (5%)

Query: 9   NFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVL 68
           + FS   D   + +   T            + + ++     ++ +++ +G +   +   L
Sbjct: 276 DEFSHLCDPFSSSDGETTSLATPCHP----LLKHIDFHLTTLEQLLNRSGFDVATLQNQL 331

Query: 69  LELDLAGRLCHHPEGKVSLT 88
           +EL++ GR+    +G + L+
Sbjct: 332 IELEITGRITVTTQGYIKLS 351


>gi|315104185|gb|EFT76161.1| DNA protecting protein DprA [Propionibacterium acnes HL050PA2]
          Length = 377

 Score = 41.7 bits (97), Expect = 0.034,   Method: Composition-based stats.
 Identities = 9/76 (11%), Positives = 25/76 (32%), Gaps = 1/76 (1%)

Query: 15  SDTNHTKNINITHYPEYTQCERVRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLLELDL 73
                 +    +   +      + + ++L  +    +D++    G+        L  L+ 
Sbjct: 297 LAPEPERPAGRSLPTDILDAIELAVHEALPAHGSCGLDELAVLAGVPVAQCSAALSVLEQ 356

Query: 74  AGRLCHHPEGKVSLTM 89
            G      +G  S+T+
Sbjct: 357 LGMAACCLDGTWSVTL 372


>gi|317401638|gb|EFV82264.1| DeoR family Transcriptional regulator [Achromobacter xylosoxidans
          C54]
          Length = 253

 Score = 41.7 bits (97), Expect = 0.035,   Method: Composition-based stats.
 Identities = 16/58 (27%), Positives = 24/58 (41%), Gaps = 1/58 (1%)

Query: 36 RVRIKQSLNN-VPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHLP 92
            RI+  L++   +  D I+   G+    V   LLEL+  G L     G V +    P
Sbjct: 7  YQRIRALLSSLQQVSTDRIVGELGVSRETVRRDLLELEAMGELRRVHGGAVPVHSEPP 64


>gi|57640407|ref|YP_182885.1| hypothetical protein TK0472 [Thermococcus kodakarensis KOD1]
 gi|57158731|dbj|BAD84661.1| hypothetical protein, conserved [Thermococcus kodakarensis KOD1]
          Length = 70

 Score = 41.7 bits (97), Expect = 0.035,   Method: Composition-based stats.
 Identities = 12/43 (27%), Positives = 20/43 (46%)

Query: 37 VRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCH 79
           R+ ++L + P  +D+I   TGI    V   LL     G++  
Sbjct: 4  QRVLKALESGPKTVDEIAKETGISPMEVRRYLLRFAEQGKVES 46


>gi|269792957|ref|YP_003317861.1| DNA protecting protein DprA [Thermanaerovibrio acidaminovorans DSM
           6589]
 gi|269100592|gb|ACZ19579.1| DNA protecting protein DprA [Thermanaerovibrio acidaminovorans DSM
           6589]
          Length = 361

 Score = 41.7 bits (97), Expect = 0.035,   Method: Composition-based stats.
 Identities = 12/86 (13%), Positives = 26/86 (30%), Gaps = 9/86 (10%)

Query: 4   PQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVP-IHIDDIIHHTGIEAP 62
           P ++ +      +   +                  I Q + +     +D +     I A 
Sbjct: 279 PLVDLDLLFPPGEDRGSSRQ--------VDPLEGAILQVMASEGDWTVDKLALECKIGAA 330

Query: 63  VVYLVLLELDLAGRLCHHPEGKVSLT 88
            +   L  L+  G +     G+ SL+
Sbjct: 331 DLLSRLAILEARGLVYRSSPGRYSLS 356


>gi|261213227|ref|ZP_05927509.1| rossmann fold nucleotide-binding protein Smf possibly involved in
           DNA uptake [Vibrio sp. RC341]
 gi|260837501|gb|EEX64204.1| rossmann fold nucleotide-binding protein Smf possibly involved in
           DNA uptake [Vibrio sp. RC341]
          Length = 371

 Score = 41.7 bits (97), Expect = 0.036,   Method: Composition-based stats.
 Identities = 14/82 (17%), Positives = 27/82 (32%), Gaps = 9/82 (10%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVV 64
             E+  +     +    +  +             +  ++      ID +   T I    V
Sbjct: 295 LSERVPYQPTLFSAPQGDEELPFP---------ELLANVGVEATPIDILASRTHIPVQDV 345

Query: 65  YLVLLELDLAGRLCHHPEGKVS 86
            + LLEL+L G +   P G + 
Sbjct: 346 MMQLLELELLGHVVAVPGGYIR 367


>gi|312958122|ref|ZP_07772645.1| DNA processing protein [Pseudomonas fluorescens WH6]
 gi|311287553|gb|EFQ66111.1| DNA processing protein [Pseudomonas fluorescens WH6]
          Length = 367

 Score = 41.7 bits (97), Expect = 0.037,   Method: Composition-based stats.
 Identities = 9/63 (14%), Positives = 19/63 (30%)

Query: 25  ITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGK 84
                         +   L+  P   + +   +G     V   L EL+L G++       
Sbjct: 301 QALSRPTPTPVTHPLVALLHASPHTSEALAIASGRPLSQVLATLTELELEGQVICESGRW 360

Query: 85  VSL 87
           ++ 
Sbjct: 361 LAR 363


>gi|329889387|ref|ZP_08267730.1| DNA protecting protein DprA [Brevundimonas diminuta ATCC 11568]
 gi|328844688|gb|EGF94252.1| DNA protecting protein DprA [Brevundimonas diminuta ATCC 11568]
          Length = 362

 Score = 41.7 bits (97), Expect = 0.037,   Method: Composition-based stats.
 Identities = 19/74 (25%), Positives = 26/74 (35%), Gaps = 1/74 (1%)

Query: 14  QSDTNHTKNINITHYPEY-TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELD 72
                   +      P+        RI+  L+  PI  D++    G+        LLEL 
Sbjct: 288 TLREPPADSPFAAGSPDQIDDAVLDRIEALLSPTPIGRDELARAAGLSIAETAAALLELH 347

Query: 73  LAGRLCHHPEGKVS 86
           LAGR    P G  S
Sbjct: 348 LAGRATLLPGGLAS 361


>gi|314923937|gb|EFS87768.1| DNA protecting protein DprA [Propionibacterium acnes HL001PA1]
 gi|314966118|gb|EFT10217.1| DNA protecting protein DprA [Propionibacterium acnes HL082PA2]
 gi|315094913|gb|EFT66889.1| DNA protecting protein DprA [Propionibacterium acnes HL060PA1]
 gi|327328005|gb|EGE69774.1| DNA processing / uptake protein [Propionibacterium acnes HL103PA1]
          Length = 377

 Score = 41.7 bits (97), Expect = 0.037,   Method: Composition-based stats.
 Identities = 9/76 (11%), Positives = 25/76 (32%), Gaps = 1/76 (1%)

Query: 15  SDTNHTKNINITHYPEYTQCERVRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLLELDL 73
                 +    +   +      + + ++L  +    +D++    G+        L  L+ 
Sbjct: 297 LAPEPERPAGRSLPTDILDAIELAVHEALPAHGSCGLDELAVLAGVPVAQCSAALSVLEQ 356

Query: 74  AGRLCHHPEGKVSLTM 89
            G      +G  S+T+
Sbjct: 357 LGMAACCLDGTWSVTL 372


>gi|93007287|ref|YP_581724.1| DNA processing protein DprA, putative [Psychrobacter cryohalolentis
           K5]
 gi|92394965|gb|ABE76240.1| DNA processing protein DprA, putative [Psychrobacter cryohalolentis
           K5]
          Length = 407

 Score = 41.4 bits (96), Expect = 0.038,   Method: Composition-based stats.
 Identities = 15/84 (17%), Positives = 30/84 (35%), Gaps = 1/84 (1%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYPEYTQCER-VRIKQSLNNVPIHIDDIIHHTGIEAPV 63
             +  F  S +     K   +   P  T  E    + + L+     +D +I  T +    
Sbjct: 324 LDKSVFKQSATIKKTIKPQEVKPAPSITVPEHLTTLFEKLDWHGQDLDALILVTELVPAQ 383

Query: 64  VYLVLLELDLAGRLCHHPEGKVSL 87
           +   L+EL+L G +       + +
Sbjct: 384 LIGQLMELELLGAVTVQGGRYLRI 407


>gi|325104560|ref|YP_004274214.1| DNA protecting protein DprA [Pedobacter saltans DSM 12145]
 gi|324973408|gb|ADY52392.1| DNA protecting protein DprA [Pedobacter saltans DSM 12145]
          Length = 361

 Score = 41.4 bits (96), Expect = 0.039,   Method: Composition-based stats.
 Identities = 8/58 (13%), Positives = 23/58 (39%), Gaps = 1/58 (1%)

Query: 32  TQCERVRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
              + + + + +  +  I IDD+     ++   + + LL L++   +   P     + 
Sbjct: 304 LNKDELIVFEVIKAHDQIAIDDLQVSLNMQQSKLAVALLGLEMKSVIVSLPGKIYKVN 361


>gi|327334330|gb|EGE76044.1| DNA processing / uptake protein [Propionibacterium acnes HL097PA1]
          Length = 377

 Score = 41.4 bits (96), Expect = 0.040,   Method: Composition-based stats.
 Identities = 9/76 (11%), Positives = 25/76 (32%), Gaps = 1/76 (1%)

Query: 15  SDTNHTKNINITHYPEYTQCERVRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLLELDL 73
                 +    +   +      + + ++L  +    +D++    G+        L  L+ 
Sbjct: 297 LAPEPERPAGRSLPTDILDAIELAVHEALPAHGSCGLDELAVLAGVPVAQCSAALSVLEQ 356

Query: 74  AGRLCHHPEGKVSLTM 89
            G      +G  S+T+
Sbjct: 357 LGMAACCLDGTWSVTL 372


>gi|323359718|ref|YP_004226114.1| Rossmann fold nucleotide-binding protein [Microbacterium testaceum
           StLB037]
 gi|323276089|dbj|BAJ76234.1| predicted Rossmann fold nucleotide-binding protein [Microbacterium
           testaceum StLB037]
          Length = 387

 Score = 41.4 bits (96), Expect = 0.040,   Method: Composition-based stats.
 Identities = 14/76 (18%), Positives = 26/76 (34%), Gaps = 1/76 (1%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNN-VPIHIDDIIHHTGIEAPV 63
               +       +        +   E    +  R+  +L++ V    DDI   +G+ +  
Sbjct: 301 TSADDVREMIGHSPEPDAGATSRGGEGRTDDTTRLFDALSSRVARGADDIARRSGLSSAQ 360

Query: 64  VYLVLLELDLAGRLCH 79
           V   L    LAGR+  
Sbjct: 361 VQTQLGLAQLAGRVVR 376


>gi|153810947|ref|ZP_01963615.1| hypothetical protein RUMOBE_01337 [Ruminococcus obeum ATCC 29174]
 gi|149832835|gb|EDM87918.1| hypothetical protein RUMOBE_01337 [Ruminococcus obeum ATCC 29174]
          Length = 302

 Score = 41.4 bits (96), Expect = 0.040,   Method: Composition-based stats.
 Identities = 11/45 (24%), Positives = 21/45 (46%)

Query: 34  CERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLC 78
            +   +   L+  P  ++ +I  TG+    V  +LLEL ++G   
Sbjct: 247 TDLKLVYSCLDLQPKSVEFLIQKTGLSPEKVGGLLLELKISGLAR 291


>gi|328950082|ref|YP_004367417.1| DNA protecting protein DprA [Marinithermus hydrothermalis DSM
           14884]
 gi|328450406|gb|AEB11307.1| DNA protecting protein DprA [Marinithermus hydrothermalis DSM
           14884]
          Length = 321

 Score = 41.4 bits (96), Expect = 0.040,   Method: Composition-based stats.
 Identities = 13/62 (20%), Positives = 20/62 (32%)

Query: 25  ITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGK 84
               PE T+ E               D++     + A  V   L  L+L G     P G+
Sbjct: 258 PALRPELTEAEARLYAALRAAGEALPDELAEELQLTAGEVLAGLAALELKGLAQALPGGR 317

Query: 85  VS 86
            +
Sbjct: 318 YA 319


>gi|121606769|ref|YP_984098.1| DNA protecting protein DprA [Polaromonas naphthalenivorans CJ2]
 gi|120595738|gb|ABM39177.1| DNA protecting protein DprA [Polaromonas naphthalenivorans CJ2]
          Length = 399

 Score = 41.4 bits (96), Expect = 0.040,   Method: Composition-based stats.
 Identities = 12/58 (20%), Positives = 23/58 (39%)

Query: 30  EYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
                    +  +L    + +D +   TG++   +   LLEL+L G++   P G    
Sbjct: 338 APVPGGEDTLLAALGFDAVSLDALQARTGLDTGHLQAQLLELELGGQVARLPGGLFQR 395


>gi|289427793|ref|ZP_06429504.1| DNA protecting protein DprA [Propionibacterium acnes J165]
 gi|289159057|gb|EFD07250.1| DNA protecting protein DprA [Propionibacterium acnes J165]
 gi|313763675|gb|EFS35039.1| DNA protecting protein DprA [Propionibacterium acnes HL013PA1]
 gi|313801455|gb|EFS42706.1| DNA protecting protein DprA [Propionibacterium acnes HL110PA2]
 gi|313807865|gb|EFS46346.1| DNA protecting protein DprA [Propionibacterium acnes HL087PA2]
 gi|313811664|gb|EFS49378.1| DNA protecting protein DprA [Propionibacterium acnes HL083PA1]
 gi|313816850|gb|EFS54564.1| DNA protecting protein DprA [Propionibacterium acnes HL059PA1]
 gi|313819650|gb|EFS57364.1| DNA protecting protein DprA [Propionibacterium acnes HL046PA2]
 gi|313822245|gb|EFS59959.1| DNA protecting protein DprA [Propionibacterium acnes HL036PA1]
 gi|313823522|gb|EFS61236.1| DNA protecting protein DprA [Propionibacterium acnes HL036PA2]
 gi|313825850|gb|EFS63564.1| DNA protecting protein DprA [Propionibacterium acnes HL063PA1]
 gi|313831405|gb|EFS69119.1| DNA protecting protein DprA [Propionibacterium acnes HL007PA1]
 gi|313835017|gb|EFS72731.1| DNA protecting protein DprA [Propionibacterium acnes HL056PA1]
 gi|313839826|gb|EFS77540.1| DNA protecting protein DprA [Propionibacterium acnes HL086PA1]
 gi|314914677|gb|EFS78508.1| DNA protecting protein DprA [Propionibacterium acnes HL005PA4]
 gi|314919210|gb|EFS83041.1| DNA protecting protein DprA [Propionibacterium acnes HL050PA1]
 gi|314920880|gb|EFS84711.1| DNA protecting protein DprA [Propionibacterium acnes HL050PA3]
 gi|314924577|gb|EFS88408.1| DNA protecting protein DprA [Propionibacterium acnes HL036PA3]
 gi|314930448|gb|EFS94279.1| DNA protecting protein DprA [Propionibacterium acnes HL067PA1]
 gi|314954499|gb|EFS98905.1| DNA protecting protein DprA [Propionibacterium acnes HL027PA1]
 gi|314957379|gb|EFT01482.1| DNA protecting protein DprA [Propionibacterium acnes HL002PA1]
 gi|314961998|gb|EFT06099.1| DNA protecting protein DprA [Propionibacterium acnes HL002PA2]
 gi|314963577|gb|EFT07677.1| DNA protecting protein DprA [Propionibacterium acnes HL082PA1]
 gi|314968590|gb|EFT12688.1| DNA protecting protein DprA [Propionibacterium acnes HL037PA1]
 gi|314974280|gb|EFT18376.1| DNA protecting protein DprA [Propionibacterium acnes HL053PA1]
 gi|314976715|gb|EFT20810.1| DNA protecting protein DprA [Propionibacterium acnes HL045PA1]
 gi|314984417|gb|EFT28509.1| DNA protecting protein DprA [Propionibacterium acnes HL005PA1]
 gi|314986433|gb|EFT30525.1| DNA protecting protein DprA [Propionibacterium acnes HL005PA2]
 gi|314990793|gb|EFT34884.1| DNA protecting protein DprA [Propionibacterium acnes HL005PA3]
 gi|315079433|gb|EFT51426.1| DNA protecting protein DprA [Propionibacterium acnes HL053PA2]
 gi|315081341|gb|EFT53317.1| DNA protecting protein DprA [Propionibacterium acnes HL078PA1]
 gi|315083542|gb|EFT55518.1| DNA protecting protein DprA [Propionibacterium acnes HL027PA2]
 gi|315087222|gb|EFT59198.1| DNA protecting protein DprA [Propionibacterium acnes HL002PA3]
 gi|315095251|gb|EFT67227.1| DNA protecting protein DprA [Propionibacterium acnes HL038PA1]
 gi|315099301|gb|EFT71277.1| DNA protecting protein DprA [Propionibacterium acnes HL059PA2]
 gi|315100523|gb|EFT72499.1| DNA protecting protein DprA [Propionibacterium acnes HL046PA1]
 gi|315106705|gb|EFT78681.1| DNA protecting protein DprA [Propionibacterium acnes HL030PA1]
 gi|315108930|gb|EFT80906.1| DNA protecting protein DprA [Propionibacterium acnes HL030PA2]
 gi|327328319|gb|EGE70081.1| DNA processing / uptake protein [Propionibacterium acnes HL096PA2]
 gi|327329816|gb|EGE71572.1| DNA processing / uptake protein [Propionibacterium acnes HL096PA3]
 gi|327444344|gb|EGE90998.1| DNA protecting protein DprA [Propionibacterium acnes HL043PA2]
 gi|327455053|gb|EGF01708.1| DNA protecting protein DprA [Propionibacterium acnes HL087PA3]
 gi|327457659|gb|EGF04314.1| DNA protecting protein DprA [Propionibacterium acnes HL083PA2]
 gi|328752257|gb|EGF65873.1| DNA protecting protein DprA [Propionibacterium acnes HL020PA1]
 gi|328755116|gb|EGF68732.1| DNA protecting protein DprA [Propionibacterium acnes HL087PA1]
 gi|328758105|gb|EGF71721.1| DNA protecting protein DprA [Propionibacterium acnes HL025PA2]
 gi|328760131|gb|EGF73709.1| DNA processing / uptake protein [Propionibacterium acnes HL099PA1]
 gi|332675846|gb|AEE72662.1| DNA processing / uptake protein [Propionibacterium acnes 266]
          Length = 377

 Score = 41.4 bits (96), Expect = 0.042,   Method: Composition-based stats.
 Identities = 9/76 (11%), Positives = 25/76 (32%), Gaps = 1/76 (1%)

Query: 15  SDTNHTKNINITHYPEYTQCERVRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLLELDL 73
                 +    +   +      + + ++L  +    +D++    G+        L  L+ 
Sbjct: 297 LAPEPERPAGRSLPTDILDAIELAVHEALPAHGSCGLDELAVLAGVPVAQCSAALSVLEQ 356

Query: 74  AGRLCHHPEGKVSLTM 89
            G      +G  S+T+
Sbjct: 357 LGMAACCLDGTWSVTL 372


>gi|298293676|ref|YP_003695615.1| DeoR family transcriptional regulator [Starkeya novella DSM 506]
 gi|296930187|gb|ADH90996.1| transcriptional regulator, DeoR family [Starkeya novella DSM 506]
          Length = 282

 Score = 41.4 bits (96), Expect = 0.043,   Method: Composition-based stats.
 Identities = 17/67 (25%), Positives = 25/67 (37%), Gaps = 7/67 (10%)

Query: 36 RVRIKQSLN-NVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV------SLT 88
            RI   L  +  I +  +    G+    +   LLEL+  GRL     G V      S+ 
Sbjct: 26 HARILDQLALSGSISVTTVAAELGVSDMTIRRDLLELEREGRLVRVHGGAVLAETPASVA 85

Query: 89 MHLPSPQ 95
          M    P+
Sbjct: 86 MDSEEPR 92


>gi|313794068|gb|EFS42092.1| DNA protecting protein DprA [Propionibacterium acnes HL110PA1]
 gi|327451913|gb|EGE98567.1| DNA protecting protein DprA [Propionibacterium acnes HL092PA1]
          Length = 376

 Score = 41.4 bits (96), Expect = 0.043,   Method: Composition-based stats.
 Identities = 9/76 (11%), Positives = 25/76 (32%), Gaps = 1/76 (1%)

Query: 15  SDTNHTKNINITHYPEYTQCERVRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLLELDL 73
                 +    +   +      + + ++L  +    +D++    G+        L  L+ 
Sbjct: 296 LAPEPERPAGRSLPTDILDAIELAVHEALPAHGSCGLDELAVLAGVPVAQCSAALSVLEQ 355

Query: 74  AGRLCHHPEGKVSLTM 89
            G      +G  S+T+
Sbjct: 356 LGMAACCLDGTWSVTL 371


>gi|6425140|gb|AAF08319.1|AF202665_2 transcriptional regulator [Spiroplasma citri]
 gi|110005294|emb|CAK99618.1| putative transcriptional regulator with helix-turn-helix domain
          transmembrane protein [Spiroplasma citri]
          Length = 233

 Score = 41.4 bits (96), Expect = 0.043,   Method: Composition-based stats.
 Identities = 9/48 (18%), Positives = 20/48 (41%), Gaps = 1/48 (2%)

Query: 37 VRIKQSLNNVP-IHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEG 83
           +I   L++   + ++D+I    +    +   L E++  G L     G
Sbjct: 8  EKILACLDDQQLVLVNDLITQLQLSPTTLRRDLTEMEQQGLLKRVHGG 55


>gi|314978802|gb|EFT22896.1| DNA protecting protein DprA [Propionibacterium acnes HL072PA2]
 gi|315089395|gb|EFT61371.1| DNA protecting protein DprA [Propionibacterium acnes HL072PA1]
          Length = 377

 Score = 41.4 bits (96), Expect = 0.044,   Method: Composition-based stats.
 Identities = 9/76 (11%), Positives = 25/76 (32%), Gaps = 1/76 (1%)

Query: 15  SDTNHTKNINITHYPEYTQCERVRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLLELDL 73
                 +    +   +      + + ++L  +    +D++    G+        L  L+ 
Sbjct: 297 LAPEPERPAGRSLPTDILDAIELAVHEALPAHGSCGLDELAVLAGVPVAQCSAALSVLEQ 356

Query: 74  AGRLCHHPEGKVSLTM 89
            G      +G  S+T+
Sbjct: 357 LGMAACCLDGTWSVTL 372


>gi|313829531|gb|EFS67245.1| DNA protecting protein DprA [Propionibacterium acnes HL063PA2]
          Length = 377

 Score = 41.4 bits (96), Expect = 0.044,   Method: Composition-based stats.
 Identities = 9/76 (11%), Positives = 25/76 (32%), Gaps = 1/76 (1%)

Query: 15  SDTNHTKNINITHYPEYTQCERVRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLLELDL 73
                 +    +   +      + + ++L  +    +D++    G+        L  L+ 
Sbjct: 297 LAPEPERPAGRSLPTDILDAIELAVHEALPAHGSCGLDELAVLAGVPVAQCSAALSVLEQ 356

Query: 74  AGRLCHHPEGKVSLTM 89
            G      +G  S+T+
Sbjct: 357 LGMAACCLDGTWSVTL 372


>gi|312135863|ref|YP_004003201.1| DNA protecting protein dpra [Caldicellulosiruptor owensensis OL]
 gi|311775914|gb|ADQ05401.1| DNA protecting protein DprA [Caldicellulosiruptor owensensis OL]
          Length = 365

 Score = 41.4 bits (96), Expect = 0.044,   Method: Composition-based stats.
 Identities = 8/39 (20%), Positives = 21/39 (53%)

Query: 48  IHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
           +H++++I  TG +A  V  ++  L++  ++       +S
Sbjct: 325 MHVENLIMLTGWDAGKVASLITSLEIKSKIIRTRGNMIS 363


>gi|225874954|ref|YP_002756413.1| DNA protecting protein DprA [Acidobacterium capsulatum ATCC 51196]
 gi|225792046|gb|ACO32136.1| DNA protecting protein DprA [Acidobacterium capsulatum ATCC 51196]
          Length = 401

 Score = 41.4 bits (96), Expect = 0.044,   Method: Composition-based stats.
 Identities = 13/73 (17%), Positives = 31/73 (42%), Gaps = 4/73 (5%)

Query: 15  SDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTG--IEAPVVYLVLLELD 72
           S    T ++   +     +   +RI +   +  + +++I+      + +  ++  L EL+
Sbjct: 321 SPEPVTASLFDDNTAAPVEAALLRILRH--DEALQMEEILQKLEGELSSSEIFTALFELE 378

Query: 73  LAGRLCHHPEGKV 85
           LAGR+   P    
Sbjct: 379 LAGRIRQLPGKNY 391


>gi|50842909|ref|YP_056136.1| DNA processing / uptake protein [Propionibacterium acnes KPA171202]
 gi|50840511|gb|AAT83178.1| DNA processing / uptake protein [Propionibacterium acnes KPA171202]
          Length = 377

 Score = 41.4 bits (96), Expect = 0.044,   Method: Composition-based stats.
 Identities = 9/76 (11%), Positives = 25/76 (32%), Gaps = 1/76 (1%)

Query: 15  SDTNHTKNINITHYPEYTQCERVRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLLELDL 73
                 +    +   +      + + ++L  +    +D++    G+        L  L+ 
Sbjct: 297 LAPEPERPAGRSLPTDILDAIELAVHEALPAHGSCGLDELAVLAGVPVAQCSAALSVLEQ 356

Query: 74  AGRLCHHPEGKVSLTM 89
            G      +G  S+T+
Sbjct: 357 LGMAACCLDGTWSVTL 372


>gi|217424972|ref|ZP_03456468.1| DNA protecting protein DprA [Burkholderia pseudomallei 576]
 gi|217391992|gb|EEC32018.1| DNA protecting protein DprA [Burkholderia pseudomallei 576]
          Length = 434

 Score = 41.4 bits (96), Expect = 0.044,   Method: Composition-based stats.
 Identities = 12/51 (23%), Positives = 29/51 (56%)

Query: 37  VRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
            R+  ++   P+ ++ +   T + +  ++ +LL+L+LAGR+   P G+ + 
Sbjct: 362 RRLLDAIGYGPVPLELLAQRTSLPSGTLHRLLLQLELAGRVAALPGGRYTR 412


>gi|134284081|ref|ZP_01770775.1| DNA protecting protein DprA [Burkholderia pseudomallei 305]
 gi|134244533|gb|EBA44637.1| DNA protecting protein DprA [Burkholderia pseudomallei 305]
          Length = 434

 Score = 41.4 bits (96), Expect = 0.044,   Method: Composition-based stats.
 Identities = 12/51 (23%), Positives = 29/51 (56%)

Query: 37  VRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
            R+  ++   P+ ++ +   T + +  ++ +LL+L+LAGR+   P G+ + 
Sbjct: 362 RRLLDAIGYGPVPLELLAQRTSLPSGTLHRLLLQLELAGRVAALPGGRYTR 412


>gi|295130966|ref|YP_003581629.1| DNA protecting protein DprA [Propionibacterium acnes SK137]
 gi|291376560|gb|ADE00415.1| DNA protecting protein DprA [Propionibacterium acnes SK137]
          Length = 377

 Score = 41.4 bits (96), Expect = 0.044,   Method: Composition-based stats.
 Identities = 9/76 (11%), Positives = 25/76 (32%), Gaps = 1/76 (1%)

Query: 15  SDTNHTKNINITHYPEYTQCERVRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLLELDL 73
                 +    +   +      + + ++L  +    +D++    G+        L  L+ 
Sbjct: 297 LAPEPERPAGRSLPTDILDAIELAVHEALPAHGSCGLDELAVLAGVPVAQCSAALSVLEQ 356

Query: 74  AGRLCHHPEGKVSLTM 89
            G      +G  S+T+
Sbjct: 357 LGMAACCLDGTWSVTL 372


>gi|329570081|gb|EGG51826.1| transcriptional regulator, DeoR family [Enterococcus faecalis
          TX1467]
          Length = 252

 Score = 41.4 bits (96), Expect = 0.045,   Method: Composition-based stats.
 Identities = 13/41 (31%), Positives = 18/41 (43%)

Query: 52 DIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHLP 92
          +I+    +    V   L EL+ AGRL     G  SL  + P
Sbjct: 26 EIMERLNVSDMTVRRDLTELEAAGRLKRVHGGASSLNTYRP 66


>gi|315167375|gb|EFU11392.1| DeoR-like helix-turn-helix protein [Enterococcus faecalis TX1341]
 gi|315169525|gb|EFU13542.1| DeoR-like helix-turn-helix protein [Enterococcus faecalis TX1342]
          Length = 252

 Score = 41.4 bits (96), Expect = 0.045,   Method: Composition-based stats.
 Identities = 13/41 (31%), Positives = 18/41 (43%)

Query: 52 DIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHLP 92
          +I+    +    V   L EL+ AGRL     G  SL  + P
Sbjct: 26 EIMERLNVSDMTVRRDLTELEAAGRLKRVHGGASSLNTYRP 66


>gi|315162889|gb|EFU06906.1| DeoR-like helix-turn-helix protein [Enterococcus faecalis TX0645]
 gi|315577871|gb|EFU90062.1| DeoR-like helix-turn-helix protein [Enterococcus faecalis TX0630]
          Length = 252

 Score = 41.4 bits (96), Expect = 0.045,   Method: Composition-based stats.
 Identities = 13/41 (31%), Positives = 18/41 (43%)

Query: 52 DIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHLP 92
          +I+    +    V   L EL+ AGRL     G  SL  + P
Sbjct: 26 EIMERLNVSDMTVRRDLTELEAAGRLKRVHGGASSLNTYRP 66


>gi|315149736|gb|EFT93752.1| DeoR-like helix-turn-helix protein [Enterococcus faecalis TX0012]
          Length = 252

 Score = 41.4 bits (96), Expect = 0.045,   Method: Composition-based stats.
 Identities = 13/41 (31%), Positives = 18/41 (43%)

Query: 52 DIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHLP 92
          +I+    +    V   L EL+ AGRL     G  SL  + P
Sbjct: 26 EIMERLNVSDMTVRRDLTELEAAGRLKRVHGGASSLNTYRP 66


>gi|257090138|ref|ZP_05584499.1| lactose phosphotransferase system repressor [Enterococcus
          faecalis CH188]
 gi|256998950|gb|EEU85470.1| lactose phosphotransferase system repressor [Enterococcus
          faecalis CH188]
          Length = 191

 Score = 41.4 bits (96), Expect = 0.045,   Method: Composition-based stats.
 Identities = 13/41 (31%), Positives = 18/41 (43%)

Query: 52 DIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHLP 92
          +I+    +    V   L EL+ AGRL     G  SL  + P
Sbjct: 26 EIMERLNVSDMTVRRDLTELEAAGRLKRVHGGASSLNTYRP 66


>gi|257082280|ref|ZP_05576641.1| lactose repressor [Enterococcus faecalis E1Sol]
 gi|256990310|gb|EEU77612.1| lactose repressor [Enterococcus faecalis E1Sol]
          Length = 250

 Score = 41.4 bits (96), Expect = 0.045,   Method: Composition-based stats.
 Identities = 13/41 (31%), Positives = 18/41 (43%)

Query: 52 DIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHLP 92
          +I+    +    V   L EL+ AGRL     G  SL  + P
Sbjct: 24 EIMERLNVSDMTVRRDLTELEAAGRLKRVHGGASSLNTYRP 64


>gi|256762832|ref|ZP_05503412.1| lactose repressor [Enterococcus faecalis T3]
 gi|257419573|ref|ZP_05596567.1| lactose repressor [Enterococcus faecalis T11]
 gi|256684083|gb|EEU23778.1| lactose repressor [Enterococcus faecalis T3]
 gi|257161401|gb|EEU91361.1| lactose repressor [Enterococcus faecalis T11]
          Length = 250

 Score = 41.4 bits (96), Expect = 0.045,   Method: Composition-based stats.
 Identities = 13/41 (31%), Positives = 18/41 (43%)

Query: 52 DIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHLP 92
          +I+    +    V   L EL+ AGRL     G  SL  + P
Sbjct: 24 EIMERLNVSDMTVRRDLTELEAAGRLKRVHGGASSLNTYRP 64


>gi|227519027|ref|ZP_03949076.1| sugar metabolism transcriptional repressor [Enterococcus faecalis
          TX0104]
 gi|227553650|ref|ZP_03983699.1| sugar metabolism transcriptional repressor [Enterococcus faecalis
          HH22]
 gi|293383368|ref|ZP_06629281.1| lactose phosphotransferase system repressor LacR [Enterococcus
          faecalis R712]
 gi|293388979|ref|ZP_06633464.1| lactose phosphotransferase system repressor LacR [Enterococcus
          faecalis S613]
 gi|312900967|ref|ZP_07760261.1| DeoR-like helix-turn-helix protein [Enterococcus faecalis TX0470]
 gi|312903577|ref|ZP_07762757.1| DeoR-like helix-turn-helix protein [Enterococcus faecalis TX0635]
 gi|312907804|ref|ZP_07766795.1| DeoR-like helix-turn-helix protein [Enterococcus faecalis DAPTO
          512]
 gi|312910422|ref|ZP_07769269.1| DeoR-like helix-turn-helix domain protein [Enterococcus faecalis
          DAPTO 516]
 gi|227073527|gb|EEI11490.1| sugar metabolism transcriptional repressor [Enterococcus faecalis
          TX0104]
 gi|227177232|gb|EEI58204.1| sugar metabolism transcriptional repressor [Enterococcus faecalis
          HH22]
 gi|291079159|gb|EFE16523.1| lactose phosphotransferase system repressor LacR [Enterococcus
          faecalis R712]
 gi|291081760|gb|EFE18723.1| lactose phosphotransferase system repressor LacR [Enterococcus
          faecalis S613]
 gi|310626832|gb|EFQ10115.1| DeoR-like helix-turn-helix protein [Enterococcus faecalis DAPTO
          512]
 gi|310633453|gb|EFQ16736.1| DeoR-like helix-turn-helix protein [Enterococcus faecalis TX0635]
 gi|311289695|gb|EFQ68251.1| DeoR-like helix-turn-helix domain protein [Enterococcus faecalis
          DAPTO 516]
 gi|311292066|gb|EFQ70622.1| DeoR-like helix-turn-helix protein [Enterococcus faecalis TX0470]
 gi|315028005|gb|EFT39937.1| DeoR-like helix-turn-helix protein [Enterococcus faecalis TX2137]
 gi|315147547|gb|EFT91563.1| DeoR-like helix-turn-helix protein [Enterococcus faecalis TX4244]
 gi|315575952|gb|EFU88143.1| DeoR-like helix-turn-helix protein [Enterococcus faecalis
          TX0309B]
 gi|315580742|gb|EFU92933.1| DeoR-like helix-turn-helix protein [Enterococcus faecalis
          TX0309A]
 gi|327535413|gb|AEA94247.1| lactose PTS family porter repressor LacR [Enterococcus faecalis
          OG1RF]
          Length = 252

 Score = 41.4 bits (96), Expect = 0.045,   Method: Composition-based stats.
 Identities = 13/41 (31%), Positives = 18/41 (43%)

Query: 52 DIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHLP 92
          +I+    +    V   L EL+ AGRL     G  SL  + P
Sbjct: 26 EIMERLNVSDMTVRRDLTELEAAGRLKRVHGGASSLNTYRP 66


>gi|29376380|ref|NP_815534.1| lactose phosphotransferase system repressor LacR [Enterococcus
          faecalis V583]
 gi|256961664|ref|ZP_05565835.1| lactose repressor [Enterococcus faecalis Merz96]
 gi|257079269|ref|ZP_05573630.1| lactose repressor [Enterococcus faecalis JH1]
 gi|257087095|ref|ZP_05581456.1| lactose repressor [Enterococcus faecalis D6]
 gi|294779344|ref|ZP_06744746.1| transcriptional regulator, DeoR family [Enterococcus faecalis
          PC1.1]
 gi|29343843|gb|AAO81604.1| lactose phosphotransferase system repressor LacR [Enterococcus
          faecalis V583]
 gi|256952160|gb|EEU68792.1| lactose repressor [Enterococcus faecalis Merz96]
 gi|256987299|gb|EEU74601.1| lactose repressor [Enterococcus faecalis JH1]
 gi|256995125|gb|EEU82427.1| lactose repressor [Enterococcus faecalis D6]
 gi|294453573|gb|EFG21973.1| transcriptional regulator, DeoR family [Enterococcus faecalis
          PC1.1]
          Length = 250

 Score = 41.4 bits (96), Expect = 0.045,   Method: Composition-based stats.
 Identities = 13/41 (31%), Positives = 18/41 (43%)

Query: 52 DIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHLP 92
          +I+    +    V   L EL+ AGRL     G  SL  + P
Sbjct: 24 EIMERLNVSDMTVRRDLTELEAAGRLKRVHGGASSLNTYRP 64


>gi|313900678|ref|ZP_07834171.1| transcriptional regulator, DeoR family [Clostridium sp. HGF2]
 gi|312954740|gb|EFR36415.1| transcriptional regulator, DeoR family [Clostridium sp. HGF2]
          Length = 255

 Score = 41.4 bits (96), Expect = 0.046,   Method: Composition-based stats.
 Identities = 11/50 (22%), Positives = 21/50 (42%), Gaps = 1/50 (2%)

Query: 38 RIKQSLNNVP-IHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
          RI + L++   I I +++         V   L+EL+  G +     G + 
Sbjct: 9  RILELLDHKSFITIQELMEVLNASKSTVNRDLIELEKQGLIQRERGGAIK 58


>gi|184156508|ref|YP_001844847.1| Rossmann fold nucleotide-binding protein [Acinetobacter baumannii
           ACICU]
 gi|183208102|gb|ACC55500.1| predicted Rossmann fold nucleotide-binding protein [Acinetobacter
           baumannii ACICU]
          Length = 376

 Score = 41.4 bits (96), Expect = 0.046,   Method: Composition-based stats.
 Identities = 20/83 (24%), Positives = 32/83 (38%), Gaps = 3/83 (3%)

Query: 3   HPQ--IEQNFFSSQSDTNHTKNINITHYPEYTQCERV-RIKQSLNNVPIHIDDIIHHTGI 59
           HP+  IE     +Q  +         +       E +  + QSL+ V  +ID +I H  I
Sbjct: 287 HPEQIIEDLALPTQWQSQQQNQTEEANTNTPEIPEHLIDLYQSLDWVGQNIDQLIVHHNI 346

Query: 60  EAPVVYLVLLELDLAGRLCHHPE 82
               +   L+EL+L G       
Sbjct: 347 PVSELTSSLMELELLGLCMQQSG 369


>gi|313667412|ref|YP_004047696.1| SMF-family protein [Neisseria lactamica ST-640]
 gi|313004874|emb|CBN86300.1| SMF-family protein [Neisseria lactamica 020-06]
          Length = 395

 Score = 41.4 bits (96), Expect = 0.047,   Method: Composition-based stats.
 Identities = 15/74 (20%), Positives = 25/74 (33%)

Query: 14  QSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDL 73
           Q+         +             I   +   P+H D +     + A  +Y  LLEL+L
Sbjct: 319 QTAYAPPPAAKMLSEGAAGGTAVGGILDKMGFDPVHPDVLAGQLAMPATDLYAALLELEL 378

Query: 74  AGRLCHHPEGKVSL 87
            G +   P G+   
Sbjct: 379 DGSVAAMPGGRYQR 392


>gi|313887109|ref|ZP_07820805.1| DNA protecting protein DprA [Porphyromonas asaccharolytica
           PR426713P-I]
 gi|312923338|gb|EFR34151.1| DNA protecting protein DprA [Porphyromonas asaccharolytica
           PR426713P-I]
          Length = 384

 Score = 41.4 bits (96), Expect = 0.047,   Method: Composition-based stats.
 Identities = 13/58 (22%), Positives = 22/58 (37%), Gaps = 2/58 (3%)

Query: 32  TQCERVRIKQSL--NNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
            + E   +   L  +   + ID I   T +    V   L  L+  G +   P+G+  L
Sbjct: 325 LEPETRPLLDLLIESGDGLSIDAICDQTLMGVDEVSFRLFLLESEGAVSLQPDGRYKL 382


>gi|295397009|ref|ZP_06807126.1| lactose PTS family porter repressor LacR [Aerococcus viridans
          ATCC 11563]
 gi|294974757|gb|EFG50467.1| lactose PTS family porter repressor LacR [Aerococcus viridans
          ATCC 11563]
          Length = 285

 Score = 41.4 bits (96), Expect = 0.048,   Method: Composition-based stats.
 Identities = 14/54 (25%), Positives = 22/54 (40%), Gaps = 1/54 (1%)

Query: 39 IKQSLN-NVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHL 91
          I   L  N  + + DI+    +    V   L EL+ +G L     G +SL  + 
Sbjct: 37 ILDLLKRNGTVSVTDIVEKLNVSDMTVRRDLTELEESGSLRRVHGGAISLGEYP 90


>gi|76808666|ref|YP_331760.1| SMF family protein [Burkholderia pseudomallei 1710b]
 gi|226194651|ref|ZP_03790246.1| DNA protecting protein DprA [Burkholderia pseudomallei Pakistan 9]
 gi|254188220|ref|ZP_04894732.1| DNA protecting protein DprA [Burkholderia pseudomallei Pasteur
           52237]
 gi|254261973|ref|ZP_04953027.1| DNA protecting protein DprA [Burkholderia pseudomallei 1710a]
 gi|254295704|ref|ZP_04963161.1| DNA protecting protein DprA [Burkholderia pseudomallei 406e]
 gi|76578119|gb|ABA47594.1| SMF family protein [Burkholderia pseudomallei 1710b]
 gi|157806182|gb|EDO83352.1| DNA protecting protein DprA [Burkholderia pseudomallei 406e]
 gi|157935900|gb|EDO91570.1| DNA protecting protein DprA [Burkholderia pseudomallei Pasteur
           52237]
 gi|225933352|gb|EEH29344.1| DNA protecting protein DprA [Burkholderia pseudomallei Pakistan 9]
 gi|254220662|gb|EET10046.1| DNA protecting protein DprA [Burkholderia pseudomallei 1710a]
          Length = 434

 Score = 41.4 bits (96), Expect = 0.049,   Method: Composition-based stats.
 Identities = 12/51 (23%), Positives = 29/51 (56%)

Query: 37  VRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
            R+  ++   P+ ++ +   T + +  ++ +LL+L+LAGR+   P G+ + 
Sbjct: 362 RRLLDAIGYGPVPLELLAQRTSLPSGTLHRLLLQLELAGRVAALPGGRYTR 412


>gi|313813527|gb|EFS51241.1| DNA protecting protein DprA [Propionibacterium acnes HL025PA1]
          Length = 377

 Score = 41.4 bits (96), Expect = 0.049,   Method: Composition-based stats.
 Identities = 9/76 (11%), Positives = 25/76 (32%), Gaps = 1/76 (1%)

Query: 15  SDTNHTKNINITHYPEYTQCERVRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLLELDL 73
                 +    +   +      + + ++L  +    +D++    G+        L  L+ 
Sbjct: 297 LAPEPERPAGRSLPTDILDAIELAVHEALPAHGSCGLDELAVLAGVPVAQCSAALSVLEQ 356

Query: 74  AGRLCHHPEGKVSLTM 89
            G      +G  S+T+
Sbjct: 357 LGMATCCLDGTWSVTL 372


>gi|260433998|ref|ZP_05787969.1| glycerol-3-phosphate regulon repressor [Silicibacter
          lacuscaerulensis ITI-1157]
 gi|260417826|gb|EEX11085.1| glycerol-3-phosphate regulon repressor [Silicibacter
          lacuscaerulensis ITI-1157]
          Length = 253

 Score = 41.4 bits (96), Expect = 0.049,   Method: Composition-based stats.
 Identities = 11/41 (26%), Positives = 18/41 (43%)

Query: 48 IHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
          + +DD+    G+    +   L EL  AG+L     G V  +
Sbjct: 20 VSVDDLAERFGVTVQTIRRDLTELAEAGKLDRVHGGAVLRS 60


>gi|322506376|gb|ADX01830.1| Rossmann-fold nucleotide-binding protein [Acinetobacter baumannii
           1656-2]
          Length = 376

 Score = 41.0 bits (95), Expect = 0.050,   Method: Composition-based stats.
 Identities = 19/83 (22%), Positives = 32/83 (38%), Gaps = 3/83 (3%)

Query: 3   HPQ--IEQNFFSSQSDTNHTKNINITHYPEYTQCERV-RIKQSLNNVPIHIDDIIHHTGI 59
           HP+  IE     +Q  +         +       E +  + QSL+ V  +ID ++ H  I
Sbjct: 287 HPEQIIEDLALPTQWQSQQQNQTEEANTNTPEIPEHLIDLYQSLDWVGQNIDQLVVHHNI 346

Query: 60  EAPVVYLVLLELDLAGRLCHHPE 82
               +   L+EL+L G       
Sbjct: 347 PVSELTSSLMELELLGLCMQQSG 369


>gi|237810336|ref|YP_002894787.1| DNA protecting protein DprA [Burkholderia pseudomallei MSHR346]
 gi|254197171|ref|ZP_04903594.1| DNA protecting protein DprA [Burkholderia pseudomallei S13]
 gi|169653913|gb|EDS86606.1| DNA protecting protein DprA [Burkholderia pseudomallei S13]
 gi|237503399|gb|ACQ95717.1| DNA protecting protein DprA [Burkholderia pseudomallei MSHR346]
          Length = 434

 Score = 41.0 bits (95), Expect = 0.050,   Method: Composition-based stats.
 Identities = 12/51 (23%), Positives = 29/51 (56%)

Query: 37  VRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
            R+  ++   P+ ++ +   T + +  ++ +LL+L+LAGR+   P G+ + 
Sbjct: 362 RRLLDAIGYGPVPLELLAQRTSLPSGTLHRLLLQLELAGRVAALPGGRYTR 412


>gi|50083491|ref|YP_045001.1| putative Rossmann-fold nucleotide-binding protein [Acinetobacter
           sp. ADP1]
 gi|49529467|emb|CAG67179.1| putative Rossmann-fold nucleotide-binding protein involved in DNA
           uptake (Smf) [Acinetobacter sp. ADP1]
          Length = 383

 Score = 41.0 bits (95), Expect = 0.050,   Method: Composition-based stats.
 Identities = 9/47 (19%), Positives = 16/47 (34%)

Query: 40  KQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
            Q L+     +D +  H       +   L+EL+L G         + 
Sbjct: 332 YQLLDWQGQDLDQLAQHYQGSTAELTAQLMELELLGVCIQQSGRYLR 378


>gi|254360309|ref|ZP_04976579.1| DNA protecting protein DprA [Burkholderia mallei 2002721280]
 gi|148029549|gb|EDK87454.1| DNA protecting protein DprA [Burkholderia mallei 2002721280]
          Length = 434

 Score = 41.0 bits (95), Expect = 0.051,   Method: Composition-based stats.
 Identities = 12/51 (23%), Positives = 29/51 (56%)

Query: 37  VRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
            R+  ++   P+ ++ +   T + +  ++ +LL+L+LAGR+   P G+ + 
Sbjct: 362 RRLLDAIGYGPVPLELLAQRTSLPSGTLHRLLLQLELAGRVAALPGGRYTR 412


>gi|148238859|ref|YP_001224246.1| Rossmann fold nucleotide-binding protein involved in DNA uptake
           [Synechococcus sp. WH 7803]
 gi|147847398|emb|CAK22949.1| Predicted Rossmann fold nucleotide-binding protein involved in DNA
           uptake [Synechococcus sp. WH 7803]
          Length = 368

 Score = 41.0 bits (95), Expect = 0.051,   Method: Composition-based stats.
 Identities = 11/78 (14%), Positives = 29/78 (37%), Gaps = 1/78 (1%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVV 64
            ++ + F     T    + +    P       V++ Q ++N    ++ +      +   +
Sbjct: 286 LVDLSAFIHALGTGPVPSPDSVGKPMPRTPSTVKLLQQVDNGAT-LEQMARSLQDDPQHI 344

Query: 65  YLVLLELDLAGRLCHHPE 82
              L++L+L G +   P 
Sbjct: 345 AQQLMQLELDGVVTPMPG 362


>gi|121598283|ref|YP_994103.1| DNA protecting protein DprA [Burkholderia mallei SAVP1]
 gi|126448750|ref|YP_001081877.1| DNA protecting protein DprA [Burkholderia mallei NCTC 10247]
 gi|238561913|ref|ZP_00441208.2| DNA protecting protein DprA [Burkholderia mallei GB8 horse 4]
 gi|251767986|ref|ZP_02269085.2| DNA protecting protein DprA [Burkholderia mallei PRL-20]
 gi|254203662|ref|ZP_04910022.1| DNA protecting protein DprA [Burkholderia mallei FMH]
 gi|121227093|gb|ABM49611.1| DNA protecting protein DprA [Burkholderia mallei SAVP1]
 gi|126241620|gb|ABO04713.1| DNA protecting protein DprA [Burkholderia mallei NCTC 10247]
 gi|147745174|gb|EDK52254.1| DNA protecting protein DprA [Burkholderia mallei FMH]
 gi|238523607|gb|EEP87044.1| DNA protecting protein DprA [Burkholderia mallei GB8 horse 4]
 gi|243061152|gb|EES43338.1| DNA protecting protein DprA [Burkholderia mallei PRL-20]
          Length = 434

 Score = 41.0 bits (95), Expect = 0.051,   Method: Composition-based stats.
 Identities = 12/51 (23%), Positives = 29/51 (56%)

Query: 37  VRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
            R+  ++   P+ ++ +   T + +  ++ +LL+L+LAGR+   P G+ + 
Sbjct: 362 RRLLDAIGYGPVPLELLAQRTSLPSGTLHRLLLQLELAGRVAALPGGRYTR 412


>gi|330819889|ref|YP_004348751.1| transcriptional regulator, DeoR family [Burkholderia gladioli
          BSR3]
 gi|327371884|gb|AEA63239.1| transcriptional regulator, DeoR family [Burkholderia gladioli
          BSR3]
          Length = 256

 Score = 41.0 bits (95), Expect = 0.052,   Method: Composition-based stats.
 Identities = 13/58 (22%), Positives = 26/58 (44%), Gaps = 1/58 (1%)

Query: 36 RVRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHLP 92
            RI+  L ++  + ++ +    G+    V   L+EL+ AG +     G + +   LP
Sbjct: 7  YRRIRALLKSHGTVSVEHMTQALGVSRETVRRDLVELETAGEIRRVHGGAMLVESELP 64


>gi|114566375|ref|YP_753529.1| DNA uptake Rossmann fold nucleotide-binding protein [Syntrophomonas
           wolfei subsp. wolfei str. Goettingen]
 gi|114337310|gb|ABI68158.1| Rossmann-fold nucleotide-binding protein involved in DNA uptake
           [Syntrophomonas wolfei subsp. wolfei str. Goettingen]
          Length = 362

 Score = 41.0 bits (95), Expect = 0.052,   Method: Composition-based stats.
 Identities = 16/67 (23%), Positives = 27/67 (40%)

Query: 19  HTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLC 78
             K + +     +   +   +   L   P+  DDII  TG     +  +LL+L+LAG + 
Sbjct: 293 PEKELPLQEQLLFLDEQEKVVVNCLAGDPLLFDDIIASTGFNIGELSRLLLKLELAGIVK 352

Query: 79  HHPEGKV 85
             P    
Sbjct: 353 SLPGNYY 359


>gi|218288280|ref|ZP_03492579.1| DNA protecting protein DprA [Alicyclobacillus acidocaldarius LAA1]
 gi|218241639|gb|EED08812.1| DNA protecting protein DprA [Alicyclobacillus acidocaldarius LAA1]
          Length = 366

 Score = 41.0 bits (95), Expect = 0.054,   Method: Composition-based stats.
 Identities = 18/85 (21%), Positives = 34/85 (40%), Gaps = 7/85 (8%)

Query: 4   PQIEQ-NFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAP 62
           P ++  + F   +D        I  + E       R      + PI   ++    G++  
Sbjct: 279 PLVDPNDLFPEPADVEIAGPWKIPAHLEPCYRALAR------HQPIRAGELATVAGLDLG 332

Query: 63  VVYLVLLELDLAGRLCHHPEGKVSL 87
            V+  LLE++LA  +  HP+G   +
Sbjct: 333 YVFGALLEMELACMVTRHPDGTYHI 357


>gi|307269411|ref|ZP_07550754.1| DeoR-like helix-turn-helix protein [Enterococcus faecalis TX4248]
 gi|306514250|gb|EFM82822.1| DeoR-like helix-turn-helix protein [Enterococcus faecalis TX4248]
          Length = 77

 Score = 41.0 bits (95), Expect = 0.055,   Method: Composition-based stats.
 Identities = 13/41 (31%), Positives = 18/41 (43%)

Query: 52 DIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHLP 92
          +I+    +    V   L EL+ AGRL     G  SL  + P
Sbjct: 26 EIMERLNVSDMTVRRDLTELEAAGRLKRVHGGASSLNTYRP 66


>gi|148257019|ref|YP_001241604.1| Crp/FNR family transcriptional regulator [Bradyrhizobium sp. BTAi1]
 gi|146409192|gb|ABQ37698.1| transcriptional regulator, Crp/Fnr family [Bradyrhizobium sp.
           BTAi1]
          Length = 237

 Score = 41.0 bits (95), Expect = 0.055,   Method: Composition-based stats.
 Identities = 14/57 (24%), Positives = 21/57 (36%), Gaps = 6/57 (10%)

Query: 36  RVRIKQSLNNV-----PIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           R R+            P+   DI  + G+    V     +L+  G +   P G VSL
Sbjct: 170 RDRLVDLRGPSNIVPLPMSRQDIADYLGLTIETVSRTFTKLERDGIITILPGG-VSL 225


>gi|254420463|ref|ZP_05034187.1| DNA protecting protein DprA, putative [Brevundimonas sp. BAL3]
 gi|196186640|gb|EDX81616.1| DNA protecting protein DprA, putative [Brevundimonas sp. BAL3]
          Length = 356

 Score = 41.0 bits (95), Expect = 0.055,   Method: Composition-based stats.
 Identities = 19/68 (27%), Positives = 23/68 (33%)

Query: 20  TKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCH 79
                   Y E       R+   L+  P   D+I          V   LLEL LAGR   
Sbjct: 289 APPSEPMDYGEVDDAFLDRVAALLSPTPTPRDEIARALNAPMGQVAAALLELSLAGRAEL 348

Query: 80  HPEGKVSL 87
            P G  S+
Sbjct: 349 LPGGLASI 356


>gi|332875642|ref|ZP_08443454.1| DNA protecting protein DprA [Acinetobacter baumannii 6014059]
 gi|332736215|gb|EGJ67230.1| DNA protecting protein DprA [Acinetobacter baumannii 6014059]
          Length = 383

 Score = 41.0 bits (95), Expect = 0.056,   Method: Composition-based stats.
 Identities = 19/83 (22%), Positives = 32/83 (38%), Gaps = 3/83 (3%)

Query: 3   HPQ--IEQNFFSSQSDTNHTKNINITHYPEYTQCERV-RIKQSLNNVPIHIDDIIHHTGI 59
           HP+  IE     +Q  +         +       E +  + QSL+ V  +ID ++ H  I
Sbjct: 294 HPEQIIEDLALPTQWQSQQQNQTEEANTNTPEIPEHLIDLYQSLDWVGQNIDQLVVHHNI 353

Query: 60  EAPVVYLVLLELDLAGRLCHHPE 82
               +   L+EL+L G       
Sbjct: 354 PVSELTSSLMELELLGLCMQQSG 376


>gi|308273580|emb|CBX30182.1| Protein smf [uncultured Desulfobacterium sp.]
          Length = 373

 Score = 41.0 bits (95), Expect = 0.056,   Method: Composition-based stats.
 Identities = 14/62 (22%), Positives = 29/62 (46%)

Query: 32  TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHL 91
              E  ++ ++L + P+HID++     +E   +  +LL+L+L   +   P    SL +  
Sbjct: 311 LNAEESQVLKALESYPVHIDELTRKVKMETGKLLSILLKLELQDLIKQAPGKLFSLRIKT 370

Query: 92  PS 93
             
Sbjct: 371 EE 372


>gi|225872979|ref|YP_002754438.1| transcriptional regulator, DeoR family [Acidobacterium capsulatum
          ATCC 51196]
 gi|225794483|gb|ACO34573.1| transcriptional regulator, DeoR family [Acidobacterium capsulatum
          ATCC 51196]
          Length = 261

 Score = 41.0 bits (95), Expect = 0.057,   Method: Composition-based stats.
 Identities = 12/49 (24%), Positives = 20/49 (40%), Gaps = 1/49 (2%)

Query: 36 RVRIKQS-LNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEG 83
            +I Q+ L      +D++   TG  A  V   L+ L+  G +     G
Sbjct: 9  EKQILQAVLRQGKSSVDELASLTGASAASVRRDLIRLEERGLVNRTHGG 57


>gi|313826227|gb|EFS63941.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL063PA1]
          Length = 232

 Score = 41.0 bits (95), Expect = 0.057,   Method: Composition-based stats.
 Identities = 11/45 (24%), Positives = 20/45 (44%), Gaps = 1/45 (2%)

Query: 51 DDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMH-LPSP 94
          D ++  TG     +   L +L+  G+L     G V++ +   P P
Sbjct: 2  DTLVELTGASPATIRRDLTDLEGHGQLRKVHGGAVAVNLRGTPMP 46


>gi|158315581|ref|YP_001508089.1| ArsR family transcriptional regulator [Frankia sp. EAN1pec]
 gi|158110986|gb|ABW13183.1| transcriptional regulator, ArsR family [Frankia sp. EAN1pec]
          Length = 117

 Score = 41.0 bits (95), Expect = 0.058,   Method: Composition-based stats.
 Identities = 16/62 (25%), Positives = 29/62 (46%)

Query: 33 QCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHLP 92
             R R+ + L   P  +++++   G+  P V   L  L  AG +   P+G+  L +  P
Sbjct: 11 DPHRRRVLELLRAGPRPVNELVEQLGLSQPGVSKHLRILREAGLVTVRPDGQRRLYLLEP 70

Query: 93 SP 94
          +P
Sbjct: 71 AP 72


>gi|304440375|ref|ZP_07400264.1| DNA processing protein DprA [Peptoniphilus duerdenii ATCC BAA-1640]
 gi|304371127|gb|EFM24744.1| DNA processing protein DprA [Peptoniphilus duerdenii ATCC BAA-1640]
          Length = 362

 Score = 41.0 bits (95), Expect = 0.059,   Method: Composition-based stats.
 Identities = 8/51 (15%), Positives = 20/51 (39%)

Query: 35  ERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
           + + +   +      +D I+ +T      V  +L  L++ G +     G+ 
Sbjct: 309 DELIVYDLIVKGKNDVDSIVQNTNFSVSQVSGILTVLEIKGVIMEESMGRF 359


>gi|171911229|ref|ZP_02926699.1| regulatory protein ArsR [Verrucomicrobium spinosum DSM 4136]
          Length = 120

 Score = 41.0 bits (95), Expect = 0.059,   Method: Composition-based stats.
 Identities = 13/63 (20%), Positives = 21/63 (33%)

Query: 32 TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHL 91
              R ++   L+     + D+     I    V   L  L+ AG +     G+V      
Sbjct: 17 ADPTRRQMLAQLSAGETCVTDLARPHAISLAAVSKHLGVLEKAGLVKRQRNGRVHSMTLD 76

Query: 92 PSP 94
          P P
Sbjct: 77 PKP 79


>gi|320326684|gb|EFW82729.1| DNA processing protein DprA [Pseudomonas syringae pv. glycinea str.
           B076]
 gi|320331342|gb|EFW87285.1| DNA processing protein DprA [Pseudomonas syringae pv. glycinea str.
           race 4]
          Length = 372

 Score = 41.0 bits (95), Expect = 0.060,   Method: Composition-based stats.
 Identities = 10/52 (19%), Positives = 18/52 (34%)

Query: 37  VRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
             +   L+  P   + +   +G     V   L EL+L GR+        +  
Sbjct: 320 HPLLALLHAAPHTSEGLSVSSGWPLLKVLAGLTELELDGRISCEAGRWFARA 371


>gi|291557378|emb|CBL34495.1| Predicted Rossmann fold nucleotide-binding protein involved in DNA
           uptake [Eubacterium siraeum V10Sc8a]
          Length = 492

 Score = 41.0 bits (95), Expect = 0.060,   Method: Composition-based stats.
 Identities = 12/92 (13%), Positives = 32/92 (34%), Gaps = 5/92 (5%)

Query: 1   MVHPQIEQN----FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSL-NNVPIHIDDIIH 55
           ++ P  E +      + Q      K             E   I   + N+  + +D ++ 
Sbjct: 397 IIAPIAETDNTDVSKAEQVTDTEDKQSGQIAEAAENASEAAEILGIIANSDGVTLDTLLS 456

Query: 56  HTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
              +    +  +L +L+++G +     G  ++
Sbjct: 457 ACSLSFGELSEILADLEISGAVSCGAGGIYTV 488


>gi|221194723|ref|ZP_03567780.1| putative DNA processing protein DprA [Atopobium rimae ATCC 49626]
 gi|221185627|gb|EEE18017.1| putative DNA processing protein DprA [Atopobium rimae ATCC 49626]
          Length = 299

 Score = 41.0 bits (95), Expect = 0.060,   Method: Composition-based stats.
 Identities = 9/60 (15%), Positives = 23/60 (38%)

Query: 26  THYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
               +     + RI  +L   P   +++    G +   +   L + + +G +   P+G+ 
Sbjct: 222 ARAQKDQTSPKSRIISALLASPSRPEELAMRLGEDVLTLMRTLTDFEASGIIQRLPDGRY 281


>gi|323516244|gb|ADX90625.1| Rossmann fold nucleotide-binding protein [Acinetobacter baumannii
           TCDC-AB0715]
          Length = 383

 Score = 41.0 bits (95), Expect = 0.061,   Method: Composition-based stats.
 Identities = 19/83 (22%), Positives = 32/83 (38%), Gaps = 3/83 (3%)

Query: 3   HPQ--IEQNFFSSQSDTNHTKNINITHYPEYTQCERV-RIKQSLNNVPIHIDDIIHHTGI 59
           HP+  IE     +Q  +         +       E +  + QSL+ V  +ID ++ H  I
Sbjct: 294 HPEQIIEDLALPTQWQSQQQNQTEEANTNTPEIPEHLIDLYQSLDWVGQNIDQLVVHHNI 353

Query: 60  EAPVVYLVLLELDLAGRLCHHPE 82
               +   L+EL+L G       
Sbjct: 354 PVSELTSSLMELELLGLCMQQSG 376


>gi|289627011|ref|ZP_06459965.1| DNA processing protein DprA [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289647924|ref|ZP_06479267.1| DNA processing protein DprA [Pseudomonas syringae pv. aesculi str.
           2250]
 gi|330867903|gb|EGH02612.1| DNA processing protein DprA [Pseudomonas syringae pv. aesculi str.
           0893_23]
          Length = 372

 Score = 41.0 bits (95), Expect = 0.061,   Method: Composition-based stats.
 Identities = 10/55 (18%), Positives = 18/55 (32%)

Query: 34  CERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
                +   L+  P   + +   +    P V   L EL+L GR+        +  
Sbjct: 317 PCDHPLLALLHAAPHTSEGLSVSSCWPLPKVLAGLTELELDGRISCEAGRWFARA 371


>gi|70733537|ref|YP_257176.1| smf protein [Pseudomonas fluorescens Pf-5]
 gi|68347836|gb|AAY95442.1| smf protein [Pseudomonas fluorescens Pf-5]
          Length = 364

 Score = 41.0 bits (95), Expect = 0.062,   Method: Composition-based stats.
 Identities = 11/63 (17%), Positives = 19/63 (30%)

Query: 25  ITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGK 84
                  T      +   L+  P   + +   +G   P V   L EL++ GR        
Sbjct: 300 PPSASLPTAACTHPLLALLHAAPHSSEALASASGWPLPRVLAALTELEIEGRAVDENGRW 359

Query: 85  VSL 87
            + 
Sbjct: 360 YAR 362


>gi|167736557|ref|ZP_02409331.1| DNA protecting protein DprA [Burkholderia pseudomallei 14]
 gi|167822175|ref|ZP_02453646.1| DNA protecting protein DprA [Burkholderia pseudomallei 9]
 gi|167892268|ref|ZP_02479670.1| DNA protecting protein DprA [Burkholderia pseudomallei 7894]
 gi|167908985|ref|ZP_02496076.1| DNA protecting protein DprA [Burkholderia pseudomallei 112]
          Length = 396

 Score = 41.0 bits (95), Expect = 0.062,   Method: Composition-based stats.
 Identities = 12/51 (23%), Positives = 29/51 (56%)

Query: 37  VRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
            R+  ++   P+ ++ +   T + +  ++ +LL+L+LAGR+   P G+ + 
Sbjct: 324 RRLLDAIGYGPVPLELLAQRTSLPSGTLHRLLLQLELAGRVAALPGGRYTR 374


>gi|167917027|ref|ZP_02504118.1| DNA protecting protein DprA [Burkholderia pseudomallei BCC215]
          Length = 396

 Score = 41.0 bits (95), Expect = 0.063,   Method: Composition-based stats.
 Identities = 12/51 (23%), Positives = 29/51 (56%)

Query: 37  VRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
            R+  ++   P+ ++ +   T + +  ++ +LL+L+LAGR+   P G+ + 
Sbjct: 324 RRLLDAIGYGPVPLELLAQRTSLPSGTLHRLLLQLELAGRVAALPGGRYTR 374


>gi|90406711|ref|ZP_01214904.1| DNA processing protein [Psychromonas sp. CNPT3]
 gi|90312164|gb|EAS40256.1| DNA processing protein [Psychromonas sp. CNPT3]
          Length = 164

 Score = 41.0 bits (95), Expect = 0.063,   Method: Composition-based stats.
 Identities = 9/49 (18%), Positives = 25/49 (51%)

Query: 39  IKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           + Q ++     +D ++  +G++   +   L+EL++ G +    +G + L
Sbjct: 114 LLQHIDFYNTTLDQLLQRSGLDLLSLQKQLIELEIDGSISLSVDGYIKL 162


>gi|53717761|ref|YP_106747.1| SMF family protein [Burkholderia pseudomallei K96243]
 gi|167813631|ref|ZP_02445311.1| DNA protecting protein DprA [Burkholderia pseudomallei 91]
 gi|52208175|emb|CAH34106.1| SMF family protein [Burkholderia pseudomallei K96243]
          Length = 396

 Score = 40.6 bits (94), Expect = 0.066,   Method: Composition-based stats.
 Identities = 12/51 (23%), Positives = 29/51 (56%)

Query: 37  VRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
            R+  ++   P+ ++ +   T + +  ++ +LL+L+LAGR+   P G+ + 
Sbjct: 324 RRLLDAIGYGPVPLELLAQRTSLPSGTLHRLLLQLELAGRVAALPGGRYTR 374


>gi|53724673|ref|YP_101981.1| DNA processing protein DprA [Burkholderia mallei ATCC 23344]
 gi|124383553|ref|YP_001028236.1| DNA protecting protein DprA [Burkholderia mallei NCTC 10229]
 gi|254177084|ref|ZP_04883741.1| DNA protecting protein DprA [Burkholderia mallei ATCC 10399]
 gi|254208637|ref|ZP_04914985.1| DNA protecting protein DprA [Burkholderia mallei JHU]
 gi|52428096|gb|AAU48689.1| DNA processing protein DprA, putative [Burkholderia mallei ATCC
           23344]
 gi|124291573|gb|ABN00842.1| DNA protecting protein DprA [Burkholderia mallei NCTC 10229]
 gi|147750513|gb|EDK57582.1| DNA protecting protein DprA [Burkholderia mallei JHU]
 gi|160698125|gb|EDP88095.1| DNA protecting protein DprA [Burkholderia mallei ATCC 10399]
          Length = 396

 Score = 40.6 bits (94), Expect = 0.067,   Method: Composition-based stats.
 Identities = 12/51 (23%), Positives = 29/51 (56%)

Query: 37  VRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
            R+  ++   P+ ++ +   T + +  ++ +LL+L+LAGR+   P G+ + 
Sbjct: 324 RRLLDAIGYGPVPLELLAQRTSLPSGTLHRLLLQLELAGRVAALPGGRYTR 374


>gi|257456000|ref|ZP_05621209.1| DNA protecting protein DprA [Enhydrobacter aerosaccus SK60]
 gi|257446589|gb|EEV21623.1| DNA protecting protein DprA [Enhydrobacter aerosaccus SK60]
          Length = 409

 Score = 40.6 bits (94), Expect = 0.068,   Method: Composition-based stats.
 Identities = 14/78 (17%), Positives = 26/78 (33%), Gaps = 3/78 (3%)

Query: 12  SSQSDTNHTKNINITHYPEYTQ--CERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLL 69
           S Q  +   +N      P           +   L+ V   +D ++  T  +   +   L+
Sbjct: 330 SPQLPSESAQNTQPHQAPLAMDVAPHLQTLLNQLDWVGQDLDSLVDKTRTDIATLMGWLI 389

Query: 70  ELDLAGRLCHHPEGKVSL 87
           EL+L G +     G    
Sbjct: 390 ELELMGLVMQ-RGGLYMR 406


>gi|119503588|ref|ZP_01625671.1| SMF protein [marine gamma proteobacterium HTCC2080]
 gi|119460650|gb|EAW41742.1| SMF protein [marine gamma proteobacterium HTCC2080]
          Length = 380

 Score = 40.6 bits (94), Expect = 0.068,   Method: Composition-based stats.
 Identities = 7/69 (10%), Positives = 24/69 (34%)

Query: 16  DTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAG 75
             +++ N   T      +  + ++   L +    +  +       +  +  ++ +L+L G
Sbjct: 306 ALDYSSNAGETVSLAPLEPAKRQLLTLLGDGEHDLASLASALQCSSRQLLAMVTQLELQG 365

Query: 76  RLCHHPEGK 84
            +     G 
Sbjct: 366 YVEQTSAGL 374


>gi|312143685|ref|YP_003995131.1| DNA protecting protein DprA [Halanaerobium sp. 'sapolanicus']
 gi|311904336|gb|ADQ14777.1| DNA protecting protein DprA [Halanaerobium sp. 'sapolanicus']
          Length = 381

 Score = 40.6 bits (94), Expect = 0.069,   Method: Composition-based stats.
 Identities = 9/67 (13%), Positives = 21/67 (31%), Gaps = 1/67 (1%)

Query: 21  KNINITHYPEYTQCERVRIKQSLNNV-PIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCH 79
               +         +  +I         I+ DD+I  + +    V  +L++ +L   +  
Sbjct: 304 DRNELQKVYPELNYDEKKILYLFQYELEIYYDDLIRLSNLTTDKVDKILIKFELMDLIQR 363

Query: 80  HPEGKVS 86
               K  
Sbjct: 364 LKGKKYR 370


>gi|260557578|ref|ZP_05829792.1| rossmann fold nucleotide-binding protein [Acinetobacter baumannii
           ATCC 19606]
 gi|260408751|gb|EEX02055.1| rossmann fold nucleotide-binding protein [Acinetobacter baumannii
           ATCC 19606]
          Length = 376

 Score = 40.6 bits (94), Expect = 0.069,   Method: Composition-based stats.
 Identities = 19/83 (22%), Positives = 32/83 (38%), Gaps = 3/83 (3%)

Query: 3   HPQ--IEQNFFSSQSDTNHTKNINITHYPEYTQCERV-RIKQSLNNVPIHIDDIIHHTGI 59
           HP+  IE     +Q  +         +       E +  + QSL+ V  +ID ++ H  I
Sbjct: 287 HPEQIIEDLALPTQWQSQQQNQTEEANTNTPEIPEHLIDLYQSLDWVGQNIDQLVVHHNI 346

Query: 60  EAPVVYLVLLELDLAGRLCHHPE 82
               +   L+EL+L G       
Sbjct: 347 PVSELTSSLMELELLGLCMQQSG 369


>gi|315230977|ref|YP_004071413.1| hypothetical protein TERMP_01214 [Thermococcus barophilus MP]
 gi|315184005|gb|ADT84190.1| hypothetical protein TERMP_01214 [Thermococcus barophilus MP]
          Length = 310

 Score = 40.6 bits (94), Expect = 0.070,   Method: Composition-based stats.
 Identities = 11/55 (20%), Positives = 27/55 (49%)

Query: 30  EYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGK 84
           E  + +  ++ + L N P+   +++   G+    V L+L +++  G +    EG+
Sbjct: 247 EVLRSDEEKVIELLKNGPVLQSELVKKLGVSKAKVSLLLKDMEKKGLIERVKEGR 301


>gi|262166816|ref|ZP_06034553.1| rossmann fold nucleotide-binding protein Smf possibly involved in
           DNA uptake [Vibrio mimicus VM223]
 gi|262026532|gb|EEY45200.1| rossmann fold nucleotide-binding protein Smf possibly involved in
           DNA uptake [Vibrio mimicus VM223]
          Length = 371

 Score = 40.6 bits (94), Expect = 0.070,   Method: Composition-based stats.
 Identities = 14/82 (17%), Positives = 28/82 (34%), Gaps = 9/82 (10%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVV 64
             E+  + +   +    +  +             +  ++      ID +   T I    V
Sbjct: 295 LSERVPYQATLFSAPQSDEELPFP---------ELLANVGVEATPIDILASRTHIPVQDV 345

Query: 65  YLVLLELDLAGRLCHHPEGKVS 86
            + LLEL+L G +   P G + 
Sbjct: 346 MMQLLELELLGHVVAVPGGYIR 367


>gi|262172814|ref|ZP_06040492.1| rossmann fold nucleotide-binding protein Smf possibly involved in
           DNA uptake [Vibrio mimicus MB-451]
 gi|261893890|gb|EEY39876.1| rossmann fold nucleotide-binding protein Smf possibly involved in
           DNA uptake [Vibrio mimicus MB-451]
          Length = 371

 Score = 40.6 bits (94), Expect = 0.070,   Method: Composition-based stats.
 Identities = 14/82 (17%), Positives = 28/82 (34%), Gaps = 9/82 (10%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVV 64
             E+  + +   +    +  +             +  ++      ID +   T I    V
Sbjct: 295 LSERVPYQATLFSAPQSDEELPFP---------ELLANVGVEATPIDILASRTHIPVQDV 345

Query: 65  YLVLLELDLAGRLCHHPEGKVS 86
            + LLEL+L G +   P G + 
Sbjct: 346 MMQLLELELLGHVVAVPGGYIR 367


>gi|299771933|ref|YP_003733959.1| Rossmann fold nucleotide-binding protein [Acinetobacter sp. DR1]
 gi|298702021|gb|ADI92586.1| Rossmann fold nucleotide-binding protein [Acinetobacter sp. DR1]
          Length = 377

 Score = 40.6 bits (94), Expect = 0.071,   Method: Composition-based stats.
 Identities = 18/82 (21%), Positives = 33/82 (40%), Gaps = 2/82 (2%)

Query: 1   MVHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIE 60
           ++        + SQ   N T+ + ++  PE  +     + QSL+ V   ID ++ H    
Sbjct: 291 IIEDLALPTQWQSQQ-QNSTEEVVVSCAPEIPEHLIN-LYQSLDWVGQDIDQLVIHHSQP 348

Query: 61  APVVYLVLLELDLAGRLCHHPE 82
              +   L+EL+L G       
Sbjct: 349 VAELTSSLMELELLGLCMQQSG 370


>gi|126658133|ref|ZP_01729284.1| SMF protein [Cyanothece sp. CCY0110]
 gi|126620504|gb|EAZ91222.1| SMF protein [Cyanothece sp. CCY0110]
          Length = 375

 Score = 40.6 bits (94), Expect = 0.071,   Method: Composition-based stats.
 Identities = 13/66 (19%), Positives = 25/66 (37%)

Query: 22  NINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHP 81
            +           E ++I Q+++      D I+   G+    V   LL+L+L G +   P
Sbjct: 308 EVEKKEDVPKLDPELLKIFQAISTEATSFDVIVEKAGLPTAQVSGGLLQLELEGLITQLP 367

Query: 82  EGKVSL 87
             +   
Sbjct: 368 GMRYQR 373


>gi|258622992|ref|ZP_05718007.1| Smf/DprA family protein [Vibrio mimicus VM573]
 gi|258584775|gb|EEW09509.1| Smf/DprA family protein [Vibrio mimicus VM573]
          Length = 371

 Score = 40.6 bits (94), Expect = 0.074,   Method: Composition-based stats.
 Identities = 14/82 (17%), Positives = 28/82 (34%), Gaps = 9/82 (10%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVV 64
             E+  + +   +    +  +             +  ++      ID +   T I    V
Sbjct: 295 LSERVPYQATLFSAPQSDEELPFP---------ELLANVGVEATPIDILASRTHIPVQDV 345

Query: 65  YLVLLELDLAGRLCHHPEGKVS 86
            + LLEL+L G +   P G + 
Sbjct: 346 MMQLLELELLGHVVAVPGGYIR 367


>gi|327445018|gb|EGE91672.1| DNA protecting protein DprA [Propionibacterium acnes HL043PA1]
          Length = 377

 Score = 40.6 bits (94), Expect = 0.076,   Method: Composition-based stats.
 Identities = 8/76 (10%), Positives = 25/76 (32%), Gaps = 1/76 (1%)

Query: 15  SDTNHTKNINITHYPEYTQCERVRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLLELDL 73
                 +    +   +      + + ++L  +    +D++    G+        L  L+ 
Sbjct: 297 LAPEPERPAGRSLPTDILDAIELAVHEALPAHGSCGLDELAVLAGVPVAQCSAALSVLEQ 356

Query: 74  AGRLCHHPEGKVSLTM 89
            G      +G  ++T+
Sbjct: 357 LGMAACCLDGTWAVTL 372


>gi|269958987|ref|YP_003328776.1| putativeDNA recombination-mediator protein A [Anaplasma centrale
           str. Israel]
 gi|269848818|gb|ACZ49462.1| putativeDNA recombination-mediator protein A [Anaplasma centrale
           str. Israel]
          Length = 378

 Score = 40.6 bits (94), Expect = 0.077,   Method: Composition-based stats.
 Identities = 15/75 (20%), Positives = 31/75 (41%)

Query: 17  TNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGR 76
            +  +  +       +   R  I Q L+  P  I+D+   T I    +   L+EL+L  +
Sbjct: 304 RHAARRQDAATDGAGSAAIRRAILQQLSVSPTDIEDLAACTKIGTSTLLAELIELELLRK 363

Query: 77  LCHHPEGKVSLTMHL 91
           +   P  + +L++  
Sbjct: 364 VHRFPGNRFALSLEN 378


>gi|258590885|emb|CBE67180.1| DNA processing chain A (DprA/Smf) [NC10 bacterium 'Dutch sediment']
          Length = 379

 Score = 40.6 bits (94), Expect = 0.078,   Method: Composition-based stats.
 Identities = 18/73 (24%), Positives = 32/73 (43%)

Query: 14  QSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDL 73
           Q   +    +++T      + + V I  +L   P+ IDD+I  T + A  +  +LL L L
Sbjct: 297 QVAPSAQTMLDLTAARSPLEPQEVLIIDTLEAGPMQIDDLIARTQLPAGQMASLLLSLML 356

Query: 74  AGRLCHHPEGKVS 86
            G +   P    +
Sbjct: 357 KGLIEELPGKSFA 369


>gi|300932543|ref|ZP_07147799.1| hypothetical protein CresD4_00620 [Corynebacterium resistens DSM
          45100]
          Length = 93

 Score = 40.6 bits (94), Expect = 0.079,   Method: Composition-based stats.
 Identities = 9/38 (23%), Positives = 17/38 (44%)

Query: 43 LNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHH 80
          +++    + +I   TG+    V   LL+L+  GR    
Sbjct: 1  MSDGVTTVGEIARRTGLAPSTVDAALLQLERMGRARKV 38


>gi|226357401|ref|YP_002787141.1| DNA processing protein DprA (Smf) [Deinococcus deserti VCD115]
 gi|226319391|gb|ACO47387.1| putative DNA processing protein DprA (Smf) [Deinococcus deserti
           VCD115]
          Length = 369

 Score = 40.6 bits (94), Expect = 0.080,   Method: Composition-based stats.
 Identities = 12/63 (19%), Positives = 22/63 (34%), Gaps = 1/63 (1%)

Query: 25  ITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGK 84
                     ++  + ++L   P  +DD+   TG+  P +   L+ L L G         
Sbjct: 308 PARPLPTLPPDQAAVLEAL-TAPATLDDLRAATGLCLPELQTALVMLQLQGLAEESGGRW 366

Query: 85  VSL 87
           V  
Sbjct: 367 VRR 369


>gi|261822171|ref|YP_003260277.1| DeoR family transcriptional regulator [Pectobacterium wasabiae
          WPP163]
 gi|261606184|gb|ACX88670.1| transcriptional regulator, DeoR family [Pectobacterium wasabiae
          WPP163]
          Length = 256

 Score = 40.6 bits (94), Expect = 0.081,   Method: Composition-based stats.
 Identities = 16/58 (27%), Positives = 25/58 (43%), Gaps = 2/58 (3%)

Query: 37 VRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHLPSP 94
            +  +LN   +  + II H G+    V   +L+L+ AG L     G V+ T     P
Sbjct: 11 QALLSTLNR--VSTEKIIQHLGVSRETVRRDILKLEAAGALRRVHGGIVATTEEPEPP 66


>gi|241664934|ref|YP_002983294.1| DNA protecting protein DprA [Ralstonia pickettii 12D]
 gi|240866961|gb|ACS64622.1| DNA protecting protein DprA [Ralstonia pickettii 12D]
          Length = 401

 Score = 40.6 bits (94), Expect = 0.083,   Method: Composition-based stats.
 Identities = 13/50 (26%), Positives = 22/50 (44%)

Query: 36  RVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
              +  +L   P+ +D +   TG  A  +   LL L+L  R+   P G+ 
Sbjct: 348 ETALLDALGFDPVDLDTLCERTGQAAAALSAQLLALELDSRVERQPGGRF 397


>gi|282883340|ref|ZP_06291934.1| DNA protecting protein DprA [Peptoniphilus lacrimalis 315-B]
 gi|281296844|gb|EFA89346.1| DNA protecting protein DprA [Peptoniphilus lacrimalis 315-B]
          Length = 360

 Score = 40.6 bits (94), Expect = 0.084,   Method: Composition-based stats.
 Identities = 14/68 (20%), Positives = 28/68 (41%), Gaps = 5/68 (7%)

Query: 21  KNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHH 80
           K     H  E    +   I   + +  I I++I + +  +   +  +L +L+L   +   
Sbjct: 293 KKEEEKHIIENLSEDENLILNLMEDGNITIEEICNKSNFDVIYINSLLTKLELKSVIE-- 350

Query: 81  PEGKVSLT 88
              K+SLT
Sbjct: 351 ---KISLT 355


>gi|255280064|ref|ZP_05344619.1| DNA processing protein DprA [Bryantella formatexigens DSM 14469]
 gi|255269155|gb|EET62360.1| DNA processing protein DprA [Bryantella formatexigens DSM 14469]
          Length = 367

 Score = 40.6 bits (94), Expect = 0.084,   Method: Composition-based stats.
 Identities = 8/44 (18%), Positives = 16/44 (36%)

Query: 34  CERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRL 77
                +   L++   ++  +   T I    V   L  L+L G +
Sbjct: 312 SSEKLVYSCLDSDAKNLQTLAEETDIPVWQVMGALSALELKGLV 355


>gi|149375616|ref|ZP_01893385.1| probable smf protein [Marinobacter algicola DG893]
 gi|149360018|gb|EDM48473.1| probable smf protein [Marinobacter algicola DG893]
          Length = 388

 Score = 40.2 bits (93), Expect = 0.086,   Method: Composition-based stats.
 Identities = 9/52 (17%), Positives = 22/52 (42%)

Query: 11  FSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAP 62
           ++ Q++ + +  +      E      + + ++L   P   DD+   TG+ A 
Sbjct: 311 WTGQNEGDPSSVVMKRPAIEGLDSREIAVLEALGYDPQSTDDLCSVTGLPAD 362


>gi|240124645|ref|ZP_04737531.1| DprA [Neisseria gonorrhoeae SK-92-679]
 gi|268683219|ref|ZP_06150081.1| DNA processing chain A [Neisseria gonorrhoeae SK-92-679]
 gi|268623503|gb|EEZ55903.1| DNA processing chain A [Neisseria gonorrhoeae SK-92-679]
          Length = 397

 Score = 40.2 bits (93), Expect = 0.087,   Method: Composition-based stats.
 Identities = 15/72 (20%), Positives = 23/72 (31%), Gaps = 3/72 (4%)

Query: 16  DTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAG 75
                  +               I   +   PIH D +     + A  +Y  LLEL+L G
Sbjct: 326 APPPAAKMPSEGA---AGGTAGGILDKMGFDPIHPDVLAGQLAMPAADLYAALLELELDG 382

Query: 76  RLCHHPEGKVSL 87
            +   P G+   
Sbjct: 383 SVAAMPGGRYQR 394


>gi|262371338|ref|ZP_06064656.1| DNA protecting protein DprA [Acinetobacter johnsonii SH046]
 gi|262313675|gb|EEY94724.1| DNA protecting protein DprA [Acinetobacter johnsonii SH046]
          Length = 377

 Score = 40.2 bits (93), Expect = 0.089,   Method: Composition-based stats.
 Identities = 8/80 (10%), Positives = 27/80 (33%), Gaps = 1/80 (1%)

Query: 8   QNFFSSQSDTNHTKNINITHYPE-YTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYL 66
           ++        + +++   T         + + +   L+ V  ++D +      +   +  
Sbjct: 293 EDLALPTQWYSQSQSQETTPSASIEIPSDLLELYNQLDWVGQNMDQLNFKLNTDIATLTS 352

Query: 67  VLLELDLAGRLCHHPEGKVS 86
            L+EL++ G         + 
Sbjct: 353 QLMELEILGLAQQQAGNYLR 372


>gi|258626116|ref|ZP_05720967.1| Smf/DprA family protein [Vibrio mimicus VM603]
 gi|258581642|gb|EEW06540.1| Smf/DprA family protein [Vibrio mimicus VM603]
          Length = 371

 Score = 40.2 bits (93), Expect = 0.089,   Method: Composition-based stats.
 Identities = 14/82 (17%), Positives = 28/82 (34%), Gaps = 9/82 (10%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVV 64
             E+  + +   +    +  +             +  ++      ID +   T I    V
Sbjct: 295 LSERVPYQATLFSAPQGDEELPFP---------ELLANVGVEATPIDILASRTHIPVQDV 345

Query: 65  YLVLLELDLAGRLCHHPEGKVS 86
            + LLEL+L G +   P G + 
Sbjct: 346 MMQLLELELLGHVVAVPGGYIR 367


>gi|268325350|emb|CBH38938.1| hypothetical protein BSM_24150 [uncultured archaeon]
 gi|268325957|emb|CBH39545.1| conserved hypothetical protein [uncultured archaeon]
          Length = 160

 Score = 40.2 bits (93), Expect = 0.090,   Method: Composition-based stats.
 Identities = 10/49 (20%), Positives = 17/49 (34%), Gaps = 2/49 (4%)

Query: 33 QCERVRIKQSL--NNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCH 79
               +I   L      I +D++   TG     V   L  ++ AG +  
Sbjct: 23 DELSSKIIGILFIEPEEIALDELARRTGYSLSAVSTALKFIERAGIVKR 71


>gi|303232642|ref|ZP_07319327.1| putative DNA protecting protein DprA [Atopobium vaginae PB189-T1-4]
 gi|302481128|gb|EFL44203.1| putative DNA protecting protein DprA [Atopobium vaginae PB189-T1-4]
          Length = 303

 Score = 40.2 bits (93), Expect = 0.091,   Method: Composition-based stats.
 Identities = 9/51 (17%), Positives = 20/51 (39%)

Query: 36  RVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
             R+  +L   P+  D++          V   L + ++ G +    +G+ S
Sbjct: 241 EGRMLAALIANPMRADELACALDEPIVSVLSALGDYEIQGLVKRMLDGRFS 291


>gi|294648883|ref|ZP_06726339.1| smf family protein [Acinetobacter haemolyticus ATCC 19194]
 gi|292825274|gb|EFF84021.1| smf family protein [Acinetobacter haemolyticus ATCC 19194]
          Length = 376

 Score = 40.2 bits (93), Expect = 0.091,   Method: Composition-based stats.
 Identities = 10/80 (12%), Positives = 24/80 (30%), Gaps = 1/80 (1%)

Query: 8   QNFFSSQSDTNHTKNINITHYPEYTQCERV-RIKQSLNNVPIHIDDIIHHTGIEAPVVYL 66
           ++        +  ++   +          +  + Q L+ V   ID +          +  
Sbjct: 292 EDLALPTQWQSEQQSSEKSSNAAPNLPSHLVGLYQCLDWVGQDIDQLTQQQQSNIAELTS 351

Query: 67  VLLELDLAGRLCHHPEGKVS 86
            L+EL+L G         + 
Sbjct: 352 QLMELELLGLCTQQGGRYLR 371


>gi|120552988|ref|YP_957339.1| DNA protecting protein DprA [Marinobacter aquaeolei VT8]
 gi|120322837|gb|ABM17152.1| DNA protecting protein DprA [Marinobacter aquaeolei VT8]
          Length = 405

 Score = 40.2 bits (93), Expect = 0.092,   Method: Composition-based stats.
 Identities = 15/74 (20%), Positives = 28/74 (37%)

Query: 11  FSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLE 70
           +S Q+     +    +    +     + + ++L   P   D +   TG+ A  +   LL 
Sbjct: 320 WSMQAQPAEPEATENSSDLSFLDSREIAVFEALGYDPQSTDALGLATGLPADQLLQSLLI 379

Query: 71  LDLAGRLCHHPEGK 84
           L+L G     P G 
Sbjct: 380 LELEGLAHACPGGY 393


>gi|46445706|ref|YP_007071.1| putative protein required for chromosomal DNA transformation
           [Candidatus Protochlamydia amoebophila UWE25]
 gi|46399347|emb|CAF22796.1| putative protein required for chromosomal DNA transformation
           [Candidatus Protochlamydia amoebophila UWE25]
          Length = 363

 Score = 40.2 bits (93), Expect = 0.093,   Method: Composition-based stats.
 Identities = 11/55 (20%), Positives = 21/55 (38%)

Query: 32  TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
            Q E + + Q L    + I++I+    +    V  +L+ L L   +   P     
Sbjct: 307 LQQEEIHLLQKLPVEELSIEEIVKRAQLPIQQVNSLLMSLVLKKIIKEFPGKFYK 361


>gi|254805838|ref|YP_003084059.1| DNA processing protein DprA [Neisseria meningitidis alpha14]
 gi|254669380|emb|CBA08516.1| DNA processing protein DprA [Neisseria meningitidis alpha14]
          Length = 395

 Score = 40.2 bits (93), Expect = 0.094,   Method: Composition-based stats.
 Identities = 15/49 (30%), Positives = 22/49 (44%)

Query: 39  IKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           I   +   PIH D +     + A  +Y  LLEL+L G +   P G+   
Sbjct: 344 ILDKMGFDPIHPDVLAGQLAMPAADLYAALLELELDGSVAAMPGGRYQR 392


>gi|14521903|ref|NP_127380.1| ArsR family transcriptional regulator [Pyrococcus abyssi GE5]
 gi|5459123|emb|CAB50609.1| Transcriptional regulatory protein, arsR family [Pyrococcus
          abyssi GE5]
          Length = 184

 Score = 40.2 bits (93), Expect = 0.095,   Method: Composition-based stats.
 Identities = 10/46 (21%), Positives = 22/46 (47%)

Query: 33 QCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLC 78
             R++I + L + P+ + ++    G +   VY  +  L+ AG + 
Sbjct: 19 DRTRMKILELLRDHPMSVSELAERLGKDKSTVYRHIKALEKAGLVE 64


>gi|251790097|ref|YP_003004818.1| DeoR family transcriptional regulator [Dickeya zeae Ech1591]
 gi|247538718|gb|ACT07339.1| transcriptional regulator, DeoR family [Dickeya zeae Ech1591]
          Length = 258

 Score = 40.2 bits (93), Expect = 0.097,   Method: Composition-based stats.
 Identities = 14/47 (29%), Positives = 20/47 (42%)

Query: 48 IHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHLPSP 94
          +  D II H G+    V   +L+L+  G L     G VS  +    P
Sbjct: 20 VSTDHIIQHLGVSRETVRRDVLKLEAQGVLRRVHGGVVSTGVEPEPP 66


>gi|262402046|ref|ZP_06078610.1| rossmann fold nucleotide-binding protein Smf possibly involved in
           DNA uptake [Vibrio sp. RC586]
 gi|262351692|gb|EEZ00824.1| rossmann fold nucleotide-binding protein Smf possibly involved in
           DNA uptake [Vibrio sp. RC586]
          Length = 371

 Score = 40.2 bits (93), Expect = 0.098,   Method: Composition-based stats.
 Identities = 13/82 (15%), Positives = 28/82 (34%), Gaps = 9/82 (10%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVV 64
             E+  + +   +    +  +             +  ++      ID +   T I    +
Sbjct: 295 LSERVPYQATLFSAPQGDEELPFP---------ELLANVGVEATPIDILASRTQIPVQDI 345

Query: 65  YLVLLELDLAGRLCHHPEGKVS 86
            + LLEL+L G +   P G + 
Sbjct: 346 MMQLLELELLGHVVAVPGGYIR 367


>gi|116621518|ref|YP_823674.1| DNA protecting protein DprA [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116224680|gb|ABJ83389.1| DNA protecting protein DprA [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 391

 Score = 40.2 bits (93), Expect = 0.099,   Method: Composition-based stats.
 Identities = 11/60 (18%), Positives = 20/60 (33%), Gaps = 2/60 (3%)

Query: 26  THYPEYTQCERVRIKQSLNNV-PIHIDDIIHHT-GIEAPVVYLVLLELDLAGRLCHHPEG 83
           +           R  + L     IH+DD++          +   L EL++ G +   P  
Sbjct: 326 SDPAPELGTVSRRTLEVLQVDNSIHLDDLLEKVEDTSPSELIAALFELEMLGLVKQLPGK 385


>gi|288869534|ref|ZP_05974841.2| conserved hypothetical protein [Methanobrevibacter smithii DSM
          2374]
 gi|288861786|gb|EFC94084.1| conserved hypothetical protein [Methanobrevibacter smithii DSM
          2374]
          Length = 266

 Score = 40.2 bits (93), Expect = 0.10,   Method: Composition-based stats.
 Identities = 11/53 (20%), Positives = 24/53 (45%), Gaps = 1/53 (1%)

Query: 36 RVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
          R++I  +L   P+++ DI   TG+    +   +  L+L G +         ++
Sbjct: 30 RLKILATLYEQPLNMKDINRTTGLSYSSISSNMFGLELGGFIYR-SGNLYHIS 81


>gi|148642464|ref|YP_001272977.1| transcriptional regulator [Methanobrevibacter smithii ATCC 35061]
 gi|148551481|gb|ABQ86609.1| predicted transcriptional regulator [Methanobrevibacter smithii
          ATCC 35061]
          Length = 263

 Score = 40.2 bits (93), Expect = 0.10,   Method: Composition-based stats.
 Identities = 11/53 (20%), Positives = 24/53 (45%), Gaps = 1/53 (1%)

Query: 36 RVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
          R++I  +L   P+++ DI   TG+    +   +  L+L G +         ++
Sbjct: 27 RLKILATLYEQPLNMKDINRTTGLSYSSISSNMFGLELGGFIYR-SGNLYHIS 78


>gi|146342150|ref|YP_001207198.1| transcriptional regulator [Bradyrhizobium sp. ORS278]
 gi|146194956|emb|CAL78981.1| putative transcriptional regulator with a cAMP binding domain, Crp
           family; putative nitrogen fixation regulation protein
           fixK [Bradyrhizobium sp. ORS278]
          Length = 194

 Score = 40.2 bits (93), Expect = 0.11,   Method: Composition-based stats.
 Identities = 14/57 (24%), Positives = 22/57 (38%), Gaps = 6/57 (10%)

Query: 36  RVRIKQSLNNV-----PIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           R R+ +          P+   DI  + G+    V     +L+  G +   P G VSL
Sbjct: 127 RDRLVELRGPSNIVPLPMSRQDIADYLGLTIETVSRTFTKLERDGVIAILPGG-VSL 182


>gi|291280181|ref|YP_003497016.1| DNA processing protein A [Deferribacter desulfuricans SSM1]
 gi|290754883|dbj|BAI81260.1| DNA processing protein A [Deferribacter desulfuricans SSM1]
          Length = 378

 Score = 40.2 bits (93), Expect = 0.11,   Method: Composition-based stats.
 Identities = 8/46 (17%), Positives = 19/46 (41%)

Query: 32  TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRL 77
                 +I  +L   P +ID++     ++   +   L  ++L G +
Sbjct: 320 EDALEEKIYNALALFPKNIDELCLSINLDYVSIMNKLSMMELKGLI 365


>gi|293611138|ref|ZP_06693436.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292826389|gb|EFF84756.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 377

 Score = 40.2 bits (93), Expect = 0.11,   Method: Composition-based stats.
 Identities = 18/82 (21%), Positives = 33/82 (40%), Gaps = 2/82 (2%)

Query: 1   MVHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIE 60
           ++        + SQ   N T+   ++  PE  +     + QSL+ V  +ID ++ H    
Sbjct: 291 IIEDLALPTQWQSQQ-QNSTEEAVVSSTPEIPEHLIN-LYQSLDWVGQNIDQLVLHHSQP 348

Query: 61  APVVYLVLLELDLAGRLCHHPE 82
              +   L+EL+L G       
Sbjct: 349 VAELTSSLMELELLGLCMQQSG 370


>gi|34763132|ref|ZP_00144101.1| Smf protein [Fusobacterium nucleatum subsp. vincentii ATCC 49256]
 gi|237742000|ref|ZP_04572481.1| SMF family protein [Fusobacterium sp. 4_1_13]
 gi|256845340|ref|ZP_05550798.1| DNA protecting protein DprA [Fusobacterium sp. 3_1_36A2]
 gi|27887195|gb|EAA24297.1| Smf protein [Fusobacterium nucleatum subsp. vincentii ATCC 49256]
 gi|229429648|gb|EEO39860.1| SMF family protein [Fusobacterium sp. 4_1_13]
 gi|256718899|gb|EEU32454.1| DNA protecting protein DprA [Fusobacterium sp. 3_1_36A2]
          Length = 288

 Score = 40.2 bits (93), Expect = 0.11,   Method: Composition-based stats.
 Identities = 12/48 (25%), Positives = 24/48 (50%), Gaps = 1/48 (2%)

Query: 39  IKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
           I  SL++   ++D+I+  T IE   +   L+ L++ G +     G+  
Sbjct: 239 ILNSLSSE-KNLDNILIETKIEQTEILAELMALEIMGVIKSIAGGRYK 285


>gi|330957383|gb|EGH57643.1| DNA processing protein DprA [Pseudomonas syringae pv. maculicola
           str. ES4326]
          Length = 371

 Score = 40.2 bits (93), Expect = 0.11,   Method: Composition-based stats.
 Identities = 10/52 (19%), Positives = 18/52 (34%)

Query: 37  VRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
             +   L+  P   + +   +G   P V   L EL+L  R+        +  
Sbjct: 319 HPLLALLHAAPHTSEGLSVSSGWPLPKVLAGLTELELDERISCEAGRWFARA 370


>gi|153854395|ref|ZP_01995673.1| hypothetical protein DORLON_01668 [Dorea longicatena DSM 13814]
 gi|149752921|gb|EDM62852.1| hypothetical protein DORLON_01668 [Dorea longicatena DSM 13814]
          Length = 238

 Score = 40.2 bits (93), Expect = 0.11,   Method: Composition-based stats.
 Identities = 8/54 (14%), Positives = 19/54 (35%)

Query: 32  TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
            +     +   L+  P   + ++  TG+    +   L+ L+L G +        
Sbjct: 181 LESPEFMVYSCLDLFPKGTNQLMKETGLSVTELMERLITLELNGYVKEVSRNYY 234


>gi|320012239|gb|ADW07089.1| transcriptional regulator, DeoR family [Streptomyces flavogriseus
          ATCC 33331]
          Length = 253

 Score = 39.8 bits (92), Expect = 0.11,   Method: Composition-based stats.
 Identities = 11/61 (18%), Positives = 18/61 (29%)

Query: 25 ITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGK 84
              P      R  I  +L      +DD+    G+    +   L  L+    +     G 
Sbjct: 2  SEENPAEGDHRRASIVTALREGVRRVDDLARACGVSTMTIRRDLRVLEQRNEIRRVRGGA 61

Query: 85 V 85
          V
Sbjct: 62 V 62


>gi|88860595|ref|ZP_01135232.1| hypothetical protein PTD2_05040 [Pseudoalteromonas tunicata D2]
 gi|88817190|gb|EAR27008.1| hypothetical protein PTD2_05040 [Pseudoalteromonas tunicata D2]
          Length = 363

 Score = 39.8 bits (92), Expect = 0.11,   Method: Composition-based stats.
 Identities = 11/54 (20%), Positives = 23/54 (42%)

Query: 34  CERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
            +   +   L    + +D++ + T I    +   LL+L+L+  +     G V L
Sbjct: 307 DDEEPLLAELGYDVMTVDELSNKTNIPIEQLLTRLLDLELSNHVERVLGGYVKL 360


>gi|226952178|ref|ZP_03822642.1| Rossmann-fold nucleotide-binding protein involved in DNA uptake
           (Smf) [Acinetobacter sp. ATCC 27244]
 gi|226837016|gb|EEH69399.1| Rossmann-fold nucleotide-binding protein involved in DNA uptake
           (Smf) [Acinetobacter sp. ATCC 27244]
          Length = 364

 Score = 39.8 bits (92), Expect = 0.11,   Method: Composition-based stats.
 Identities = 10/80 (12%), Positives = 24/80 (30%), Gaps = 1/80 (1%)

Query: 8   QNFFSSQSDTNHTKNINITHYPEYTQCERV-RIKQSLNNVPIHIDDIIHHTGIEAPVVYL 66
           ++        +  ++   +          +  + Q L+ V   ID +          +  
Sbjct: 280 EDLALPTQWQSEQQSSEKSSNAAPNLPSHLVGLYQCLDWVGQDIDQLTQQQQSNIAELTS 339

Query: 67  VLLELDLAGRLCHHPEGKVS 86
            L+EL+L G         + 
Sbjct: 340 HLMELELLGLCTQQGGRYLR 359


>gi|13475230|ref|NP_106794.1| hypothetical protein mlr8761 [Mesorhizobium loti MAFF303099]
 gi|14025981|dbj|BAB52580.1| mlr8761 [Mesorhizobium loti MAFF303099]
          Length = 269

 Score = 39.8 bits (92), Expect = 0.12,   Method: Composition-based stats.
 Identities = 10/63 (15%), Positives = 19/63 (30%), Gaps = 4/63 (6%)

Query: 21 KNINITHYPEYTQCERVRI--KQSLNNV--PIHIDDIIHHTGIEAPVVYLVLLELDLAGR 76
             +    P      +  +   + L     PI +++I    G     V   L  L+  G 
Sbjct: 7  SPNDQDRAPGEVSTVQRALNLLKLLGTTEKPIGVNEIARRLGKHVSAVSRTLATLEHNGF 66

Query: 77 LCH 79
          +  
Sbjct: 67 VER 69


>gi|187920150|ref|YP_001889181.1| DEAD/H associated domain-containing protein [Burkholderia
            phytofirmans PsJN]
 gi|187718588|gb|ACD19811.1| DEAD/H associated domain protein [Burkholderia phytofirmans PsJN]
          Length = 1504

 Score = 39.8 bits (92), Expect = 0.12,   Method: Composition-based stats.
 Identities = 11/75 (14%), Positives = 19/75 (25%), Gaps = 3/75 (4%)

Query: 5    QIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVV 64
                  F+           +           R R+       P+ +D I     + A  V
Sbjct: 1019 LYPPAEFAPALAAPKGYTESWNADDALIDVLRARLT---GFGPLPVDAIAEALKLPAASV 1075

Query: 65   YLVLLELDLAGRLCH 79
               L  L+  G +  
Sbjct: 1076 EQSLTRLEAEGYVMR 1090


>gi|325290385|ref|YP_004266566.1| DNA protecting protein DprA [Syntrophobotulus glycolicus DSM 8271]
 gi|324965786|gb|ADY56565.1| DNA protecting protein DprA [Syntrophobotulus glycolicus DSM 8271]
          Length = 383

 Score = 39.8 bits (92), Expect = 0.12,   Method: Composition-based stats.
 Identities = 15/57 (26%), Positives = 27/57 (47%)

Query: 34  CERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMH 90
            E +++   L++VP+HID +  +  +    + L LLEL+L   +   P     L   
Sbjct: 327 TENLQLLDYLSDVPLHIDTLALNCSMSPHTIALGLLELELQEIVKQLPGQYYVLARR 383


>gi|193076054|gb|ABO10649.2| putative Rossmann-fold nucleotide-binding DNA uptake protein (Smf)
           [Acinetobacter baumannii ATCC 17978]
          Length = 383

 Score = 39.8 bits (92), Expect = 0.12,   Method: Composition-based stats.
 Identities = 19/83 (22%), Positives = 32/83 (38%), Gaps = 3/83 (3%)

Query: 3   HPQ--IEQNFFSSQSDTNHTKNINITHYPEYTQCERV-RIKQSLNNVPIHIDDIIHHTGI 59
           HP+  IE     +Q  +         +       E +  + QSL+ V  +ID ++ H  I
Sbjct: 294 HPEQIIEDLALPTQWQSQQQNQTEEANTNTPEIPEHLIDLYQSLDWVGQNIDQLVIHHNI 353

Query: 60  EAPVVYLVLLELDLAGRLCHHPE 82
               +   L+EL+L G       
Sbjct: 354 PVSELTSSLMELELLGLCMQQSG 376


>gi|126640267|ref|YP_001083251.1| putative Rossmann-fold nucleotide-binding DNA uptake protein (Smf)
           [Acinetobacter baumannii ATCC 17978]
          Length = 362

 Score = 39.8 bits (92), Expect = 0.12,   Method: Composition-based stats.
 Identities = 19/83 (22%), Positives = 32/83 (38%), Gaps = 3/83 (3%)

Query: 3   HPQ--IEQNFFSSQSDTNHTKNINITHYPEYTQCERV-RIKQSLNNVPIHIDDIIHHTGI 59
           HP+  IE     +Q  +         +       E +  + QSL+ V  +ID ++ H  I
Sbjct: 273 HPEQIIEDLALPTQWQSQQQNQTEEANTNTPEIPEHLIDLYQSLDWVGQNIDQLVIHHNI 332

Query: 60  EAPVVYLVLLELDLAGRLCHHPE 82
               +   L+EL+L G       
Sbjct: 333 PVSELTSSLMELELLGLCMQQSG 355


>gi|154250247|ref|YP_001411072.1| DNA protecting protein DprA [Fervidobacterium nodosum Rt17-B1]
 gi|154154183|gb|ABS61415.1| DNA protecting protein DprA [Fervidobacterium nodosum Rt17-B1]
          Length = 333

 Score = 39.8 bits (92), Expect = 0.12,   Method: Composition-based stats.
 Identities = 6/54 (11%), Positives = 21/54 (38%), Gaps = 1/54 (1%)

Query: 35  ERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
           +   + ++L    ++ + +          + L+L  ++L G +    +G  +  
Sbjct: 280 DEKLLLEALETN-LNPEQLSEKISKPLSEILLLLTIMELKGLVYRVEDGTYARA 332


>gi|184158217|ref|YP_001846556.1| transcriptional regulator [Acinetobacter baumannii ACICU]
 gi|239504245|ref|ZP_04663555.1| transcriptional regulator [Acinetobacter baumannii AB900]
 gi|332875774|ref|ZP_08443573.1| IclR helix-turn-helix protein [Acinetobacter baumannii 6014059]
 gi|183209811|gb|ACC57209.1| Transcriptional regulator [Acinetobacter baumannii ACICU]
 gi|322508538|gb|ADX03992.1| Transcriptional regulatory protein [Acinetobacter baumannii
          1656-2]
 gi|323518155|gb|ADX92536.1| transcriptional regulator [Acinetobacter baumannii TCDC-AB0715]
 gi|332736038|gb|EGJ67066.1| IclR helix-turn-helix protein [Acinetobacter baumannii 6014059]
          Length = 232

 Score = 39.8 bits (92), Expect = 0.13,   Method: Composition-based stats.
 Identities = 8/70 (11%), Positives = 24/70 (34%), Gaps = 5/70 (7%)

Query: 26 THYPEYTQCERVRIKQSL-----NNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHH 80
           H          R+   L      +  + + ++   T +    +  +++ L+  G +   
Sbjct: 6  PHPATSGNASADRLLTLLTAFRIGDKSLTLAELAERTELNKATIMRLIVSLEDFGFVNRL 65

Query: 81 PEGKVSLTMH 90
           +G+ +L   
Sbjct: 66 SDGRYTLASE 75


>gi|323143587|ref|ZP_08078264.1| transcriptional regulator, DeoR family [Succinatimonas hippei YIT
          12066]
 gi|322416650|gb|EFY07307.1| transcriptional regulator, DeoR family [Succinatimonas hippei YIT
          12066]
          Length = 251

 Score = 39.8 bits (92), Expect = 0.13,   Method: Composition-based stats.
 Identities = 11/46 (23%), Positives = 23/46 (50%), Gaps = 1/46 (2%)

Query: 48 IHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHLPS 93
          + +D+++  TG     +   L++LD  G +     G V+L   +P+
Sbjct: 19 VTVDELVSITGASPATIRRELIKLDKEGAVYRVHGG-VTLNRFVPN 63


>gi|299770041|ref|YP_003732067.1| transcriptional regulator [Acinetobacter sp. DR1]
 gi|298700129|gb|ADI90694.1| transcriptional regulator [Acinetobacter sp. DR1]
          Length = 232

 Score = 39.8 bits (92), Expect = 0.13,   Method: Composition-based stats.
 Identities = 8/70 (11%), Positives = 24/70 (34%), Gaps = 5/70 (7%)

Query: 26 THYPEYTQCERVRIKQSL-----NNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHH 80
           H          R+   L      +  + + ++   T +    +  +++ L+  G +   
Sbjct: 6  PHPATSGNASADRLLTLLTAFRIGDKSLTLAELAERTELNKATIMRLIVSLEDFGFVNRL 65

Query: 81 PEGKVSLTMH 90
           +G+ +L   
Sbjct: 66 SDGRYTLASE 75


>gi|253991649|ref|YP_003043005.1| DNA protecting protein DprA [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253783099|emb|CAQ86264.1| conserved hypothetical protein [Photorhabdus asymbiotica]
          Length = 361

 Score = 39.8 bits (92), Expect = 0.13,   Method: Composition-based stats.
 Identities = 15/72 (20%), Positives = 30/72 (41%), Gaps = 2/72 (2%)

Query: 19  HTKNINITHYPEYTQCER--VRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGR 76
           H +       P++ Q E     +  ++++    +D I   + +    V   LLEL+L G+
Sbjct: 290 HMEGTKQEVKPQFEQTELPFADVLVNVSDEITSVDIIAQRSLLPINEVMAKLLELELLGK 349

Query: 77  LCHHPEGKVSLT 88
           +     G V + 
Sbjct: 350 VAVVAGGYVRVN 361


>gi|257463631|ref|ZP_05628022.1| Smf protein [Fusobacterium sp. D12]
 gi|317061183|ref|ZP_07925668.1| SMF family protein [Fusobacterium sp. D12]
 gi|313686859|gb|EFS23694.1| SMF family protein [Fusobacterium sp. D12]
          Length = 283

 Score = 39.8 bits (92), Expect = 0.13,   Method: Composition-based stats.
 Identities = 10/57 (17%), Positives = 19/57 (33%), Gaps = 1/57 (1%)

Query: 30  EYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
                   +I  SL      +D++          +   L+EL++ G +     GK  
Sbjct: 225 PEVSSLSRKILASLLRE-KSLDELEKELLCSKQELLSQLMELEIEGWIKSISGGKFK 280


>gi|242399074|ref|YP_002994498.1| hypothetical protein TSIB_1095 [Thermococcus sibiricus MM 739]
 gi|242265467|gb|ACS90149.1| hypothetical protein TSIB_1095 [Thermococcus sibiricus MM 739]
          Length = 281

 Score = 39.8 bits (92), Expect = 0.13,   Method: Composition-based stats.
 Identities = 8/51 (15%), Positives = 23/51 (45%)

Query: 34  CERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGK 84
            +  ++ + L   P++  +++   G     V L+L  ++  G +    +G+
Sbjct: 222 SDEEKVIEILRERPMYQSELVKRLGFSKAKVSLLLKNMEKRGLIERVKDGR 272


>gi|325284173|ref|YP_004256714.1| DNA protecting protein DprA [Deinococcus proteolyticus MRP]
 gi|324315982|gb|ADY27097.1| DNA protecting protein DprA [Deinococcus proteolyticus MRP]
          Length = 374

 Score = 39.8 bits (92), Expect = 0.13,   Method: Composition-based stats.
 Identities = 11/83 (13%), Positives = 23/83 (27%), Gaps = 1/83 (1%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVV 64
           +   +  +                      E+     +L   P  +DD+   TG+    +
Sbjct: 293 ETAADILTELGWEARAAGAGAGEDVPDLPPEQAATYSAL-TEPRTLDDLAALTGLGLAEL 351

Query: 65  YLVLLELDLAGRLCHHPEGKVSL 87
              L+ L L+G         +  
Sbjct: 352 QTALMMLQLSGLAEDSGGRWLRR 374


>gi|163784068|ref|ZP_02179021.1| hypothetical protein HG1285_12267 [Hydrogenivirga sp. 128-5-R1-1]
 gi|159880667|gb|EDP74218.1| hypothetical protein HG1285_12267 [Hydrogenivirga sp. 128-5-R1-1]
          Length = 69

 Score = 39.8 bits (92), Expect = 0.13,   Method: Composition-based stats.
 Identities = 10/49 (20%), Positives = 19/49 (38%), Gaps = 1/49 (2%)

Query: 30 EYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLC 78
                  +I  S+ N   H D+++    I A  +  +L  L+L   + 
Sbjct: 11 PDLDEIEKQILDSIENN-THFDNLLEKLSIPADQLITILFNLELKNLIK 58


>gi|218767196|ref|YP_002341708.1| DprA homolog [Neisseria meningitidis Z2491]
 gi|121051204|emb|CAM07475.1| DprA homolog [Neisseria meningitidis Z2491]
          Length = 395

 Score = 39.8 bits (92), Expect = 0.13,   Method: Composition-based stats.
 Identities = 16/74 (21%), Positives = 25/74 (33%)

Query: 14  QSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDL 73
           Q+         +             I   +   PIH D +     + A  +Y  LLEL+L
Sbjct: 319 QTAYAPPPAAKMPSEAAAGGTAVGGILDKMGFDPIHPDVLAGQLAMPAADLYAALLELEL 378

Query: 74  AGRLCHHPEGKVSL 87
            G +   P G+   
Sbjct: 379 DGSVAAMPSGRYQR 392


>gi|224535809|ref|ZP_03676348.1| hypothetical protein BACCELL_00673 [Bacteroides cellulosilyticus
          DSM 14838]
 gi|224522532|gb|EEF91637.1| hypothetical protein BACCELL_00673 [Bacteroides cellulosilyticus
          DSM 14838]
          Length = 81

 Score = 39.8 bits (92), Expect = 0.13,   Method: Composition-based stats.
 Identities = 15/48 (31%), Positives = 23/48 (47%), Gaps = 2/48 (4%)

Query: 35 ERVRIKQSLN--NVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHH 80
          +  RI   +      + +DDII H+G +   VY  L EL+ +G L   
Sbjct: 11 DTQRIIDYIGTFANGVSVDDIILHSGADKLRVYPALFELEQSGWLEVL 58


>gi|70732836|ref|YP_262603.1| hypothetical protein PFL_5535 [Pseudomonas fluorescens Pf-5]
 gi|68347135|gb|AAY94741.1| lhr [Pseudomonas fluorescens Pf-5]
          Length = 1474

 Score = 39.8 bits (92), Expect = 0.13,   Method: Composition-based stats.
 Identities = 13/85 (15%), Positives = 26/85 (30%), Gaps = 6/85 (7%)

Query: 2    VHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEA 61
            +     Q             +      P   +  R R+       P+ +  I    G+ A
Sbjct: 1003 LRALYPQAALQPALQPVPGFDQAWEAQPALVELIRARL---SGFAPLTLAQIAAPLGLPA 1059

Query: 62   PVVYLVLLELDLAGRLCHH---PEG 83
              ++  L++L+  G +      P G
Sbjct: 1060 SSIHQALIQLESEGYVLRGRFSPGG 1084


>gi|271500974|ref|YP_003333999.1| DeoR family transcriptional regulator [Dickeya dadantii Ech586]
 gi|270344529|gb|ACZ77294.1| transcriptional regulator, DeoR family [Dickeya dadantii Ech586]
          Length = 258

 Score = 39.8 bits (92), Expect = 0.13,   Method: Composition-based stats.
 Identities = 13/47 (27%), Positives = 20/47 (42%)

Query: 48 IHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHLPSP 94
          +  D II H G+    V   +L+L+  G L     G V+  +    P
Sbjct: 20 VSTDYIIQHLGVSRETVRRDVLKLEAQGVLRRVHGGIVATNVEPEPP 66


>gi|207723934|ref|YP_002254332.1| transcriptional regulatory dna-binding protein [Ralstonia
          solanacearum MolK2]
 gi|206589141|emb|CAQ36103.1| transcriptional regulatory dna-binding protein [Ralstonia
          solanacearum MolK2]
          Length = 118

 Score = 39.8 bits (92), Expect = 0.13,   Method: Composition-based stats.
 Identities = 11/55 (20%), Positives = 20/55 (36%)

Query: 32 TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
              R  +   L   P  + ++    G+  P V   L  L+ +G +     G+V 
Sbjct: 16 ADANRRSMLAQLARGPASVSELARPLGMSLPAVMQHLAVLEHSGLVRSEKAGRVR 70


>gi|296102350|ref|YP_003612496.1| hypothetical protein ECL_01995 [Enterobacter cloacae subsp.
          cloacae ATCC 13047]
 gi|295056809|gb|ADF61547.1| hypothetical protein ECL_01995 [Enterobacter cloacae subsp.
          cloacae ATCC 13047]
          Length = 253

 Score = 39.8 bits (92), Expect = 0.14,   Method: Composition-based stats.
 Identities = 13/58 (22%), Positives = 25/58 (43%), Gaps = 2/58 (3%)

Query: 37 VRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHLPS 93
           +I   L  +  + +D ++  T      +   L++LD  G +     G V+L   +PS
Sbjct: 8  EQIMDYLKGHNLVTVDQLVAITDASPATIRRDLIKLDQEGVISRTHGG-VTLNRFIPS 64


>gi|154504527|ref|ZP_02041265.1| hypothetical protein RUMGNA_02031 [Ruminococcus gnavus ATCC 29149]
 gi|153795009|gb|EDN77429.1| hypothetical protein RUMGNA_02031 [Ruminococcus gnavus ATCC 29149]
          Length = 360

 Score = 39.8 bits (92), Expect = 0.14,   Method: Composition-based stats.
 Identities = 7/54 (12%), Positives = 18/54 (33%)

Query: 32  TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
            +     +   +   P  +  +   T +    V  +L+ L+L G +    +   
Sbjct: 303 LESPEYMVYSCVGLYPKSVGQLTEETKLRPEEVLKLLVSLELQGYIREISKNYY 356


>gi|229820997|ref|YP_002882523.1| DNA protecting protein DprA [Beutenbergia cavernae DSM 12333]
 gi|229566910|gb|ACQ80761.1| DNA protecting protein DprA [Beutenbergia cavernae DSM 12333]
          Length = 386

 Score = 39.8 bits (92), Expect = 0.14,   Method: Composition-based stats.
 Identities = 13/73 (17%), Positives = 19/73 (26%), Gaps = 1/73 (1%)

Query: 12  SSQSDTNHTKNINITHYPEYTQCERVRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLLE 70
            S        +      P         +  +L        D +    G+  P V   L  
Sbjct: 310 ESTPPEVAVGSGRPGGSPADLAPREALVWDALPRRAAAQPDSVARVAGLGVPEVRAALGR 369

Query: 71  LDLAGRLCHHPEG 83
           L+LAG       G
Sbjct: 370 LELAGHALRDAGG 382


>gi|296328244|ref|ZP_06870774.1| DNA protecting protein DprA [Fusobacterium nucleatum subsp.
           nucleatum ATCC 23726]
 gi|296154644|gb|EFG95431.1| DNA protecting protein DprA [Fusobacterium nucleatum subsp.
           nucleatum ATCC 23726]
          Length = 288

 Score = 39.8 bits (92), Expect = 0.14,   Method: Composition-based stats.
 Identities = 12/48 (25%), Positives = 24/48 (50%), Gaps = 1/48 (2%)

Query: 39  IKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
           I  SL++   ++D+I+  T IE   +   L+ L++ G +     G+  
Sbjct: 239 ILNSLSSE-KNLDNILIETKIEQTEILAELMTLEIMGVIKSIAGGRYK 285


>gi|290956075|ref|YP_003487257.1| DeoR family transcriptional regulator [Streptomyces scabiei
          87.22]
 gi|260645601|emb|CBG68692.1| putative DeoR-family transcriptional regulator [Streptomyces
          scabiei 87.22]
          Length = 256

 Score = 39.8 bits (92), Expect = 0.14,   Method: Composition-based stats.
 Identities = 11/51 (21%), Positives = 20/51 (39%), Gaps = 1/51 (1%)

Query: 36 RVRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
             I ++L +  P  + D+    G+    +   L+ L+  G L     G V
Sbjct: 14 HQLILRALRSGGPAAVTDLSEQLGVSPATIRRDLVRLEEEGLLTRVHGGAV 64


>gi|19704403|ref|NP_603965.1| Smf protein [Fusobacterium nucleatum subsp. nucleatum ATCC 25586]
 gi|19714659|gb|AAL95264.1| Smf protein [Fusobacterium nucleatum subsp. nucleatum ATCC 25586]
          Length = 288

 Score = 39.8 bits (92), Expect = 0.14,   Method: Composition-based stats.
 Identities = 12/48 (25%), Positives = 24/48 (50%), Gaps = 1/48 (2%)

Query: 39  IKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
           I  SL++   ++D+I+  T IE   +   L+ L++ G +     G+  
Sbjct: 239 ILNSLSSE-KNLDNILIETKIEQTEILAELMTLEIMGVIKSIAGGRYK 285


>gi|320532705|ref|ZP_08033496.1| divergent AAA domain protein [Actinomyces sp. oral taxon 171 str.
           F0337]
 gi|320135077|gb|EFW27234.1| divergent AAA domain protein [Actinomyces sp. oral taxon 171 str.
           F0337]
          Length = 566

 Score = 39.8 bits (92), Expect = 0.14,   Method: Composition-based stats.
 Identities = 16/71 (22%), Positives = 25/71 (35%), Gaps = 2/71 (2%)

Query: 10  FFSSQSDTNHTKNINITHYPE--YTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLV 67
             +S S    +   +I   PE          +  SL + P     I+  TG+    V   
Sbjct: 481 VLASDSTRPTSDTTDIAVPPEISALSTNTPAVWASLEDGPRTRQQIVEATGLSPRQVTYA 540

Query: 68  LLELDLAGRLC 78
           L  L+ AG + 
Sbjct: 541 LKHLEEAGFVE 551


>gi|313884573|ref|ZP_07818334.1| transcriptional regulator, DeoR family [Eremococcus coleocola
          ACS-139-V-Col8]
 gi|312620357|gb|EFR31785.1| transcriptional regulator, DeoR family [Eremococcus coleocola
          ACS-139-V-Col8]
          Length = 264

 Score = 39.8 bits (92), Expect = 0.14,   Method: Composition-based stats.
 Identities = 14/63 (22%), Positives = 22/63 (34%), Gaps = 5/63 (7%)

Query: 33 QCERVRIKQSLNNVP-IHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHL 91
                I Q L     +++  +    G+    +   L EL+  G L     G VS     
Sbjct: 9  DQRHQLILQELTKEGKVYVSQMAQEFGLTPETLRRDLSELEAGGLLERVHGGAVS----K 64

Query: 92 PSP 94
          P+P
Sbjct: 65 PAP 67


>gi|329945985|ref|ZP_08293672.1| transcriptional regulator, DeoR family [Actinomyces sp. oral
          taxon 170 str. F0386]
 gi|328528433|gb|EGF55411.1| transcriptional regulator, DeoR family [Actinomyces sp. oral
          taxon 170 str. F0386]
          Length = 255

 Score = 39.8 bits (92), Expect = 0.14,   Method: Composition-based stats.
 Identities = 12/59 (20%), Positives = 22/59 (37%), Gaps = 1/59 (1%)

Query: 29 PEYTQCERVRIKQSLNNVPIH-IDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
          P      R  I ++L+   +H +  +   TG+    +   L EL   G +     G + 
Sbjct: 2  PNSPHERRRTILRALSPTTVHSVQALSRLTGVSVITIRRDLTELAHEGLVTRVHGGALR 60


>gi|325124150|gb|ADY83673.1| putative Rossmann-fold nucleotide-binding protein involved in DNA
           uptake (smf) [Acinetobacter calcoaceticus PHEA-2]
          Length = 377

 Score = 39.8 bits (92), Expect = 0.14,   Method: Composition-based stats.
 Identities = 18/82 (21%), Positives = 33/82 (40%), Gaps = 2/82 (2%)

Query: 1   MVHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIE 60
           ++        + SQ   N T+   ++  PE  +     + QSL+ V  +ID ++ H    
Sbjct: 291 IIEDLALPTQWQSQQ-QNSTEQAVVSSTPEIPEHLIN-LYQSLDWVGQNIDQLVLHHSQP 348

Query: 61  APVVYLVLLELDLAGRLCHHPE 82
              +   L+EL+L G       
Sbjct: 349 VAELTSSLMELELLGLCMQQSG 370


>gi|302348962|ref|YP_003816600.1| Putative transcriptional regulator, ArsR family [Acidilobus
          saccharovorans 345-15]
 gi|302329374|gb|ADL19569.1| Putative transcriptional regulator, ArsR family [Acidilobus
          saccharovorans 345-15]
          Length = 120

 Score = 39.8 bits (92), Expect = 0.14,   Method: Composition-based stats.
 Identities = 12/55 (21%), Positives = 20/55 (36%), Gaps = 2/55 (3%)

Query: 32 TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHH--PEGK 84
              R +I   L   P  ++DI          V   + +L+ AG +  H  P  +
Sbjct: 34 ASESRAKILAILQKGPTDLEDIATLINQSKANVSSQIRKLEEAGIVRSHYVPGQR 88


>gi|296171497|ref|ZP_06852761.1| smf family protein [Mycobacterium parascrofulaceum ATCC BAA-614]
 gi|295894059|gb|EFG73820.1| smf family protein [Mycobacterium parascrofulaceum ATCC BAA-614]
          Length = 127

 Score = 39.8 bits (92), Expect = 0.14,   Method: Composition-based stats.
 Identities = 9/74 (12%), Positives = 22/74 (29%), Gaps = 1/74 (1%)

Query: 10  FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVL 68
               +      +        +       R+ ++L       ++ +   +G+    V   L
Sbjct: 35  ELIGRIGELAVEEPRPATALDGLGDAERRVYEALPGRGAATVEQLAVASGLAPERVLGPL 94

Query: 69  LELDLAGRLCHHPE 82
             L+LAG +     
Sbjct: 95  AILELAGLVQRQEG 108


>gi|293608022|ref|ZP_06690325.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292828595|gb|EFF86957.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|325122341|gb|ADY81864.1| IclR family transcriptional regulator, pca regulon regulatory
          protein [Acinetobacter calcoaceticus PHEA-2]
          Length = 232

 Score = 39.8 bits (92), Expect = 0.14,   Method: Composition-based stats.
 Identities = 8/70 (11%), Positives = 24/70 (34%), Gaps = 5/70 (7%)

Query: 26 THYPEYTQCERVRIKQSL-----NNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHH 80
           H          R+   L      +  + + ++   T +    +  +++ L+  G +   
Sbjct: 6  PHPATSGNASADRLLTLLTAFRIGDKSLTLAELAERTELNKATIMRLIVSLEDFGFVNRL 65

Query: 81 PEGKVSLTMH 90
           +G+ +L   
Sbjct: 66 SDGRYTLASE 75


>gi|305681197|ref|ZP_07404004.1| DNA protecting protein DprA [Corynebacterium matruchotii ATCC
           14266]
 gi|305659402|gb|EFM48902.1| DNA protecting protein DprA [Corynebacterium matruchotii ATCC
           14266]
          Length = 405

 Score = 39.8 bits (92), Expect = 0.14,   Method: Composition-based stats.
 Identities = 11/55 (20%), Positives = 19/55 (34%)

Query: 25  ITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCH 79
                +      +RI  +    PI  D + H  G+   +   +LL L   G +  
Sbjct: 330 AATPVQKLSRNEMRIYDATGPRPIPTDQLAHDAGLTIGLTVHLLLSLAQQGLVER 384


>gi|296386494|ref|ZP_06875993.1| putative Rossmann fold nucleotide-binding protein [Pseudomonas
           aeruginosa PAb1]
          Length = 101

 Score = 39.4 bits (91), Expect = 0.14,   Method: Composition-based stats.
 Identities = 11/43 (25%), Positives = 18/43 (41%)

Query: 46  VPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
            P   + +   +G+  P V   L EL+L GR+       V  +
Sbjct: 58  APYTSEGLAAASGMTLPDVLATLSELELDGRVACEAGTWVHRS 100


>gi|218129683|ref|ZP_03458487.1| hypothetical protein BACEGG_01262 [Bacteroides eggerthii DSM
          20697]
 gi|217988095|gb|EEC54419.1| hypothetical protein BACEGG_01262 [Bacteroides eggerthii DSM
          20697]
          Length = 74

 Score = 39.4 bits (91), Expect = 0.14,   Method: Composition-based stats.
 Identities = 13/46 (28%), Positives = 23/46 (50%), Gaps = 2/46 (4%)

Query: 35 ERVRIKQSLN--NVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLC 78
          +  +I   +      + +DDII ++G +   VY  L EL+ AG + 
Sbjct: 7  DMQKIIDYIASFYGAVSVDDIIQNSGADKFRVYPALFELEQAGYIE 52


>gi|14591672|ref|NP_143759.1| hypothetical protein PH1930 [Pyrococcus horikoshii OT3]
 gi|3258374|dbj|BAA31057.1| 185aa long hypothetical protein [Pyrococcus horikoshii OT3]
          Length = 185

 Score = 39.4 bits (91), Expect = 0.14,   Method: Composition-based stats.
 Identities = 11/46 (23%), Positives = 21/46 (45%)

Query: 33 QCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLC 78
             R++I + L   P+ + +I    G +   VY  +  L+ AG + 
Sbjct: 20 DPTRIKILELLREHPMSVSEIAERLGRDKSTVYRHIKALEDAGLVE 65


>gi|300813844|ref|ZP_07094149.1| DNA protecting protein DprA [Peptoniphilus sp. oral taxon 836 str.
           F0141]
 gi|300512031|gb|EFK39226.1| DNA protecting protein DprA [Peptoniphilus sp. oral taxon 836 str.
           F0141]
          Length = 360

 Score = 39.4 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 13/68 (19%), Positives = 28/68 (41%), Gaps = 5/68 (7%)

Query: 21  KNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHH 80
           K     H  +    +   I   + +  I I++I + +  +   +  +L +L+L   +   
Sbjct: 293 KKEEEKHIIKNLSEDENLILNLMEDGSITIEEICNKSNFDVIYINSLLTKLELKSAIE-- 350

Query: 81  PEGKVSLT 88
              K+SLT
Sbjct: 351 ---KISLT 355


>gi|289450127|ref|YP_003475174.1| DNA protecting protein DprA [Clostridiales genomosp. BVAB3 str.
           UPII9-5]
 gi|289184674|gb|ADC91099.1| DNA protecting protein DprA [Clostridiales genomosp. BVAB3 str.
           UPII9-5]
          Length = 416

 Score = 39.4 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 12/88 (13%), Positives = 31/88 (35%), Gaps = 4/88 (4%)

Query: 1   MVHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIE 60
           ++ P+   +    Q+ T+   +      PE       +I + L      +D++      +
Sbjct: 323 LIAPENLADEIERQTGTDLPLSAYKEKPPE-LSPLSEKILRELTVAERSVDELCLLLHCK 381

Query: 61  APVVYLVLLELDLAGRL-CHHPEGKVSL 87
              +   L   +L G +      G+ ++
Sbjct: 382 LTELLPELSICELKGLIFSRL--GRYAV 407


>gi|225021105|ref|ZP_03710297.1| hypothetical protein CORMATOL_01117 [Corynebacterium matruchotii
           ATCC 33806]
 gi|224946105|gb|EEG27314.1| hypothetical protein CORMATOL_01117 [Corynebacterium matruchotii
           ATCC 33806]
          Length = 405

 Score = 39.4 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 11/55 (20%), Positives = 19/55 (34%)

Query: 25  ITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCH 79
                +      +RI  +    PI  D + H  G+   +   +LL L   G +  
Sbjct: 330 AATPVQKLSRNEMRIYDATGPRPIPTDQLAHDAGLTIGLTVHLLLSLAQQGLVER 384


>gi|331091605|ref|ZP_08340439.1| hypothetical protein HMPREF9477_01082 [Lachnospiraceae bacterium
          2_1_46FAA]
 gi|330403362|gb|EGG82921.1| hypothetical protein HMPREF9477_01082 [Lachnospiraceae bacterium
          2_1_46FAA]
          Length = 250

 Score = 39.4 bits (91), Expect = 0.16,   Method: Composition-based stats.
 Identities = 10/52 (19%), Positives = 23/52 (44%), Gaps = 1/52 (1%)

Query: 36 RVRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
          R +I + L     + ++++    G+    +   LL+L   G++     G V+
Sbjct: 7  REKITEFLYRYGSVQVEELAQELGVSTMTIRRDLLKLQEDGKIERCHGGAVA 58


>gi|320161008|ref|YP_004174232.1| ArsR family transcriptional regulator [Anaerolinea thermophila
          UNI-1]
 gi|319994861|dbj|BAJ63632.1| ArsR family transcriptional regulator [Anaerolinea thermophila
          UNI-1]
          Length = 194

 Score = 39.4 bits (91), Expect = 0.16,   Method: Composition-based stats.
 Identities = 13/53 (24%), Positives = 20/53 (37%)

Query: 33 QCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
             R+RI   L N  + ++ I     +    V   L +L  AG +   PE   
Sbjct: 25 DANRLRILGVLANQSMSVEQISTSLNLSPSTVSHHLAKLSEAGLVTAKPESYY 77


>gi|307297637|ref|ZP_07577443.1| DNA protecting protein DprA [Thermotogales bacterium mesG1.Ag.4.2]
 gi|306916897|gb|EFN47279.1| DNA protecting protein DprA [Thermotogales bacterium mesG1.Ag.4.2]
          Length = 339

 Score = 39.4 bits (91), Expect = 0.16,   Method: Composition-based stats.
 Identities = 10/57 (17%), Positives = 23/57 (40%)

Query: 21  KNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRL 77
           +   I+     +   + R+   L N P+   +++  T   +  + + L  L L G +
Sbjct: 273 EFPEISFEEPQSGNLQSRVLDLLGNGPLTFGELLLMTDFSSKDLIVELTNLQLGGYI 329


>gi|206563159|ref|YP_002233922.1| putative helicase [Burkholderia cenocepacia J2315]
 gi|198039199|emb|CAR55163.1| putative helicase [Burkholderia cenocepacia J2315]
          Length = 1503

 Score = 39.4 bits (91), Expect = 0.16,   Method: Composition-based stats.
 Identities = 11/78 (14%), Positives = 20/78 (25%), Gaps = 6/78 (7%)

Query: 2    VHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEA 61
            +HP       +                       R R+       P+ +D I    G+  
Sbjct: 1019 LHPDARM---TPALKVPAACAQPWEADAALVDVIRARLT---GFGPLTLDAIAAPLGLPP 1072

Query: 62   PVVYLVLLELDLAGRLCH 79
              +   L  L+  G +  
Sbjct: 1073 ASIATALAALEREGYVMR 1090


>gi|37528511|ref|NP_931856.1| hypothetical protein plu4694 [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|36787949|emb|CAE17066.1| Smf protein [Photorhabdus luminescens subsp. laumondii TTO1]
          Length = 361

 Score = 39.4 bits (91), Expect = 0.16,   Method: Composition-based stats.
 Identities = 14/70 (20%), Positives = 27/70 (38%), Gaps = 2/70 (2%)

Query: 21  KNINITHYPEYTQCER--VRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLC 78
           +       P++ Q E     +  ++      +D I   + +    V   LLEL+L G++ 
Sbjct: 292 ERTEEEVKPQFEQTELPFTDVLVNVGAEVTPVDIIAQRSSLPITEVMTKLLELELLGKVT 351

Query: 79  HHPEGKVSLT 88
               G V + 
Sbjct: 352 VVAGGYVRVN 361


>gi|33864461|ref|NP_896021.1| ArsR family regulatory protein [Prochlorococcus marinus str. MIT
          9313]
 gi|124024609|ref|YP_001018916.1| regulatory proteins, ArsR family protein [Prochlorococcus marinus
          str. MIT 9303]
 gi|33641241|emb|CAE22371.1| Bacterial regulatory proteins, ArsR family [Prochlorococcus
          marinus str. MIT 9313]
 gi|123964895|gb|ABM79651.1| Bacterial regulatory proteins, ArsR family protein
          [Prochlorococcus marinus str. MIT 9303]
          Length = 101

 Score = 39.4 bits (91), Expect = 0.16,   Method: Composition-based stats.
 Identities = 12/51 (23%), Positives = 27/51 (52%)

Query: 33 QCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEG 83
          +  R+ + ++L + P+++  ++  T +   +V   L  L +AG +   PEG
Sbjct: 13 EPNRLAVLEALRSGPLNVTAVVEKTDLSQALVSKHLKLLTIAGVVHRRPEG 63


>gi|331082496|ref|ZP_08331621.1| hypothetical protein HMPREF0992_00545 [Lachnospiraceae bacterium
           6_1_63FAA]
 gi|330400474|gb|EGG80104.1| hypothetical protein HMPREF0992_00545 [Lachnospiraceae bacterium
           6_1_63FAA]
          Length = 291

 Score = 39.4 bits (91), Expect = 0.16,   Method: Composition-based stats.
 Identities = 9/44 (20%), Positives = 22/44 (50%)

Query: 34  CERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRL 77
                +   L+  P +I++I     +++  +  +LL+L+L G +
Sbjct: 235 SHEEMVYSCLDLQPKNIEEIFQEVPLKSGEIMEILLKLELEGLI 278


>gi|313773612|gb|EFS39578.1| DNA protecting protein DprA [Propionibacterium acnes HL074PA1]
          Length = 377

 Score = 39.4 bits (91), Expect = 0.16,   Method: Composition-based stats.
 Identities = 7/70 (10%), Positives = 21/70 (30%), Gaps = 1/70 (1%)

Query: 15  SDTNHTKNINITHYPEYTQCERVRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLLELDL 73
                 +    +   +      + + ++L  +    +D++    G+        L  L+ 
Sbjct: 297 LAPEPERPAGRSLPTDILDAIELAVHEALPAHGSCGLDELAVLAGVPVAQCSAALSVLEQ 356

Query: 74  AGRLCHHPEG 83
            G      +G
Sbjct: 357 LGMAACCLDG 366


>gi|260589066|ref|ZP_05854979.1| DNA protecting protein DprA [Blautia hansenii DSM 20583]
 gi|260540486|gb|EEX21055.1| DNA protecting protein DprA [Blautia hansenii DSM 20583]
          Length = 291

 Score = 39.4 bits (91), Expect = 0.16,   Method: Composition-based stats.
 Identities = 9/44 (20%), Positives = 22/44 (50%)

Query: 34  CERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRL 77
                +   L+  P +I++I     +++  +  +LL+L+L G +
Sbjct: 235 SHEEMVYSCLDLQPKNIEEIFQEVPLKSGEIMEILLKLELEGLI 278


>gi|15891915|ref|NP_357587.1| ArsR family transcriptional regulator [Agrobacterium tumefaciens
          str. C58]
 gi|15160416|gb|AAK90372.1| transcriptional regulator, ArsR family [Agrobacterium tumefaciens
          str. C58]
          Length = 118

 Score = 39.4 bits (91), Expect = 0.16,   Method: Composition-based stats.
 Identities = 14/55 (25%), Positives = 22/55 (40%)

Query: 32 TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
              R  I   L   P  + ++   TG+  P V   L  L+ AG +    +G+V 
Sbjct: 21 ADPTRRAILARLGGGPAPVMELSAPTGLRLPTVMRHLSVLEEAGLIITSKDGRVR 75


>gi|116621036|ref|YP_823192.1| ArsR family transcriptional regulator [Candidatus Solibacter
          usitatus Ellin6076]
 gi|116224198|gb|ABJ82907.1| transcriptional regulator, ArsR family [Candidatus Solibacter
          usitatus Ellin6076]
          Length = 111

 Score = 39.4 bits (91), Expect = 0.16,   Method: Composition-based stats.
 Identities = 12/61 (19%), Positives = 22/61 (36%)

Query: 33 QCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHLP 92
             R  I + L + PI +  +     +    V   L  L+ +G +     G+V      P
Sbjct: 17 DPTRRAIMEKLGHGPISVSRLAEPLDMTLAAVVQHLQVLEESGLVQTEKAGRVRTCRIEP 76

Query: 93 S 93
          +
Sbjct: 77 A 77


>gi|90415411|ref|ZP_01223345.1| DNA processing chain A [marine gamma proteobacterium HTCC2207]
 gi|90332734|gb|EAS47904.1| DNA processing chain A [marine gamma proteobacterium HTCC2207]
          Length = 360

 Score = 39.4 bits (91), Expect = 0.17,   Method: Composition-based stats.
 Identities = 9/58 (15%), Positives = 21/58 (36%)

Query: 14  QSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLEL 71
            +        ++TH     + + V++   L   P  +D +I         +  +L+ L
Sbjct: 303 SATEPPQAPFSVTHGALNLEADEVQLLSHLGYEPTDMDSLISDGFFSVSELSRLLVAL 360


>gi|83748334|ref|ZP_00945358.1| Transcriptional regulator, ArsR family [Ralstonia solanacearum
          UW551]
 gi|207742835|ref|YP_002259227.1| transcriptional regulatory dna-binding protein [Ralstonia
          solanacearum IPO1609]
 gi|300703740|ref|YP_003745342.1| transcriptional regulatory, arsr family [Ralstonia solanacearum
          CFBP2957]
 gi|83724956|gb|EAP72110.1| Transcriptional regulator, ArsR family [Ralstonia solanacearum
          UW551]
 gi|206594229|emb|CAQ61156.1| transcriptional regulatory dna-binding protein [Ralstonia
          solanacearum IPO1609]
 gi|299071403|emb|CBJ42722.1| putative transcriptional regulatory, arsR family [Ralstonia
          solanacearum CFBP2957]
          Length = 118

 Score = 39.4 bits (91), Expect = 0.17,   Method: Composition-based stats.
 Identities = 12/62 (19%), Positives = 21/62 (33%)

Query: 32 TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHL 91
              R  +   L   P  + ++    G+  P V   L  L+ +G +     G+V      
Sbjct: 16 ADANRRSMLAQLARGPASVSELARPLGMSLPAVMQHLAVLEHSGLVRSEKAGRVRTCRIE 75

Query: 92 PS 93
          P 
Sbjct: 76 PQ 77


>gi|329848068|ref|ZP_08263096.1| putative aga operon transcriptional repressor [Asticcacaulis
          biprosthecum C19]
 gi|328843131|gb|EGF92700.1| putative aga operon transcriptional repressor [Asticcacaulis
          biprosthecum C19]
          Length = 280

 Score = 39.4 bits (91), Expect = 0.17,   Method: Composition-based stats.
 Identities = 12/51 (23%), Positives = 19/51 (37%), Gaps = 1/51 (1%)

Query: 37 VRIKQSLNNV-PIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
           RI   L+      +D++    G+    +   L ELD  G L     G + 
Sbjct: 8  KRIIDELSPDRVTSVDELTERLGVSPATIRRDLNELDGLGYLLRVRGGAMR 58


>gi|330946480|gb|EGH47521.1| putative IclR family regulatory protein [Pseudomonas syringae pv.
          pisi str. 1704B]
          Length = 123

 Score = 39.4 bits (91), Expect = 0.17,   Method: Composition-based stats.
 Identities = 6/48 (12%), Positives = 22/48 (45%)

Query: 43 LNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMH 90
          + +  + + +++  TG+    +  +++ L+  G +    +G+  L   
Sbjct: 10 IGDSALSLVELVERTGLIKSTIMRLMVSLETYGFVNRLADGRYMLASE 57


>gi|327189425|gb|EGE56589.1| ArsR family transcriptional regulator [Rhizobium etli CNPAF512]
          Length = 137

 Score = 39.4 bits (91), Expect = 0.17,   Method: Composition-based stats.
 Identities = 10/47 (21%), Positives = 17/47 (36%)

Query: 33 QCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCH 79
             R +I   L+   +   +I     +  P V   L  L+ AG +  
Sbjct: 43 SAPRRKILAYLSASGLTAGEIAERFSMSKPAVSQHLSILETAGLIRR 89


>gi|169797635|ref|YP_001715428.1| putative Rossmann-fold nucleotide-binding protein involved in DNA
           uptake (Smf) [Acinetobacter baumannii AYE]
 gi|213155571|ref|YP_002317616.1| DNA protecting protein DprA [Acinetobacter baumannii AB0057]
 gi|215484989|ref|YP_002327230.1| DNA protecting protein DprA [Acinetobacter baumannii AB307-0294]
 gi|301346866|ref|ZP_07227607.1| DNA protecting protein DprA [Acinetobacter baumannii AB056]
 gi|301512294|ref|ZP_07237531.1| DNA protecting protein DprA [Acinetobacter baumannii AB058]
 gi|301594508|ref|ZP_07239516.1| DNA protecting protein DprA [Acinetobacter baumannii AB059]
 gi|169150562|emb|CAM88471.1| putative Rossmann-fold nucleotide-binding protein involved in DNA
           uptake (Smf) [Acinetobacter baumannii AYE]
 gi|213054731|gb|ACJ39633.1| DNA protecting protein DprA [Acinetobacter baumannii AB0057]
 gi|213988661|gb|ACJ58960.1| DNA protecting protein DprA [Acinetobacter baumannii AB307-0294]
          Length = 376

 Score = 39.4 bits (91), Expect = 0.17,   Method: Composition-based stats.
 Identities = 12/44 (27%), Positives = 21/44 (47%)

Query: 39  IKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPE 82
           + QSL+ V  +ID ++ H  +    +   L+EL+L G       
Sbjct: 326 LYQSLDWVGQNIDQLVIHHNVPVSELTSSLMELELLGLCMQQSG 369


>gi|301025182|ref|ZP_07188755.1| DeoR-like helix-turn-helix protein [Escherichia coli MS 69-1]
 gi|331656702|ref|ZP_08357664.1| GlpR protein [Escherichia coli TA206]
 gi|300396182|gb|EFJ79720.1| DeoR-like helix-turn-helix protein [Escherichia coli MS 69-1]
 gi|331054950|gb|EGI26959.1| GlpR protein [Escherichia coli TA206]
          Length = 253

 Score = 39.4 bits (91), Expect = 0.17,   Method: Composition-based stats.
 Identities = 12/58 (20%), Positives = 27/58 (46%), Gaps = 2/58 (3%)

Query: 37 VRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHLPS 93
           +I   L ++  + +D+++  T      +   L++LD  G +     G V+L   +P+
Sbjct: 8  EQIMDYLKSHNLVTVDELVAVTNASPATIRRDLIKLDEQGVISRTHGG-VTLNRFIPT 64


>gi|294785361|ref|ZP_06750649.1| DNA protecting protein DprA [Fusobacterium sp. 3_1_27]
 gi|294487075|gb|EFG34437.1| DNA protecting protein DprA [Fusobacterium sp. 3_1_27]
          Length = 288

 Score = 39.4 bits (91), Expect = 0.17,   Method: Composition-based stats.
 Identities = 12/48 (25%), Positives = 24/48 (50%), Gaps = 1/48 (2%)

Query: 39  IKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
           I  SL++   ++D+I+  T IE   +   L+ L++ G +     G+  
Sbjct: 239 ILNSLSSE-KNLDNILIETKIEQTEILAELMTLEIMGAIKSIAGGRYK 285


>gi|328957780|ref|YP_004375166.1| uncharacterized HTH-type transcriptional regulator FruR
          [Carnobacterium sp. 17-4]
 gi|328674104|gb|AEB30150.1| uncharacterized HTH-type transcriptional regulator FruR
          [Carnobacterium sp. 17-4]
          Length = 245

 Score = 39.4 bits (91), Expect = 0.18,   Method: Composition-based stats.
 Identities = 16/62 (25%), Positives = 27/62 (43%), Gaps = 5/62 (8%)

Query: 36 RVRIKQSLNNVPIHI-DDII-HHTGIEAPVVYLVLLELDLAGRLCHHPEG---KVSLTMH 90
          +  I Q LN   I I D++    +G+    +   L +L+ AG +   P G     S +  
Sbjct: 7  KKAILQKLNEQDIVILDELQNVLSGVSVSTIRRDLKDLERAGHVTVLPGGAAKLFSRSTD 66

Query: 91 LP 92
          +P
Sbjct: 67 VP 68


>gi|320335675|ref|YP_004172386.1| DNA protecting protein DprA [Deinococcus maricopensis DSM 21211]
 gi|319756964|gb|ADV68721.1| DNA protecting protein DprA [Deinococcus maricopensis DSM 21211]
          Length = 358

 Score = 39.4 bits (91), Expect = 0.18,   Method: Composition-based stats.
 Identities = 14/63 (22%), Positives = 27/63 (42%), Gaps = 4/63 (6%)

Query: 25  ITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGK 84
            +  P     ++ R+  +L   P  +DD++  +G      +  LL L LAG +     G+
Sbjct: 299 PSRAPLDLPDDQARVLAAL-TGPRTLDDVLSVSG--VADAHTALLMLQLAGLVE-ESGGR 354

Query: 85  VSL 87
            + 
Sbjct: 355 YAR 357


>gi|307287969|ref|ZP_07568002.1| DeoR-like helix-turn-helix protein [Enterococcus faecalis TX0109]
 gi|306501114|gb|EFM70421.1| DeoR-like helix-turn-helix protein [Enterococcus faecalis TX0109]
 gi|315163791|gb|EFU07808.1| DeoR-like helix-turn-helix protein [Enterococcus faecalis TX1302]
          Length = 252

 Score = 39.4 bits (91), Expect = 0.18,   Method: Composition-based stats.
 Identities = 12/41 (29%), Positives = 17/41 (41%)

Query: 52 DIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHLP 92
          +I+    +    V   L EL+  GRL     G  SL  + P
Sbjct: 26 EIMERLNVSDMTVRRDLTELEATGRLKRVHGGASSLNTYRP 66


>gi|258511359|ref|YP_003184793.1| DNA protecting protein DprA [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
 gi|257478085|gb|ACV58404.1| DNA protecting protein DprA [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
          Length = 366

 Score = 39.4 bits (91), Expect = 0.18,   Method: Composition-based stats.
 Identities = 17/85 (20%), Positives = 34/85 (40%), Gaps = 7/85 (8%)

Query: 4   PQIEQ-NFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAP 62
           P ++  + F   +D     +  I  + E       R      + PI   ++     ++  
Sbjct: 279 PLVDPNDLFPEPADVEIAGSWKIPAHLEPCYRALAR------HQPIRAGELAAVADLDLG 332

Query: 63  VVYLVLLELDLAGRLCHHPEGKVSL 87
            V+  LLE++LA  +  HP+G   +
Sbjct: 333 YVFGALLEMELACMVTRHPDGTYHI 357


>gi|218514727|ref|ZP_03511567.1| filamentation induced by cAMP protein Fic [Rhizobium etli 8C-3]
          Length = 86

 Score = 39.4 bits (91), Expect = 0.18,   Method: Composition-based stats.
 Identities = 14/74 (18%), Positives = 26/74 (35%), Gaps = 1/74 (1%)

Query: 21 KNINITHYPEYTQCERVRIKQSLNNVP-IHIDDIIHHTGIEAPVVYLVLLELDLAGRLCH 79
          ++              +RI       P +  + ++  TG+ AP V   L +L+  G +  
Sbjct: 8  EDRERITSESDRAGSALRIHDLFQQNPFMTANQLVQQTGLSAPTVNAALTDLERFGVVEE 67

Query: 80 HPEGKVSLTMHLPS 93
              K      LP+
Sbjct: 68 VTGRKRGRVFELPA 81


>gi|303249954|ref|ZP_07336156.1| protein smf (DNA-processing chain A) [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|303253126|ref|ZP_07339275.1| protein smf (DNA-processing chain A) [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|307248764|ref|ZP_07530777.1| hypothetical protein appser2_17300 [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|307253383|ref|ZP_07535254.1| hypothetical protein appser6_18770 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|307262202|ref|ZP_07543852.1| hypothetical protein appser12_17470 [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
 gi|302647808|gb|EFL78015.1| protein smf (DNA-processing chain A) [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|302651017|gb|EFL81171.1| protein smf (DNA-processing chain A) [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|306854691|gb|EFM86881.1| hypothetical protein appser2_17300 [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|306859062|gb|EFM91104.1| hypothetical protein appser6_18770 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306868076|gb|EFM99902.1| hypothetical protein appser12_17470 [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
          Length = 384

 Score = 39.4 bits (91), Expect = 0.19,   Method: Composition-based stats.
 Identities = 18/83 (21%), Positives = 31/83 (37%)

Query: 4   PQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPV 63
           PQ  +N           K  ++          + +I   ++  PI IDD+   T +E   
Sbjct: 301 PQAVENAQFFTKADVPNKVNHLAKKLPELTDCQQQIVAHISLEPISIDDLAKATALEVDT 360

Query: 64  VYLVLLELDLAGRLCHHPEGKVS 86
           + + LL L+L   +     G V 
Sbjct: 361 LLVELLGLELLSVIKQVSGGYVR 383


>gi|332852663|ref|ZP_08434317.1| DNA protecting protein DprA [Acinetobacter baumannii 6013150]
 gi|332869379|ref|ZP_08438757.1| DNA protecting protein DprA [Acinetobacter baumannii 6013113]
 gi|332729131|gb|EGJ60478.1| DNA protecting protein DprA [Acinetobacter baumannii 6013150]
 gi|332732797|gb|EGJ64013.1| DNA protecting protein DprA [Acinetobacter baumannii 6013113]
          Length = 383

 Score = 39.4 bits (91), Expect = 0.19,   Method: Composition-based stats.
 Identities = 12/44 (27%), Positives = 21/44 (47%)

Query: 39  IKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPE 82
           + QSL+ V  +ID ++ H  +    +   L+EL+L G       
Sbjct: 333 LYQSLDWVGQNIDQLVIHHNVPVSELTSSLMELELLGLCMQQSG 376


>gi|254303090|ref|ZP_04970448.1| possible SMF family DNA processing protein [Fusobacterium nucleatum
           subsp. polymorphum ATCC 10953]
 gi|148323282|gb|EDK88532.1| possible SMF family DNA processing protein [Fusobacterium nucleatum
           subsp. polymorphum ATCC 10953]
          Length = 284

 Score = 39.4 bits (91), Expect = 0.19,   Method: Composition-based stats.
 Identities = 12/48 (25%), Positives = 24/48 (50%), Gaps = 1/48 (2%)

Query: 39  IKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
           I  SL++   ++D+I+  T IE   +   L+ L++ G +     G+  
Sbjct: 235 ILNSLSSE-KNLDNILMETKIEQTEILAELITLEIMGAIKSIAGGRYK 281


>gi|255526680|ref|ZP_05393584.1| DNA protecting protein DprA [Clostridium carboxidivorans P7]
 gi|296185600|ref|ZP_06854009.1| DNA protecting protein DprA [Clostridium carboxidivorans P7]
 gi|255509612|gb|EET85948.1| DNA protecting protein DprA [Clostridium carboxidivorans P7]
 gi|296049728|gb|EFG89153.1| DNA protecting protein DprA [Clostridium carboxidivorans P7]
          Length = 364

 Score = 39.1 bits (90), Expect = 0.19,   Method: Composition-based stats.
 Identities = 10/53 (18%), Positives = 19/53 (35%)

Query: 36  RVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
              I  ++N  P  I+ +      +   V   L  ++L G++        SL 
Sbjct: 312 EKIILNAINKEPKTIEQLQVIVNDDKVDVLEKLSLMELDGKIKAFQGKFYSLA 364


>gi|254515966|ref|ZP_05128026.1| peptide deformylase, DNA processing protein [gamma proteobacterium
           NOR5-3]
 gi|219675688|gb|EED32054.1| peptide deformylase, DNA processing protein [gamma proteobacterium
           NOR5-3]
          Length = 371

 Score = 39.1 bits (90), Expect = 0.19,   Method: Composition-based stats.
 Identities = 12/47 (25%), Positives = 23/47 (48%)

Query: 38  RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGK 84
           +I Q L +  + + D+   TG++   +  VL +L++ G LC      
Sbjct: 315 QILQLLGDTGLSLGDLRQSTGMQTSELLAVLGDLEIQGWLCTIDGRY 361


>gi|26246655|ref|NP_752695.1| putative transcriptional regulator [Escherichia coli CFT073]
 gi|91209721|ref|YP_539707.1| putative transcriptional regulator [Escherichia coli UTI89]
 gi|110640898|ref|YP_668626.1| DeoR family transcriptional regulator [Escherichia coli 536]
 gi|117622887|ref|YP_851800.1| putative transcriptional regulator [Escherichia coli APEC O1]
 gi|191173957|ref|ZP_03035475.1| DeoR-family transcriptional regulator [Escherichia coli F11]
 gi|215485710|ref|YP_002328141.1| predicted transcriptional regulator, DeoR family [Escherichia
          coli O127:H6 str. E2348/69]
 gi|218557607|ref|YP_002390520.1| transcriptional regulator, DeoR-family [Escherichia coli S88]
 gi|227884346|ref|ZP_04002151.1| DeoR family transcriptional regulator [Escherichia coli 83972]
 gi|237707353|ref|ZP_04537834.1| DeoR family transcriptional regulator [Escherichia sp. 3_2_53FAA]
 gi|300989960|ref|ZP_07179036.1| DeoR-like helix-turn-helix protein [Escherichia coli MS 45-1]
 gi|300996586|ref|ZP_07181480.1| DeoR-like helix-turn-helix protein [Escherichia coli MS 200-1]
 gi|301046008|ref|ZP_07193189.1| DeoR-like helix-turn-helix protein [Escherichia coli MS 185-1]
 gi|306812899|ref|ZP_07447092.1| putative transcriptional regulator, DeoR-family protein
          [Escherichia coli NC101]
 gi|312965120|ref|ZP_07779357.1| deoR-like helix-turn-helix domain protein [Escherichia coli
          2362-75]
 gi|331645836|ref|ZP_08346939.1| GlpR protein [Escherichia coli M605]
 gi|26107054|gb|AAN79238.1|AE016757_142 Putative transcriptional regulator [Escherichia coli CFT073]
 gi|91071295|gb|ABE06176.1| putative transcriptional regulator [Escherichia coli UTI89]
 gi|110342490|gb|ABG68727.1| putative regulatory protein, DeoR family [Escherichia coli 536]
 gi|115512011|gb|ABJ00086.1| putative transcriptional regulator [Escherichia coli APEC O1]
 gi|190905733|gb|EDV65354.1| DeoR-family transcriptional regulator [Escherichia coli F11]
 gi|215263782|emb|CAS08118.1| predicted transcriptional regulator, DeoR family [Escherichia
          coli O127:H6 str. E2348/69]
 gi|218364376|emb|CAR02055.1| putative transcriptional regulator, DeoR-family [Escherichia coli
          S88]
 gi|222032429|emb|CAP75168.1| transcriptional regulator [Escherichia coli LF82]
 gi|226898563|gb|EEH84822.1| DeoR family transcriptional regulator [Escherichia sp. 3_2_53FAA]
 gi|227838432|gb|EEJ48898.1| DeoR family transcriptional regulator [Escherichia coli 83972]
 gi|281177827|dbj|BAI54157.1| putative transcriptional regulator [Escherichia coli SE15]
 gi|294491466|gb|ADE90222.1| transcriptional regulator, DeoR family [Escherichia coli IHE3034]
 gi|300301981|gb|EFJ58366.1| DeoR-like helix-turn-helix protein [Escherichia coli MS 185-1]
 gi|300304483|gb|EFJ59003.1| DeoR-like helix-turn-helix protein [Escherichia coli MS 200-1]
 gi|300407235|gb|EFJ90773.1| DeoR-like helix-turn-helix protein [Escherichia coli MS 45-1]
 gi|305853662|gb|EFM54101.1| putative transcriptional regulator, DeoR-family protein
          [Escherichia coli NC101]
 gi|307552540|gb|ADN45315.1| putative transcriptional regulator [Escherichia coli ABU 83972]
 gi|307627893|gb|ADN72197.1| putative transcriptional regulator, DeoR-family protein
          [Escherichia coli UM146]
 gi|312290211|gb|EFR18094.1| deoR-like helix-turn-helix domain protein [Escherichia coli
          2362-75]
 gi|312945217|gb|ADR26044.1| putative transcriptional regulator, DeoR-family protein
          [Escherichia coli O83:H1 str. NRG 857C]
 gi|315287111|gb|EFU46525.1| DeoR-like helix-turn-helix protein [Escherichia coli MS 110-3]
 gi|315292053|gb|EFU51405.1| DeoR-like helix-turn-helix protein [Escherichia coli MS 153-1]
 gi|315299222|gb|EFU58476.1| DeoR-like helix-turn-helix protein [Escherichia coli MS 16-3]
 gi|323952751|gb|EGB48619.1| deoR family protein regulatory protein [Escherichia coli H252]
 gi|323958432|gb|EGB54138.1| deoR family protein regulatory protein [Escherichia coli H263]
 gi|324006299|gb|EGB75518.1| DeoR-like helix-turn-helix protein [Escherichia coli MS 57-2]
 gi|324010406|gb|EGB79625.1| DeoR-like helix-turn-helix protein [Escherichia coli MS 60-1]
 gi|330910437|gb|EGH38947.1| glycerol-3-phosphate regulon repressor [Escherichia coli AA86]
 gi|331044588|gb|EGI16715.1| GlpR protein [Escherichia coli M605]
          Length = 253

 Score = 39.1 bits (90), Expect = 0.19,   Method: Composition-based stats.
 Identities = 12/58 (20%), Positives = 27/58 (46%), Gaps = 2/58 (3%)

Query: 37 VRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHLPS 93
           +I   L ++  + +D+++  T      +   L++LD  G +     G V+L   +P+
Sbjct: 8  EQIMDYLKSHNLVTVDELVAVTNASPATIRRDLIKLDEQGVISRTHGG-VTLNRFIPT 64


>gi|94310737|ref|YP_583947.1| ArsR family transcriptional regulator [Cupriavidus metallidurans
          CH34]
 gi|93354589|gb|ABF08678.1| transcriptional regulator, ArsR family [Cupriavidus metallidurans
          CH34]
          Length = 121

 Score = 39.1 bits (90), Expect = 0.19,   Method: Composition-based stats.
 Identities = 12/68 (17%), Positives = 22/68 (32%)

Query: 25 ITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGK 84
             +       R  +   L   P+ + ++     +  P V   L  L+ AG +     G+
Sbjct: 12 DATFQALADTTRRTMLAQLARGPLSVTELARPLAMSLPAVMQHLSVLEQAGLVRTEKVGR 71

Query: 85 VSLTMHLP 92
          V      P
Sbjct: 72 VRTCTMAP 79


>gi|295113183|emb|CBL31820.1| Transcriptional regulators of sugar metabolism [Enterococcus sp.
          7L76]
          Length = 219

 Score = 39.1 bits (90), Expect = 0.19,   Method: Composition-based stats.
 Identities = 13/41 (31%), Positives = 18/41 (43%)

Query: 52 DIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHLP 92
          +I+    +    V   L EL+ AGRL     G  SL  + P
Sbjct: 24 EIMGRLNVSDMTVRRDLTELEAAGRLKRVHGGASSLNTYRP 64


>gi|257465867|ref|ZP_05630178.1| Smf protein [Fusobacterium gonidiaformans ATCC 25563]
 gi|315917024|ref|ZP_07913264.1| conserved hypothetical protein [Fusobacterium gonidiaformans ATCC
           25563]
 gi|313690899|gb|EFS27734.1| conserved hypothetical protein [Fusobacterium gonidiaformans ATCC
           25563]
          Length = 283

 Score = 39.1 bits (90), Expect = 0.19,   Method: Composition-based stats.
 Identities = 12/54 (22%), Positives = 22/54 (40%), Gaps = 1/54 (1%)

Query: 33  QCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
             E  +I  SL      +DD+     +   V+   L++L++ G +     GK  
Sbjct: 228 SQEAQKILVSLIRE-KSLDDLEKELFLSKQVLLSQLMQLEIEGWIKSVSGGKFK 280


>gi|257452341|ref|ZP_05617640.1| Smf protein [Fusobacterium sp. 3_1_5R]
 gi|317058884|ref|ZP_07923369.1| SMF family protein [Fusobacterium sp. 3_1_5R]
 gi|313684560|gb|EFS21395.1| SMF family protein [Fusobacterium sp. 3_1_5R]
          Length = 283

 Score = 39.1 bits (90), Expect = 0.19,   Method: Composition-based stats.
 Identities = 12/54 (22%), Positives = 22/54 (40%), Gaps = 1/54 (1%)

Query: 33  QCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
             E  +I  SL      +DD+     +   V+   L++L++ G +     GK  
Sbjct: 228 SQEAQKILVSLIRE-KSLDDLEKELFLSKQVLLSQLMQLEIEGWIKSVSGGKFK 280


>gi|262374666|ref|ZP_06067939.1| DNA protecting protein DprA [Acinetobacter junii SH205]
 gi|262310456|gb|EEY91547.1| DNA protecting protein DprA [Acinetobacter junii SH205]
          Length = 375

 Score = 39.1 bits (90), Expect = 0.19,   Method: Composition-based stats.
 Identities = 8/79 (10%), Positives = 22/79 (27%)

Query: 8   QNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLV 67
           ++              +            + + Q+L+ +   +D +          +   
Sbjct: 292 EDLALPTHWQTQQHTKDAVEQHSTLPPHLISLYQNLDWIGQDLDLLSQRYPAPISEITSQ 351

Query: 68  LLELDLAGRLCHHPEGKVS 86
           L+EL+L G         + 
Sbjct: 352 LMELELLGLCIQQGGRYLR 370


>gi|297203712|ref|ZP_06921109.1| DeoR family transcriptional regulator [Streptomyces sviceus ATCC
          29083]
 gi|297148482|gb|EDY55795.2| DeoR family transcriptional regulator [Streptomyces sviceus ATCC
          29083]
          Length = 257

 Score = 39.1 bits (90), Expect = 0.19,   Method: Composition-based stats.
 Identities = 12/58 (20%), Positives = 22/58 (37%), Gaps = 1/58 (1%)

Query: 36 RVRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHLP 92
             I ++L +  P  + D+    G+    +   L++L+  G L     G V      P
Sbjct: 10 HQLILRALRSGGPASVTDLSEQLGVSPATIRRDLVKLEEDGLLTRVHGGAVVEEGDQP 67


>gi|251793282|ref|YP_003008010.1| DNA-processing chain A [Aggregatibacter aphrophilus NJ8700]
 gi|247534677|gb|ACS97923.1| protein smf (DNA-processing chain A) [Aggregatibacter aphrophilus
           NJ8700]
          Length = 371

 Score = 39.1 bits (90), Expect = 0.19,   Method: Composition-based stats.
 Identities = 8/65 (12%), Positives = 21/65 (32%), Gaps = 3/65 (4%)

Query: 1   MVHPQIEQNFFSSQSDTNHTKNINITHY---PEYTQCERVRIKQSLNNVPIHIDDIIHHT 57
           ++        +  +           T +   PE       ++  ++   PI ID+++   
Sbjct: 282 ILENLSPSPIWKKRPQNLPHFTSRTTTHTQLPEPVTPSYPQLYDTIGYSPISIDNLVAKL 341

Query: 58  GIEAP 62
           G+   
Sbjct: 342 GLSVD 346


>gi|83589472|ref|YP_429481.1| GntR family transcriptional regulator [Moorella thermoacetica
          ATCC 39073]
 gi|83572386|gb|ABC18938.1| transcriptional regulator, GntR family [Moorella thermoacetica
          ATCC 39073]
          Length = 254

 Score = 39.1 bits (90), Expect = 0.19,   Method: Composition-based stats.
 Identities = 10/51 (19%), Positives = 21/51 (41%), Gaps = 1/51 (1%)

Query: 36 RVRIKQSLNNV-PIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
          R  I   +++  P+ ++++    G+    +   L  L+  G L     G V
Sbjct: 7  RKIIIDKISSGMPLSVNELSRELGVSPMTIRRDLETLEREGFLTRTHGGAV 57


>gi|15921674|ref|NP_377343.1| hypothetical protein ST1386 [Sulfolobus tokodaii str. 7]
 gi|15622461|dbj|BAB66452.1| 300aa long conserved hypothetical protein [Sulfolobus tokodaii
          str. 7]
          Length = 300

 Score = 39.1 bits (90), Expect = 0.19,   Method: Composition-based stats.
 Identities = 9/51 (17%), Positives = 21/51 (41%), Gaps = 5/51 (9%)

Query: 32 TQCERVRIKQSL---NNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCH 79
              + RI + L     +P    +++  +G+    +  +L EL+  G +  
Sbjct: 1  MSDSKSRIIEILKKFGELPQS--ELVRISGLSKSRLSEILSELEKQGLIER 49


>gi|116750394|ref|YP_847081.1| methyl-viologen-reducing hydrogenase subunit delta [Syntrophobacter
           fumaroxidans MPOB]
 gi|116750436|ref|YP_847123.1| methyl-viologen-reducing hydrogenase subunit delta [Syntrophobacter
           fumaroxidans MPOB]
 gi|116699458|gb|ABK18646.1| methyl-viologen-reducing hydrogenase, delta subunit
           [Syntrophobacter fumaroxidans MPOB]
 gi|116699500|gb|ABK18688.1| methyl-viologen-reducing hydrogenase, delta subunit
           [Syntrophobacter fumaroxidans MPOB]
          Length = 252

 Score = 39.1 bits (90), Expect = 0.20,   Method: Composition-based stats.
 Identities = 11/45 (24%), Positives = 22/45 (48%)

Query: 36  RVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHH 80
           +  I + L   P+ +  I   +G+    + L+L E++ AG +  H
Sbjct: 194 KALILECLREGPLSVRQIAARSGLGVYEISLLLSEVERAGLVDLH 238


>gi|312126810|ref|YP_003991684.1| DNA protecting protein dpra [Caldicellulosiruptor hydrothermalis
           108]
 gi|311776829|gb|ADQ06315.1| DNA protecting protein DprA [Caldicellulosiruptor hydrothermalis
           108]
          Length = 365

 Score = 39.1 bits (90), Expect = 0.20,   Method: Composition-based stats.
 Identities = 9/50 (18%), Positives = 25/50 (50%), Gaps = 1/50 (2%)

Query: 38  RIKQSLN-NVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
           R+ + L+ N  +H++ +I  TG +   +  ++  L++  ++       +S
Sbjct: 314 RLIKLLDENGEMHVESLIALTGWDPGKIASLITSLEIKSKVVRDRGNIIS 363


>gi|255972459|ref|ZP_05423045.1| lactose phosphotransferase system repressor [Enterococcus
          faecalis T1]
 gi|255963477|gb|EET95953.1| lactose phosphotransferase system repressor [Enterococcus
          faecalis T1]
          Length = 225

 Score = 39.1 bits (90), Expect = 0.20,   Method: Composition-based stats.
 Identities = 12/39 (30%), Positives = 17/39 (43%)

Query: 54 IHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHLP 92
          +    +    V   L EL++AGRL     G  SL  + P
Sbjct: 1  MERLNVSDMTVRRDLTELEVAGRLKRVHGGASSLNTYRP 39


>gi|327194450|gb|EGE61310.1| filamentation induced by cAMP protein Fic [Rhizobium etli CNPAF512]
          Length = 306

 Score = 39.1 bits (90), Expect = 0.21,   Method: Composition-based stats.
 Identities = 13/69 (18%), Positives = 25/69 (36%), Gaps = 4/69 (5%)

Query: 21  KNINITHYPEYTQCERVRIKQSLNNVP-IHIDDIIHHTGIEAPVVYLVLLELDLAGRLCH 79
           ++              +RI       P +  + ++  TG+ AP V   L +L+  G +  
Sbjct: 185 EDRERITSESDRAGSALRIHDLFQQNPFMTANQLVQQTGLSAPTVNAALTDLERFGVVEE 244

Query: 80  HPE---GKV 85
                 G+V
Sbjct: 245 VTGRKRGRV 253


>gi|307257797|ref|ZP_07539554.1| hypothetical protein appser10_17820 [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|306863703|gb|EFM95629.1| hypothetical protein appser10_17820 [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
          Length = 384

 Score = 39.1 bits (90), Expect = 0.21,   Method: Composition-based stats.
 Identities = 18/83 (21%), Positives = 31/83 (37%)

Query: 4   PQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPV 63
           PQ  +N           K  ++          + +I   ++  PI IDD+   T +E   
Sbjct: 301 PQAVENAQFFTKADVPNKVNHLAKKLPELTDCQQQIVAHISLEPISIDDLAKATALEVDT 360

Query: 64  VYLVLLELDLAGRLCHHPEGKVS 86
           + + LL L+L   +     G V 
Sbjct: 361 LLVELLGLELLSVIKQVSGGYVR 383


>gi|330806736|ref|YP_004351198.1| hypothetical protein PSEBR_a72 [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327374844|gb|AEA66194.1| Conserved hypothetical protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 364

 Score = 39.1 bits (90), Expect = 0.21,   Method: Composition-based stats.
 Identities = 11/67 (16%), Positives = 23/67 (34%), Gaps = 3/67 (4%)

Query: 21  KNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHH 80
           + +     P         + + L+  P+  + +   +G   P V   L EL++ GR    
Sbjct: 301 QRLPPASEPVPVT---HPLLRLLHAAPLSSEALADASGWGLPKVLAALTELEMEGRATCD 357

Query: 81  PEGKVSL 87
                + 
Sbjct: 358 NGRWFAR 364


>gi|254248593|ref|ZP_04941913.1| Helicase [Burkholderia cenocepacia PC184]
 gi|124875094|gb|EAY65084.1| Helicase [Burkholderia cenocepacia PC184]
          Length = 1518

 Score = 39.1 bits (90), Expect = 0.21,   Method: Composition-based stats.
 Identities = 8/72 (11%), Positives = 19/72 (26%), Gaps = 3/72 (4%)

Query: 11   FSSQSDTNHTKNINITHYPE-YTQCERVRIKQS--LNNVPIHIDDIIHHTGIEAPVVYLV 67
                +       +              V + ++      P+ +D I    G+    +   
Sbjct: 1034 LHPDARATPALKVPAACAQPWEADAALVDVIRARLTGFGPLTLDAIAAPLGLPPASIATA 1093

Query: 68   LLELDLAGRLCH 79
            L  L+  G +  
Sbjct: 1094 LAALEREGYVMR 1105


>gi|254430989|ref|ZP_05044692.1| SMF family protein [Cyanobium sp. PCC 7001]
 gi|197625442|gb|EDY38001.1| SMF family protein [Cyanobium sp. PCC 7001]
          Length = 354

 Score = 39.1 bits (90), Expect = 0.21,   Method: Composition-based stats.
 Identities = 12/78 (15%), Positives = 19/78 (24%), Gaps = 1/78 (1%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVV 64
               +                             + QSL      ++ +       A  V
Sbjct: 272 LDADDLIRQLGPGPRPVASAAGRSRGAASEADAALLQSLEGGA-SLEQLCLALEQPAAQV 330

Query: 65  YLVLLELDLAGRLCHHPE 82
              LL L+LAG +   P 
Sbjct: 331 ATRLLALELAGLVQAEPG 348


>gi|299066433|emb|CBJ37618.1| putative transcriptional regulatory, arsR family [Ralstonia
          solanacearum CMR15]
          Length = 118

 Score = 39.1 bits (90), Expect = 0.21,   Method: Composition-based stats.
 Identities = 12/62 (19%), Positives = 21/62 (33%)

Query: 32 TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHL 91
              R  +   L   P  + ++    G+  P V   L  L+ +G +     G+V      
Sbjct: 16 ADATRRSMLAQLTRGPASVSELARPLGMSLPAVMQHLAVLEHSGLVRSEKTGRVRTCRIE 75

Query: 92 PS 93
          P 
Sbjct: 76 PQ 77


>gi|227872632|ref|ZP_03990964.1| SMF family DNA processing protein [Oribacterium sinus F0268]
 gi|227841519|gb|EEJ51817.1| SMF family DNA processing protein [Oribacterium sinus F0268]
          Length = 300

 Score = 39.1 bits (90), Expect = 0.21,   Method: Composition-based stats.
 Identities = 9/53 (16%), Positives = 19/53 (35%)

Query: 35  ERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           E+ RI  +L     H   +     +   +++  L+EL++ G            
Sbjct: 240 EKRRIYLALGFESKHFQSLQEELKLPNYMLHRYLIELEVEGYCECVQAAYYRR 292


>gi|297581918|ref|ZP_06943838.1| smf/DprA family protein [Vibrio cholerae RC385]
 gi|297533785|gb|EFH72626.1| smf/DprA family protein [Vibrio cholerae RC385]
          Length = 371

 Score = 39.1 bits (90), Expect = 0.21,   Method: Composition-based stats.
 Identities = 12/49 (24%), Positives = 21/49 (42%)

Query: 38  RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
            +  ++      ID +   T I    + + LLEL+L G +   P G + 
Sbjct: 319 ELLANVGIEATPIDILASRTQIPVQDIMMQLLELELLGHVVAVPGGYIR 367


>gi|269103774|ref|ZP_06156471.1| rossmann fold nucleotide-binding protein Smf possibly involved in
           DNA uptake [Photobacterium damselae subsp. damselae CIP
           102761]
 gi|268163672|gb|EEZ42168.1| rossmann fold nucleotide-binding protein Smf possibly involved in
           DNA uptake [Photobacterium damselae subsp. damselae CIP
           102761]
          Length = 364

 Score = 39.1 bits (90), Expect = 0.22,   Method: Composition-based stats.
 Identities = 13/86 (15%), Positives = 27/86 (31%), Gaps = 4/86 (4%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYPEYTQCERV----RIKQSLNNVPIHIDDIIHHTGIE 60
           +  Q+ F            +                  +  ++ +  I +D +   + + 
Sbjct: 275 ESAQDIFEEVGALTECAINHQLSQALPETENEQLPFPELLATVGSEVIPVDVLAERSQMP 334

Query: 61  APVVYLVLLELDLAGRLCHHPEGKVS 86
              V   LLEL+L G +   P G + 
Sbjct: 335 VHDVMTQLLELELLGLVTALPGGYIR 360


>gi|227080285|ref|YP_002808836.1| smf protein [Vibrio cholerae M66-2]
 gi|298501231|ref|ZP_07011030.1| smf/DprA family protein [Vibrio cholerae MAK 757]
 gi|227008173|gb|ACP04385.1| smf protein [Vibrio cholerae M66-2]
 gi|297540103|gb|EFH76165.1| smf/DprA family protein [Vibrio cholerae MAK 757]
          Length = 371

 Score = 39.1 bits (90), Expect = 0.22,   Method: Composition-based stats.
 Identities = 12/49 (24%), Positives = 21/49 (42%)

Query: 38  RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
            +  ++      ID +   T I    + + LLEL+L G +   P G + 
Sbjct: 319 ELLANVGIEATPIDILASRTQIPVQDIMMQLLELELLGHVVAVPGGYIR 367


>gi|327334524|gb|EGE76235.1| transcriptional regulator, DeoR family [Propionibacterium acnes
          HL097PA1]
          Length = 268

 Score = 39.1 bits (90), Expect = 0.22,   Method: Composition-based stats.
 Identities = 11/41 (26%), Positives = 22/41 (53%)

Query: 48 IHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
          + ++D++  TG+ A  +Y  L  L+ +G L  H    V++ 
Sbjct: 29 VSVEDLVELTGVSAMTIYRDLAILESSGVLQRHRGRVVAVA 69


>gi|170735723|ref|YP_001776983.1| DEAD/DEAH box helicase domain-containing protein [Burkholderia
            cenocepacia MC0-3]
 gi|169817911|gb|ACA92493.1| DEAD/H associated domain protein [Burkholderia cenocepacia MC0-3]
          Length = 1518

 Score = 39.1 bits (90), Expect = 0.22,   Method: Composition-based stats.
 Identities = 8/72 (11%), Positives = 19/72 (26%), Gaps = 3/72 (4%)

Query: 11   FSSQSDTNHTKNINITHYPE-YTQCERVRIKQS--LNNVPIHIDDIIHHTGIEAPVVYLV 67
                +       +              V + ++      P+ +D I    G+    +   
Sbjct: 1034 LHPDARATPALKVPAACAQPWEADAALVDVIRARLTGFGPLTLDAIAAPLGLPPASIATA 1093

Query: 68   LLELDLAGRLCH 79
            L  L+  G +  
Sbjct: 1094 LAALEREGYVMR 1105


>gi|15640080|ref|NP_229707.1| smf protein [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|121587264|ref|ZP_01677037.1| Smf/DprA family protein [Vibrio cholerae 2740-80]
 gi|121727882|ref|ZP_01680941.1| Smf/DprA family protein [Vibrio cholerae V52]
 gi|147675247|ref|YP_001218364.1| Smf/DprA family protein [Vibrio cholerae O395]
 gi|153817608|ref|ZP_01970275.1| Smf/DprA family protein [Vibrio cholerae NCTC 8457]
 gi|153821944|ref|ZP_01974611.1| Smf/DprA family protein [Vibrio cholerae B33]
 gi|229508333|ref|ZP_04397837.1| hypothetical protein VCF_003568 [Vibrio cholerae BX 330286]
 gi|229508828|ref|ZP_04398319.1| hypothetical protein VCE_000233 [Vibrio cholerae B33]
 gi|229517099|ref|ZP_04406545.1| hypothetical protein VCC_001120 [Vibrio cholerae RC9]
 gi|229606608|ref|YP_002877256.1| hypothetical protein VCD_001517 [Vibrio cholerae MJ-1236]
 gi|254851613|ref|ZP_05240963.1| smf/DprA family protein [Vibrio cholerae MO10]
 gi|255746770|ref|ZP_05420716.1| rossmann fold nucleotide-binding protein Smf possibly involved in
           DNA uptake [Vibrio cholera CIRS 101]
 gi|262155851|ref|ZP_06028973.1| rossmann fold nucleotide-binding protein Smf possibly involved in
           DNA uptake [Vibrio cholerae INDRE 91/1]
 gi|262166894|ref|ZP_06034615.1| rossmann fold nucleotide-binding protein Smf possibly involved in
           DNA uptake [Vibrio cholerae RC27]
 gi|9654442|gb|AAF93226.1| smf protein [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|121548510|gb|EAX58566.1| Smf/DprA family protein [Vibrio cholerae 2740-80]
 gi|121629826|gb|EAX62241.1| Smf/DprA family protein [Vibrio cholerae V52]
 gi|126511876|gb|EAZ74470.1| Smf/DprA family protein [Vibrio cholerae NCTC 8457]
 gi|126520564|gb|EAZ77787.1| Smf/DprA family protein [Vibrio cholerae B33]
 gi|146317130|gb|ABQ21669.1| Smf/DprA family protein [Vibrio cholerae O395]
 gi|227011949|gb|ACP08159.1| smf protein [Vibrio cholerae O395]
 gi|229346162|gb|EEO11134.1| hypothetical protein VCC_001120 [Vibrio cholerae RC9]
 gi|229354103|gb|EEO19035.1| hypothetical protein VCE_000233 [Vibrio cholerae B33]
 gi|229354606|gb|EEO19528.1| hypothetical protein VCF_003568 [Vibrio cholerae BX 330286]
 gi|229369263|gb|ACQ59686.1| hypothetical protein VCD_001517 [Vibrio cholerae MJ-1236]
 gi|254847318|gb|EET25732.1| smf/DprA family protein [Vibrio cholerae MO10]
 gi|255735527|gb|EET90926.1| rossmann fold nucleotide-binding protein Smf possibly involved in
           DNA uptake [Vibrio cholera CIRS 101]
 gi|262024665|gb|EEY43345.1| rossmann fold nucleotide-binding protein Smf possibly involved in
           DNA uptake [Vibrio cholerae RC27]
 gi|262030303|gb|EEY48945.1| rossmann fold nucleotide-binding protein Smf possibly involved in
           DNA uptake [Vibrio cholerae INDRE 91/1]
          Length = 371

 Score = 39.1 bits (90), Expect = 0.22,   Method: Composition-based stats.
 Identities = 12/49 (24%), Positives = 21/49 (42%)

Query: 38  RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
            +  ++      ID +   T I    + + LLEL+L G +   P G + 
Sbjct: 319 ELLANVGIEATPIDILASRTQIPVQDIMMQLLELELLGHVVAVPGGYIR 367


>gi|149925346|ref|ZP_01913610.1| SMF protein [Limnobacter sp. MED105]
 gi|149825463|gb|EDM84671.1| SMF protein [Limnobacter sp. MED105]
          Length = 362

 Score = 39.1 bits (90), Expect = 0.22,   Method: Composition-based stats.
 Identities = 15/79 (18%), Positives = 25/79 (31%)

Query: 10  FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLL 69
                    HT+             E  R+ Q L + P+H D +    G+        L 
Sbjct: 280 VLQEDDSDCHTEMTCTIDTDAEPDEELGRVLQYLGHDPVHTDTLARQLGLGTEDTLAALT 339

Query: 70  ELDLAGRLCHHPEGKVSLT 88
           EL+L G +      +   +
Sbjct: 340 ELELLGLVLSESGNRWVRS 358


>gi|314969118|gb|EFT13216.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL037PA1]
          Length = 268

 Score = 39.1 bits (90), Expect = 0.23,   Method: Composition-based stats.
 Identities = 11/41 (26%), Positives = 22/41 (53%)

Query: 48 IHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
          + ++D++  TG+ A  +Y  L  L+ +G L  H    V++ 
Sbjct: 29 VSVEDLVESTGVSAMTIYRDLAILESSGVLQRHRGRVVAVA 69


>gi|251794253|ref|YP_003008984.1| DeoR family transcriptional regulator [Paenibacillus sp. JDR-2]
 gi|247541879|gb|ACS98897.1| transcriptional regulator, DeoR family [Paenibacillus sp. JDR-2]
          Length = 258

 Score = 39.1 bits (90), Expect = 0.23,   Method: Composition-based stats.
 Identities = 11/59 (18%), Positives = 25/59 (42%), Gaps = 1/59 (1%)

Query: 36 RVRIKQSLN-NVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHLPS 93
          R RI + L     ++++++     +    +   L +L+ +G+L     G V L   +  
Sbjct: 9  RNRILEMLGIKGKVNVNELARQFEVTTETIRRDLDDLEKSGKLKKVYGGAVKLKTEIEP 67


>gi|331697351|ref|YP_004333590.1| AsnC family transcriptional regulator [Pseudonocardia
          dioxanivorans CB1190]
 gi|326952040|gb|AEA25737.1| transcriptional regulator, AsnC family [Pseudonocardia
          dioxanivorans CB1190]
          Length = 163

 Score = 39.1 bits (90), Expect = 0.23,   Method: Composition-based stats.
 Identities = 9/44 (20%), Positives = 16/44 (36%), Gaps = 1/44 (2%)

Query: 37 VRIKQSLN-NVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCH 79
            I + L  +  +  D I    G+    V   + E + AG +  
Sbjct: 2  REILELLERDSALSHDTIATMLGLPVEEVSARIAEWEAAGVIRR 45


>gi|229515913|ref|ZP_04405370.1| hypothetical protein VCB_003571 [Vibrio cholerae TMA 21]
 gi|229347013|gb|EEO11975.1| hypothetical protein VCB_003571 [Vibrio cholerae TMA 21]
          Length = 371

 Score = 39.1 bits (90), Expect = 0.23,   Method: Composition-based stats.
 Identities = 12/49 (24%), Positives = 21/49 (42%)

Query: 38  RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
            +  ++      ID +   T I    + + LLEL+L G +   P G + 
Sbjct: 319 ELLANVGIEATPIDILASRTQIPVQDIMMQLLELELLGHVVAVPGGYIR 367


>gi|153212925|ref|ZP_01948519.1| Smf/DprA family protein [Vibrio cholerae 1587]
 gi|124116151|gb|EAY34971.1| Smf/DprA family protein [Vibrio cholerae 1587]
          Length = 371

 Score = 39.1 bits (90), Expect = 0.23,   Method: Composition-based stats.
 Identities = 12/49 (24%), Positives = 21/49 (42%)

Query: 38  RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
            +  ++      ID +   T I    + + LLEL+L G +   P G + 
Sbjct: 319 ELLANVGIEATPIDILASRTQIPVQDIMMQLLELELLGHVVAVPGGYIR 367


>gi|229524950|ref|ZP_04414355.1| hypothetical protein VCA_002559 [Vibrio cholerae bv. albensis
           VL426]
 gi|229338531|gb|EEO03548.1| hypothetical protein VCA_002559 [Vibrio cholerae bv. albensis
           VL426]
          Length = 371

 Score = 39.1 bits (90), Expect = 0.24,   Method: Composition-based stats.
 Identities = 12/49 (24%), Positives = 21/49 (42%)

Query: 38  RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
            +  ++      ID +   T I    + + LLEL+L G +   P G + 
Sbjct: 319 ELLANVGIEATPIDILASRTQIPVQDIMMQLLELELLGHVVAVPGGYIR 367


>gi|153802768|ref|ZP_01957354.1| Smf/DprA family protein [Vibrio cholerae MZO-3]
 gi|124121681|gb|EAY40424.1| Smf/DprA family protein [Vibrio cholerae MZO-3]
          Length = 371

 Score = 39.1 bits (90), Expect = 0.24,   Method: Composition-based stats.
 Identities = 12/49 (24%), Positives = 21/49 (42%)

Query: 38  RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
            +  ++      ID +   T I    + + LLEL+L G +   P G + 
Sbjct: 319 ELLANVGIEATPIDILASRTQIPVQDIMMQLLELELLGHVVAVPGGYIR 367


>gi|302555417|ref|ZP_07307759.1| DeoR family transcriptional regulator [Streptomyces
          viridochromogenes DSM 40736]
 gi|302473035|gb|EFL36128.1| DeoR family transcriptional regulator [Streptomyces
          viridochromogenes DSM 40736]
          Length = 254

 Score = 39.1 bits (90), Expect = 0.24,   Method: Composition-based stats.
 Identities = 12/58 (20%), Positives = 22/58 (37%), Gaps = 1/58 (1%)

Query: 36 RVRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHLP 92
             I ++L +  P  + D+    G+    +   L++L+  G L     G V      P
Sbjct: 7  HQLILRALRSGGPAAVTDLSEQLGVSPATIRRDLVKLEEDGLLTRVHGGAVVEEGDQP 64


>gi|153826433|ref|ZP_01979100.1| Smf/DprA family protein [Vibrio cholerae MZO-2]
 gi|149739819|gb|EDM54014.1| Smf/DprA family protein [Vibrio cholerae MZO-2]
          Length = 371

 Score = 39.1 bits (90), Expect = 0.24,   Method: Composition-based stats.
 Identities = 12/49 (24%), Positives = 21/49 (42%)

Query: 38  RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
            +  ++      ID +   T I    + + LLEL+L G +   P G + 
Sbjct: 319 ELLANVGIEATPIDILASRTQIPVQDIMMQLLELELLGHVVAVPGGYIR 367


>gi|153830116|ref|ZP_01982783.1| Smf/DprA family protein [Vibrio cholerae 623-39]
 gi|229530166|ref|ZP_04419555.1| hypothetical protein VCG_003277 [Vibrio cholerae 12129(1)]
 gi|254225572|ref|ZP_04919181.1| Smf/DprA family protein [Vibrio cholerae V51]
 gi|254291091|ref|ZP_04961888.1| Smf/DprA family protein [Vibrio cholerae AM-19226]
 gi|125621892|gb|EAZ50217.1| Smf/DprA family protein [Vibrio cholerae V51]
 gi|148874380|gb|EDL72515.1| Smf/DprA family protein [Vibrio cholerae 623-39]
 gi|150422936|gb|EDN14886.1| Smf/DprA family protein [Vibrio cholerae AM-19226]
 gi|229332299|gb|EEN97786.1| hypothetical protein VCG_003277 [Vibrio cholerae 12129(1)]
 gi|327482959|gb|AEA77366.1| Rossmann fold nucleotide-binding protein Smf possibly involved in
           DNA uptake [Vibrio cholerae LMA3894-4]
          Length = 371

 Score = 39.1 bits (90), Expect = 0.24,   Method: Composition-based stats.
 Identities = 12/49 (24%), Positives = 21/49 (42%)

Query: 38  RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
            +  ++      ID +   T I    + + LLEL+L G +   P G + 
Sbjct: 319 ELLANVGIEATPIDILASRTQIPVQDIMMQLLELELLGHVVAVPGGYIR 367


>gi|313835211|gb|EFS72925.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL037PA2]
 gi|314929183|gb|EFS93014.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL044PA1]
 gi|314970866|gb|EFT14964.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL037PA3]
          Length = 278

 Score = 39.1 bits (90), Expect = 0.24,   Method: Composition-based stats.
 Identities = 11/41 (26%), Positives = 22/41 (53%)

Query: 48 IHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
          + ++D++  TG+ A  +Y  L  L+ +G L  H    V++ 
Sbjct: 39 VSVEDLVEATGVSAMTIYRDLASLEASGVLQRHRGRVVAVA 79


>gi|295675124|ref|YP_003603648.1| DNA protecting protein DprA [Burkholderia sp. CCGE1002]
 gi|295434967|gb|ADG14137.1| DNA protecting protein DprA [Burkholderia sp. CCGE1002]
          Length = 409

 Score = 39.1 bits (90), Expect = 0.24,   Method: Composition-based stats.
 Identities = 15/70 (21%), Positives = 30/70 (42%), Gaps = 1/70 (1%)

Query: 23  INITHYPEYTQ-CERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHP 81
                 P+     +  R+  +L + P  ++ +   T +E   ++  LL L+LAG++   P
Sbjct: 340 PPSGSAPQPALAPDAQRLLAALGHSPTTLEILAARTEMEDAALHAALLRLELAGKITLLP 399

Query: 82  EGKVSLTMHL 91
            G+     H 
Sbjct: 400 GGRFMRAHHD 409


>gi|228471288|ref|ZP_04056094.1| Smf protein DNA processing chain A [Porphyromonas uenonis 60-3]
 gi|228306930|gb|EEK16028.1| Smf protein DNA processing chain A [Porphyromonas uenonis 60-3]
          Length = 384

 Score = 39.1 bits (90), Expect = 0.24,   Method: Composition-based stats.
 Identities = 12/58 (20%), Positives = 22/58 (37%), Gaps = 2/58 (3%)

Query: 32  TQCERVRIKQSL--NNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
            + +   +   L  +   + ID I   T +    V   L  L+  G +   P+G+  L
Sbjct: 325 LEPKTRPLLDLLIESGDGLSIDAICDQTLMGVDEVSFRLFLLESDGAVSLQPDGRYKL 382


>gi|50843761|ref|YP_056988.1| DeoR family transcriptional regulator [Propionibacterium acnes
          KPA171202]
 gi|289424364|ref|ZP_06426147.1| transcriptional regulator, DeoR family [Propionibacterium acnes
          SK187]
 gi|289427560|ref|ZP_06429273.1| transcriptional regulator, DeoR family [Propionibacterium acnes
          J165]
 gi|295131854|ref|YP_003582517.1| transcriptional regulator, DeoR family [Propionibacterium acnes
          SK137]
 gi|50841363|gb|AAT84030.1| putative regulatory protein, DeoR family [Propionibacterium acnes
          KPA171202]
 gi|289155061|gb|EFD03743.1| transcriptional regulator, DeoR family [Propionibacterium acnes
          SK187]
 gi|289159490|gb|EFD07681.1| transcriptional regulator, DeoR family [Propionibacterium acnes
          J165]
 gi|291375656|gb|ADD99510.1| transcriptional regulator, DeoR family [Propionibacterium acnes
          SK137]
 gi|313765061|gb|EFS36425.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL013PA1]
 gi|313771101|gb|EFS37067.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL074PA1]
 gi|313792605|gb|EFS40691.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL110PA1]
 gi|313803604|gb|EFS44786.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL110PA2]
 gi|313806817|gb|EFS45315.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL087PA2]
 gi|313811733|gb|EFS49447.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL083PA1]
 gi|313814254|gb|EFS51968.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL025PA1]
 gi|313815689|gb|EFS53403.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL059PA1]
 gi|313817607|gb|EFS55321.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL046PA2]
 gi|313821567|gb|EFS59281.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL036PA1]
 gi|313824489|gb|EFS62203.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL036PA2]
 gi|313826834|gb|EFS64548.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL063PA1]
 gi|313829152|gb|EFS66866.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL063PA2]
 gi|313832265|gb|EFS69979.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL007PA1]
 gi|313832726|gb|EFS70440.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL056PA1]
 gi|313839586|gb|EFS77300.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL086PA1]
 gi|314916179|gb|EFS80010.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL005PA4]
 gi|314917443|gb|EFS81274.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL050PA1]
 gi|314921781|gb|EFS85612.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL050PA3]
 gi|314926230|gb|EFS90061.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL036PA3]
 gi|314930951|gb|EFS94782.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL067PA1]
 gi|314955378|gb|EFS99783.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL027PA1]
 gi|314959124|gb|EFT03226.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL002PA1]
 gi|314961626|gb|EFT05727.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL002PA2]
 gi|314963910|gb|EFT08010.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL082PA1]
 gi|314975164|gb|EFT19259.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL053PA1]
 gi|314977574|gb|EFT21669.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL045PA1]
 gi|314979958|gb|EFT24052.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL072PA2]
 gi|314985079|gb|EFT29171.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL005PA1]
 gi|314987149|gb|EFT31241.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL005PA2]
 gi|314990651|gb|EFT34742.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL005PA3]
 gi|315079123|gb|EFT51130.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL053PA2]
 gi|315081533|gb|EFT53509.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL078PA1]
 gi|315083042|gb|EFT55018.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL027PA2]
 gi|315086576|gb|EFT58552.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL002PA3]
 gi|315087980|gb|EFT59956.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL072PA1]
 gi|315096940|gb|EFT68916.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL038PA1]
 gi|315099377|gb|EFT71353.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL059PA2]
 gi|315102279|gb|EFT74255.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL046PA1]
 gi|315107426|gb|EFT79402.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL030PA1]
 gi|315109720|gb|EFT81696.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL030PA2]
 gi|327332466|gb|EGE74201.1| transcriptional regulator, DeoR family [Propionibacterium acnes
          HL096PA2]
 gi|327334089|gb|EGE75804.1| transcriptional regulator, DeoR family [Propionibacterium acnes
          HL096PA3]
 gi|327444506|gb|EGE91160.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL013PA2]
 gi|327446759|gb|EGE93413.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL043PA2]
 gi|327448801|gb|EGE95455.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL043PA1]
 gi|327454219|gb|EGF00874.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL087PA3]
 gi|327456277|gb|EGF02932.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL083PA2]
 gi|327457449|gb|EGF04104.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL092PA1]
 gi|328755976|gb|EGF69592.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL087PA1]
 gi|328758012|gb|EGF71628.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL020PA1]
 gi|328758939|gb|EGF72555.1| DeoR-like helix-turn-helix protein [Propionibacterium acnes
          HL025PA2]
 gi|328759862|gb|EGF73452.1| transcriptional regulator, DeoR family [Propionibacterium acnes
          HL099PA1]
 gi|332676717|gb|AEE73533.1| HTH-type transcriptional regulator YgbI [Propionibacterium acnes
          266]
          Length = 268

 Score = 39.1 bits (90), Expect = 0.24,   Method: Composition-based stats.
 Identities = 11/41 (26%), Positives = 22/41 (53%)

Query: 48 IHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
          + ++D++  TG+ A  +Y  L  L+ +G L  H    V++ 
Sbjct: 29 VSVEDLVESTGVSAMTIYRDLAILESSGVLQRHRGRVVAVA 69


>gi|312792638|ref|YP_004025561.1| DNA protecting protein dpra [Caldicellulosiruptor kristjanssonii
           177R1B]
 gi|312179778|gb|ADQ39948.1| DNA protecting protein DprA [Caldicellulosiruptor kristjanssonii
           177R1B]
          Length = 365

 Score = 38.7 bits (89), Expect = 0.25,   Method: Composition-based stats.
 Identities = 9/50 (18%), Positives = 24/50 (48%), Gaps = 1/50 (2%)

Query: 38  RIKQSLN-NVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
           R+ + L+ N  +H++ +I  TG     +  ++  L++  ++       +S
Sbjct: 314 RLIKLLDENGEMHVESLIALTGWNPGKIASLITSLEIKSKVVRTRGNIIS 363


>gi|222446039|ref|ZP_03608554.1| hypothetical protein METSMIALI_01688 [Methanobrevibacter smithii
          DSM 2375]
 gi|222435604|gb|EEE42769.1| hypothetical protein METSMIALI_01688 [Methanobrevibacter smithii
          DSM 2375]
          Length = 266

 Score = 38.7 bits (89), Expect = 0.25,   Method: Composition-based stats.
 Identities = 11/53 (20%), Positives = 24/53 (45%), Gaps = 1/53 (1%)

Query: 36 RVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
          R++I  +L   P+++ DI   TG+    +   +  L+L G +         ++
Sbjct: 30 RLKILATLYERPLNMKDINRTTGLSYSSISSNMFGLELGGFIYR-SGNLYHIS 81


>gi|326794870|ref|YP_004312690.1| DeoR family transcriptional regulator [Marinomonas mediterranea
          MMB-1]
 gi|326545634|gb|ADZ90854.1| transcriptional regulator, DeoR family [Marinomonas mediterranea
          MMB-1]
          Length = 252

 Score = 38.7 bits (89), Expect = 0.25,   Method: Composition-based stats.
 Identities = 7/49 (14%), Positives = 20/49 (40%), Gaps = 1/49 (2%)

Query: 36 RVRIKQSLNNVPIH-IDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEG 83
             I   L +  +  +D++++   +    +   L++L+  G +     G
Sbjct: 7  YKEIVDYLKDTSLATVDELVNKIDVSPATIRRDLIDLEQQGAVRRTHGG 55


>gi|320533103|ref|ZP_08033835.1| DeoR-like helix-turn-helix protein [Actinomyces sp. oral taxon
          171 str. F0337]
 gi|320134675|gb|EFW26891.1| DeoR-like helix-turn-helix protein [Actinomyces sp. oral taxon
          171 str. F0337]
          Length = 255

 Score = 38.7 bits (89), Expect = 0.25,   Method: Composition-based stats.
 Identities = 12/58 (20%), Positives = 22/58 (37%), Gaps = 1/58 (1%)

Query: 30 EYTQCERVRIKQSLNNVPIH-IDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
          E     R  I ++L+   +H +  +   TG+    +   L EL   G +     G + 
Sbjct: 3  ESPHDRRRTILRALSPTTVHSVQALSRLTGVSVITIRRDLAELAHEGLVTRVHGGALR 60


>gi|325673254|ref|ZP_08152946.1| IclR family transcriptional regulator [Rhodococcus equi ATCC
          33707]
 gi|325555844|gb|EGD25514.1| IclR family transcriptional regulator [Rhodococcus equi ATCC
          33707]
          Length = 268

 Score = 38.7 bits (89), Expect = 0.25,   Method: Composition-based stats.
 Identities = 11/69 (15%), Positives = 24/69 (34%), Gaps = 3/69 (4%)

Query: 19 HTKNINITHYPEYTQCER-VRIKQSLN--NVPIHIDDIIHHTGIEAPVVYLVLLELDLAG 75
           T           +  +R   I  +    +  + ++++   T +    V+ +L  L   G
Sbjct: 7  PTDISPTDRAVPPSMVDRMTVILDAFGGFSSRVPLEELARRTRLPRSTVHRILDSLLRLG 66

Query: 76 RLCHHPEGK 84
           + H P G 
Sbjct: 67 WVEHSPGGY 75


>gi|260554283|ref|ZP_05826533.1| DNA protecting protein DprA [Acinetobacter sp. RUH2624]
 gi|260404592|gb|EEW98112.1| DNA protecting protein DprA [Acinetobacter sp. RUH2624]
          Length = 376

 Score = 38.7 bits (89), Expect = 0.26,   Method: Composition-based stats.
 Identities = 13/73 (17%), Positives = 26/73 (35%)

Query: 10  FFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLL 69
             +       ++N              + + QSL+ V  +ID ++ H  +    +   L+
Sbjct: 297 LPTQWQSQQQSQNEETNTNIPEIPEHLIDLYQSLDWVGQNIDQLVIHHNVSVSELTSSLM 356

Query: 70  ELDLAGRLCHHPE 82
           EL+L G       
Sbjct: 357 ELELLGLCMQQSG 369


>gi|78062702|ref|YP_372610.1| DEAD/DEAH box helicase [Burkholderia sp. 383]
 gi|77970587|gb|ABB11966.1| ATP dependent helicase, Lhr family [Burkholderia sp. 383]
          Length = 1515

 Score = 38.7 bits (89), Expect = 0.26,   Method: Composition-based stats.
 Identities = 11/78 (14%), Positives = 20/78 (25%), Gaps = 6/78 (7%)

Query: 2    VHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEA 61
            +HP       +                       R R+       P+ +D I    G+  
Sbjct: 1032 LHPDAR---IAPALKVPAACAQPWEADAALVDVIRARLT---GFGPLALDSIATPLGLPP 1085

Query: 62   PVVYLVLLELDLAGRLCH 79
              +   L  L+  G +  
Sbjct: 1086 ASIATALAALEREGYVMR 1103


>gi|17546679|ref|NP_520081.1| transcriptional regulatory DNA-binding transcription regulator
          protein [Ralstonia solanacearum GMI1000]
 gi|17428978|emb|CAD15662.1| putative transcriptional regulatory dna-binding transcription
          regulator protein [Ralstonia solanacearum GMI1000]
          Length = 118

 Score = 38.7 bits (89), Expect = 0.26,   Method: Composition-based stats.
 Identities = 12/62 (19%), Positives = 21/62 (33%)

Query: 32 TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHL 91
              R  +   L   P  + ++    G+  P V   L  L+ +G +     G+V      
Sbjct: 16 ADATRRSMLAQLTRGPASVSELARPLGMSLPAVMQHLAVLEHSGLVRSEKTGRVRTCRIE 75

Query: 92 PS 93
          P 
Sbjct: 76 PQ 77


>gi|289523584|ref|ZP_06440438.1| smf protein [Anaerobaculum hydrogeniformans ATCC BAA-1850]
 gi|289503276|gb|EFD24440.1| smf protein [Anaerobaculum hydrogeniformans ATCC BAA-1850]
          Length = 374

 Score = 38.7 bits (89), Expect = 0.27,   Method: Composition-based stats.
 Identities = 12/85 (14%), Positives = 24/85 (28%), Gaps = 4/85 (4%)

Query: 4   PQIEQNFFSSQSDTNHTK---NINITHYPEYTQCERVRIKQSL-NNVPIHIDDIIHHTGI 59
           P I+ + F      +                      R+   L       +D+I     +
Sbjct: 276 PLIDVDSFVHLMKGSPEGFLVKGQSEVSLAELDDGERRVYGLLREKGDRTVDNISLECKM 335

Query: 60  EAPVVYLVLLELDLAGRLCHHPEGK 84
               V+  L +L+  G +     G+
Sbjct: 336 TPAQVFTTLTKLESRGLVSATGPGR 360


>gi|118463022|ref|YP_882921.1| smf family protein [Mycobacterium avium 104]
 gi|118164309|gb|ABK65206.1| smf family protein [Mycobacterium avium 104]
          Length = 388

 Score = 38.7 bits (89), Expect = 0.27,   Method: Composition-based stats.
 Identities = 9/64 (14%), Positives = 18/64 (28%), Gaps = 4/64 (6%)

Query: 23  INITHYPEYTQ---CERVRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLC 78
               H             R+ ++L       ++ +    G+        L  L+LAG + 
Sbjct: 309 AEEPHPVTPLDGLGEAERRVYEALPGRGAATVEQLAAGCGLLPEQALGPLAMLELAGLVR 368

Query: 79  HHPE 82
               
Sbjct: 369 RQDG 372


>gi|328544725|ref|YP_004304834.1| transcriptional regulator, DeoR family [polymorphum gilvum
          SL003B-26A1]
 gi|326414467|gb|ADZ71530.1| Transcriptional regulator, DeoR family [Polymorphum gilvum
          SL003B-26A1]
          Length = 253

 Score = 38.7 bits (89), Expect = 0.27,   Method: Composition-based stats.
 Identities = 12/64 (18%), Positives = 21/64 (32%), Gaps = 1/64 (1%)

Query: 31 YTQCERVRIKQSLNNVP-IHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTM 89
               + RI   L+  P + + ++     +    +   L E+   G L     G V    
Sbjct: 4  PKSVRQERILTELSQTPSLRVGELARRLDVSTETIRRDLDEMTEQGLLNRTYGGAVRSLS 63

Query: 90 HLPS 93
            PS
Sbjct: 64 TEPS 67


>gi|262191291|ref|ZP_06049485.1| rossmann fold nucleotide-binding protein Smf possibly involved in
           DNA uptake [Vibrio cholerae CT 5369-93]
 gi|262032829|gb|EEY51373.1| rossmann fold nucleotide-binding protein Smf possibly involved in
           DNA uptake [Vibrio cholerae CT 5369-93]
          Length = 371

 Score = 38.7 bits (89), Expect = 0.27,   Method: Composition-based stats.
 Identities = 12/49 (24%), Positives = 21/49 (42%)

Query: 38  RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
            +  ++      ID +   T I    + + LLEL+L G +   P G + 
Sbjct: 319 ELLANVGIEATPIDILASRTQIPVQDIMMQLLELELLGHVVAVPGGYIR 367


>gi|304317947|ref|YP_003853092.1| DeoR family transcriptional regulator [Thermoanaerobacterium
          thermosaccharolyticum DSM 571]
 gi|302779449|gb|ADL70008.1| transcriptional regulator, DeoR family [Thermoanaerobacterium
          thermosaccharolyticum DSM 571]
          Length = 274

 Score = 38.7 bits (89), Expect = 0.28,   Method: Composition-based stats.
 Identities = 11/57 (19%), Positives = 24/57 (42%), Gaps = 2/57 (3%)

Query: 36 RVRIKQSLNNV-PIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHL 91
          R++I + L+    + + ++    G+    +   L  L+L G +     G + L  H 
Sbjct: 7  RMKIAELLSKDKSMTVSELSEILGVSESTIRRDLRMLELDGFIQRTHGGAI-LNTHT 62


>gi|152970253|ref|YP_001335362.1| DeoR transcriptional regulator [Klebsiella pneumoniae subsp.
          pneumoniae MGH 78578]
 gi|238894746|ref|YP_002919480.1| putative DeoR family regulatory protein [Klebsiella pneumoniae
          NTUH-K2044]
 gi|262044264|ref|ZP_06017330.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
          rhinoscleromatis ATCC 13884]
 gi|330006126|ref|ZP_08305525.1| transcriptional regulator, DeoR family [Klebsiella sp. MS 92-3]
 gi|150955102|gb|ABR77132.1| putative bacterial regulatory protein, DeoR [Klebsiella
          pneumoniae subsp. pneumoniae MGH 78578]
 gi|238547062|dbj|BAH63413.1| putative DeoR-family bacterial regulatory protein [Klebsiella
          pneumoniae subsp. pneumoniae NTUH-K2044]
 gi|259038323|gb|EEW39528.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
          rhinoscleromatis ATCC 13884]
 gi|328535942|gb|EGF62364.1| transcriptional regulator, DeoR family [Klebsiella sp. MS 92-3]
          Length = 266

 Score = 38.7 bits (89), Expect = 0.28,   Method: Composition-based stats.
 Identities = 16/62 (25%), Positives = 26/62 (41%), Gaps = 4/62 (6%)

Query: 35 ERVR-IKQSLN-NVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHLP 92
          ER R I + L  +  + +++I   T +    +   L EL+  G L     G  +L    P
Sbjct: 5  ERHRLIVELLGQHGVMRVNEIAQATRVSRETIRRDLSELERKGILTRSHGG--ALAAENP 62

Query: 93 SP 94
           P
Sbjct: 63 LP 64


>gi|328905756|gb|EGG25532.1| DeoR family transcriptional regulator [Propionibacterium sp. P08]
          Length = 271

 Score = 38.7 bits (89), Expect = 0.28,   Method: Composition-based stats.
 Identities = 11/41 (26%), Positives = 22/41 (53%)

Query: 48 IHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
          + ++D++  TG+ A  +Y  L  L+ +G L  H    V++ 
Sbjct: 32 VSVEDLVEATGVSAMTIYRDLASLEASGVLQRHRGRVVAVA 72


>gi|260774552|ref|ZP_05883465.1| rossmann fold nucleotide-binding protein Smf possibly involved in
           DNA uptake [Vibrio metschnikovii CIP 69.14]
 gi|260610458|gb|EEX35664.1| rossmann fold nucleotide-binding protein Smf possibly involved in
           DNA uptake [Vibrio metschnikovii CIP 69.14]
          Length = 367

 Score = 38.7 bits (89), Expect = 0.28,   Method: Composition-based stats.
 Identities = 12/59 (20%), Positives = 23/59 (38%), Gaps = 3/59 (5%)

Query: 31  YTQCERVR---IKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
               E++    +  ++      +D +   T I    V + LLEL+L G +     G + 
Sbjct: 303 PNDEEQLPFPELLANVGVEATPVDILAQRTHIPVQEVMMQLLELELLGHVVAVSGGYIR 361


>gi|325068271|ref|ZP_08126944.1| DeoR family regulatory protein [Actinomyces oris K20]
          Length = 255

 Score = 38.7 bits (89), Expect = 0.29,   Method: Composition-based stats.
 Identities = 12/58 (20%), Positives = 22/58 (37%), Gaps = 1/58 (1%)

Query: 30 EYTQCERVRIKQSLNNVPIH-IDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
          E     R  I ++L+   +H +  +   TG+    +   L EL   G +     G + 
Sbjct: 3  ESPHDRRRTILRALSPTTVHSVQALSRLTGVSVITIRRDLAELAHEGLVTRVHGGALR 60


>gi|289674175|ref|ZP_06495065.1| putative IclR-family regulatory protein [Pseudomonas syringae pv.
          syringae FF5]
          Length = 246

 Score = 38.7 bits (89), Expect = 0.29,   Method: Composition-based stats.
 Identities = 8/62 (12%), Positives = 24/62 (38%), Gaps = 5/62 (8%)

Query: 34 CERVRIKQSL-----NNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
              R+   L      +  + + +++  TG+    +  +++ L+  G +    +G+  L 
Sbjct: 14 ASADRVLTVLSSFQIGDSALSLVELVERTGLIKSTIMRLMVSLETYGFVNRLADGRYMLA 73

Query: 89 MH 90
            
Sbjct: 74 SE 75


>gi|190151041|ref|YP_001969566.1| protein smf (DNA-processing chain A) [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
 gi|307264403|ref|ZP_07545989.1| hypothetical protein appser13_17940 [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
 gi|189916172|gb|ACE62424.1| Protein smf (DNA-processing chain A) [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
 gi|306870219|gb|EFN01977.1| hypothetical protein appser13_17940 [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
          Length = 384

 Score = 38.7 bits (89), Expect = 0.29,   Method: Composition-based stats.
 Identities = 18/83 (21%), Positives = 31/83 (37%)

Query: 4   PQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPV 63
           PQ  +N           K  ++          + +I   ++  PI IDD+   T +E   
Sbjct: 301 PQAVENAQFFTKADVPNKVNHLAKKLPELTDCQQQIVAHVSLEPISIDDLAKATALEVDT 360

Query: 64  VYLVLLELDLAGRLCHHPEGKVS 86
           + + LL L+L   +     G V 
Sbjct: 361 LLVELLGLELLSVIKQVSGGYVR 383


>gi|307130598|ref|YP_003882614.1| transcriptional repressor of the fructose operon, DeoR family
          [Dickeya dadantii 3937]
 gi|306528127|gb|ADM98057.1| Transcriptional repressor of the fructose operon, DeoR family
          [Dickeya dadantii 3937]
          Length = 258

 Score = 38.7 bits (89), Expect = 0.29,   Method: Composition-based stats.
 Identities = 13/47 (27%), Positives = 19/47 (40%)

Query: 48 IHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHLPSP 94
          +  D II H G+    V   +L+L+  G L     G V+       P
Sbjct: 20 VTTDHIIQHLGVSRETVRRDVLKLEAQGVLRRVHGGIVATGTEPEPP 66


>gi|254796757|ref|YP_003081593.1| DNA processing chain A [Neorickettsia risticii str. Illinois]
 gi|254590002|gb|ACT69364.1| DNA processing chain A [Neorickettsia risticii str. Illinois]
          Length = 375

 Score = 38.7 bits (89), Expect = 0.29,   Method: Composition-based stats.
 Identities = 12/52 (23%), Positives = 28/52 (53%)

Query: 36  RVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           + +I + +++  I +  + H  GI    + L ++EL++ G++      +VSL
Sbjct: 321 KAQILKKIDSTSIPMSQLAHELGISEKTLLLAIVELEIEGKVTRTIANEVSL 372


>gi|222530148|ref|YP_002574030.1| DNA protecting protein DprA [Caldicellulosiruptor bescii DSM 6725]
 gi|222456995|gb|ACM61257.1| DNA protecting protein DprA [Caldicellulosiruptor bescii DSM 6725]
          Length = 365

 Score = 38.7 bits (89), Expect = 0.29,   Method: Composition-based stats.
 Identities = 10/51 (19%), Positives = 25/51 (49%), Gaps = 1/51 (1%)

Query: 37  VRIKQSLN-NVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
            R+ + L+ N  +H++ +I  TG E   +  ++  L++  ++       +S
Sbjct: 313 KRLIKLLDENGEMHVESLIALTGWEPGKLASLITSLEIKSKVVRGRGNIIS 363


>gi|148272559|ref|YP_001222120.1| hypothetical protein CMM_1379 [Clavibacter michiganensis subsp.
           michiganensis NCPPB 382]
 gi|147830489|emb|CAN01424.1| conserved hypothetical protein [Clavibacter michiganensis subsp.
           michiganensis NCPPB 382]
          Length = 431

 Score = 38.7 bits (89), Expect = 0.30,   Method: Composition-based stats.
 Identities = 11/93 (11%), Positives = 22/93 (23%), Gaps = 19/93 (20%)

Query: 12  SSQSDTNHTKNINITHYPEYT------------QCERVRIKQSL----NNVPIHIDDIIH 55
            +++                                 VR+  +L          +     
Sbjct: 339 QARASEAPHAPSRAAPSAPDAARAGARTAEVRGDPRVVRVLDALAVRRGRETADV---AA 395

Query: 56  HTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
            +G+       VL  L+L G +     G V  +
Sbjct: 396 RSGLGLAETSSVLGMLELEGAVARPDGGWVRRS 428


>gi|330955155|gb|EGH55415.1| putative IclR family regulatory protein [Pseudomonas syringae Cit
          7]
          Length = 228

 Score = 38.7 bits (89), Expect = 0.30,   Method: Composition-based stats.
 Identities = 6/48 (12%), Positives = 22/48 (45%)

Query: 43 LNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMH 90
          + +  + + +++  TG+    +  +++ L+  G +    +G+  L   
Sbjct: 10 IGDSALSLVELVERTGLIKSTIMRLMVSLETYGFVNRLADGRYMLASE 57


>gi|312621559|ref|YP_004023172.1| DNA protecting protein dpra [Caldicellulosiruptor kronotskyensis
           2002]
 gi|312202026|gb|ADQ45353.1| DNA protecting protein DprA [Caldicellulosiruptor kronotskyensis
           2002]
          Length = 365

 Score = 38.7 bits (89), Expect = 0.30,   Method: Composition-based stats.
 Identities = 10/51 (19%), Positives = 25/51 (49%), Gaps = 1/51 (1%)

Query: 37  VRIKQSLN-NVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
            R+ + L+ N  +H++ +I  TG E   +  ++  L++  ++       +S
Sbjct: 313 KRLIKLLDENGEMHVESLIALTGWEPGKLASLITSLEIKAKVVRGRGNIIS 363


>gi|302872580|ref|YP_003841216.1| DNA protecting protein DprA [Caldicellulosiruptor obsidiansis OB47]
 gi|302575439|gb|ADL43230.1| DNA protecting protein DprA [Caldicellulosiruptor obsidiansis OB47]
          Length = 365

 Score = 38.7 bits (89), Expect = 0.31,   Method: Composition-based stats.
 Identities = 6/39 (15%), Positives = 20/39 (51%)

Query: 48  IHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
           +H++++I  TG +   +  ++  L++  ++       +S
Sbjct: 325 MHVENLIALTGWDPGKIASLITSLEIKSKVVRDRGNIIS 363


>gi|187479229|ref|YP_787254.1| IclR family transcriptional regulator [Bordetella avium 197N]
 gi|115423816|emb|CAJ50367.1| IclR-family transcriptional regulator [Bordetella avium 197N]
          Length = 272

 Score = 38.7 bits (89), Expect = 0.31,   Method: Composition-based stats.
 Identities = 14/73 (19%), Positives = 28/73 (38%), Gaps = 3/73 (4%)

Query: 22 NINITHYPEYTQCERV-RIKQSL--NNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLC 78
            +    P     +R  R+  +L     P+ + ++   TG+ A   + +L +L +   + 
Sbjct: 12 PSSDAGQPAIQVIDRAMRLLDALAAQPEPVTLKELSATTGLHASTAHRILNDLVIGRYVE 71

Query: 79 HHPEGKVSLTMHL 91
              G   L M L
Sbjct: 72 RVDNGLYQLGMRL 84


>gi|260886588|ref|ZP_05897851.1| DNA processing protein DprA [Selenomonas sputigena ATCC 35185]
 gi|260863731|gb|EEX78231.1| DNA processing protein DprA [Selenomonas sputigena ATCC 35185]
          Length = 370

 Score = 38.7 bits (89), Expect = 0.31,   Method: Composition-based stats.
 Identities = 12/62 (19%), Positives = 24/62 (38%), Gaps = 1/62 (1%)

Query: 21  KNINITHYPEYTQCERVRIKQSLNNVP-IHIDDIIHHTGIEAPVVYLVLLELDLAGRLCH 79
            +      P+    E   +   L+    + +D++I     +A  V  +LL L + G +  
Sbjct: 296 ASRTSASPPQELTEEEAAVYALLSREAALSLDELICRLQGKAANVAFLLLGLRVKGLVEE 355

Query: 80  HP 81
            P
Sbjct: 356 TP 357


>gi|322513217|ref|ZP_08066343.1| DNA-processing protein Smf [Actinobacillus ureae ATCC 25976]
 gi|322120993|gb|EFX92834.1| DNA-processing protein Smf [Actinobacillus ureae ATCC 25976]
          Length = 384

 Score = 38.7 bits (89), Expect = 0.31,   Method: Composition-based stats.
 Identities = 17/83 (20%), Positives = 31/83 (37%)

Query: 4   PQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPV 63
           PQ  +N           +  ++          + +I + +   PI IDD+   T +E   
Sbjct: 301 PQAVENAQFFAKANVPNRGNHLAKKLPEMTACQQQIVEHIGLDPISIDDLAKATSLEVET 360

Query: 64  VYLVLLELDLAGRLCHHPEGKVS 86
           + + LL L+L   +     G V 
Sbjct: 361 LLVELLGLELLSVIKQVNGGYVR 383


>gi|225619937|ref|YP_002721194.1| transcription-repair coupling factor [Brachyspira hyodysenteriae
          WA1]
 gi|225214756|gb|ACN83490.1| transcription-repair coupling factor [Brachyspira hyodysenteriae
          WA1]
          Length = 246

 Score = 38.7 bits (89), Expect = 0.31,   Method: Composition-based stats.
 Identities = 8/38 (21%), Positives = 17/38 (44%)

Query: 48 IHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
          I I+++I    +    +   L  L+ AG++     G +
Sbjct: 20 IKIEELIERLNVSEATIRRDLTFLEKAGKIRRVHGGAI 57


>gi|261406254|ref|YP_003242495.1| ArsR family transcriptional regulator [Paenibacillus sp. Y412MC10]
 gi|261282717|gb|ACX64688.1| transcriptional regulator, ArsR family [Paenibacillus sp. Y412MC10]
          Length = 305

 Score = 38.7 bits (89), Expect = 0.31,   Method: Composition-based stats.
 Identities = 12/76 (15%), Positives = 28/76 (36%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVV 64
            ++      + D +    + +         ER+R+ + + + P  + ++    G     +
Sbjct: 200 LLQYPIDIPEEDEDEPPVVLLRMTEALADPERLRLLRYIADEPKAVSEMASELGQPYEQL 259

Query: 65  YLVLLELDLAGRLCHH 80
              L+ L  AG L  H
Sbjct: 260 MHHLMILRAAGLLRSH 275


>gi|329851598|ref|ZP_08266355.1| iclR helix-turn-helix domain protein [Asticcacaulis biprosthecum
          C19]
 gi|328840444|gb|EGF90016.1| iclR helix-turn-helix domain protein [Asticcacaulis biprosthecum
          C19]
          Length = 259

 Score = 38.3 bits (88), Expect = 0.32,   Method: Composition-based stats.
 Identities = 11/55 (20%), Positives = 25/55 (45%), Gaps = 2/55 (3%)

Query: 39 IKQSLNNVP--IHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHL 91
          I + L+  P  + I ++    G     ++ V++ ++    L  HP  +  +T+ L
Sbjct: 29 ILELLSEFPRGLTITEMAGKLGFSVSEIFRVIMVMERLAWLRRHPGDRFRVTLRL 83


>gi|313111456|ref|ZP_07797258.1| putative Rossmann fold nucleotide-binding protein [Pseudomonas
           aeruginosa 39016]
 gi|310883760|gb|EFQ42354.1| putative Rossmann fold nucleotide-binding protein [Pseudomonas
           aeruginosa 39016]
          Length = 132

 Score = 38.3 bits (88), Expect = 0.33,   Method: Composition-based stats.
 Identities = 11/43 (25%), Positives = 18/43 (41%)

Query: 46  VPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
            P   + +   +G+  P V   L EL+L GR+       V  +
Sbjct: 89  APYTSEGLAAASGMTLPDVLATLSELELDGRVACEAGTWVHRS 131


>gi|284045125|ref|YP_003395465.1| DNA protecting protein DprA [Conexibacter woesei DSM 14684]
 gi|283949346|gb|ADB52090.1| DNA protecting protein DprA [Conexibacter woesei DSM 14684]
          Length = 366

 Score = 38.3 bits (88), Expect = 0.33,   Method: Composition-based stats.
 Identities = 8/71 (11%), Positives = 22/71 (30%), Gaps = 5/71 (7%)

Query: 18  NHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHT--GIEAPVVYLVLLELDLAG 75
                +           +   + + + +     D +   T  G+        L +L+L G
Sbjct: 296 ADAPRVPGNAVASGLPADLRALLERVGSG---QDTVAALTADGLPVDAALAGLAQLELRG 352

Query: 76  RLCHHPEGKVS 86
           ++     G+ +
Sbjct: 353 KVRRTTGGRYA 363


>gi|78044382|ref|YP_360615.1| putative DNA proccessing protein DprA [Carboxydothermus
           hydrogenoformans Z-2901]
 gi|77996497|gb|ABB15396.1| putative DNA proccessing protein DprA [Carboxydothermus
           hydrogenoformans Z-2901]
          Length = 358

 Score = 38.3 bits (88), Expect = 0.33,   Method: Composition-based stats.
 Identities = 9/50 (18%), Positives = 21/50 (42%)

Query: 38  RIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           +I + L N  + +++I +        V   +  L++ G +     GK + 
Sbjct: 308 KILEVLVNEDLTVEEIAYRLNARVSEVLREISFLEIKGFVKKQFGGKFTR 357


>gi|307246636|ref|ZP_07528707.1| hypothetical protein appser1_18320 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|307251006|ref|ZP_07532931.1| hypothetical protein appser4_17690 [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|307255621|ref|ZP_07537426.1| hypothetical protein appser9_18460 [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|307260072|ref|ZP_07541784.1| hypothetical protein appser11_18580 [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|306852508|gb|EFM84742.1| hypothetical protein appser1_18320 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|306856946|gb|EFM89077.1| hypothetical protein appser4_17690 [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|306861470|gb|EFM93459.1| hypothetical protein appser9_18460 [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|306865908|gb|EFM97784.1| hypothetical protein appser11_18580 [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
          Length = 384

 Score = 38.3 bits (88), Expect = 0.33,   Method: Composition-based stats.
 Identities = 18/83 (21%), Positives = 31/83 (37%)

Query: 4   PQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPV 63
           PQ  +N           K  ++          + +I   ++  PI IDD+   T +E   
Sbjct: 301 PQAVENAQFFTKADVPNKVNHLAKKLPELTACQQQIVAHISLEPISIDDLAKATSLEVET 360

Query: 64  VYLVLLELDLAGRLCHHPEGKVS 86
           + + LL L+L   +     G V 
Sbjct: 361 LLVELLGLELLSVIKQVSGGYVR 383


>gi|78189408|ref|YP_379746.1| SMF protein [Chlorobium chlorochromatii CaD3]
 gi|78171607|gb|ABB28703.1| SMF protein [Chlorobium chlorochromatii CaD3]
          Length = 385

 Score = 38.3 bits (88), Expect = 0.33,   Method: Composition-based stats.
 Identities = 17/84 (20%), Positives = 30/84 (35%), Gaps = 2/84 (2%)

Query: 3   HPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNN-VPIHIDDIIHHTGIEA 61
            P   +        T +      T           +I Q+L++  P HID +     ++ 
Sbjct: 299 QPHQAKPI-HPTKATANATTTTATTQLPLLNPLESQIYQALSSSDPTHIDTLAATLQLDL 357

Query: 62  PVVYLVLLELDLAGRLCHHPEGKV 85
             ++L L EL+L G +   P    
Sbjct: 358 STLFLHLFELELQGVIEQQPGQLF 381


>gi|32035463|ref|ZP_00135424.1| COG0758: Predicted Rossmann fold nucleotide-binding protein
           involved in DNA uptake [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|126209176|ref|YP_001054401.1| protein smf (DNA-processing chain A) [Actinobacillus
           pleuropneumoniae L20]
 gi|126097968|gb|ABN74796.1| Protein smf (DNA-processing chain A) [Actinobacillus
           pleuropneumoniae serovar 5b str. L20]
          Length = 384

 Score = 38.3 bits (88), Expect = 0.33,   Method: Composition-based stats.
 Identities = 18/83 (21%), Positives = 31/83 (37%)

Query: 4   PQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPV 63
           PQ  +N           K  ++          + +I   ++  PI IDD+   T +E   
Sbjct: 301 PQAVENAQFFTKADVPNKVNHLAKKLPELTACQQQIVAHISLEPISIDDLAKATSLEVET 360

Query: 64  VYLVLLELDLAGRLCHHPEGKVS 86
           + + LL L+L   +     G V 
Sbjct: 361 LLVELLGLELLSVIKQVSGGYVR 383


>gi|312137949|ref|YP_004005285.1| iclr family transcriptional regulator [Rhodococcus equi 103S]
 gi|311887288|emb|CBH46599.1| putative IclR family transcriptional regulator [Rhodococcus equi
          103S]
          Length = 268

 Score = 38.3 bits (88), Expect = 0.34,   Method: Composition-based stats.
 Identities = 11/69 (15%), Positives = 24/69 (34%), Gaps = 3/69 (4%)

Query: 19 HTKNINITHYPEYTQCER-VRIKQSLN--NVPIHIDDIIHHTGIEAPVVYLVLLELDLAG 75
           T           +  +R   I  +    +  + ++++   T +    V+ +L  L   G
Sbjct: 7  PTDISPTDRAVPPSMVDRMTVILDAFGGFSSRVPLEELARRTRLPRSTVHRILDSLLRLG 66

Query: 76 RLCHHPEGK 84
           + H P G 
Sbjct: 67 WVEHSPGGY 75


>gi|300691127|ref|YP_003752122.1| transcriptional regulatory, arsR family [Ralstonia solanacearum
          PSI07]
 gi|299078187|emb|CBJ50830.1| putative transcriptional regulatory, arsR family [Ralstonia
          solanacearum PSI07]
          Length = 122

 Score = 38.3 bits (88), Expect = 0.34,   Method: Composition-based stats.
 Identities = 12/62 (19%), Positives = 21/62 (33%)

Query: 32 TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHL 91
              R  +   L   P  + ++    G+  P V   L  L+ +G +     G+V      
Sbjct: 20 ADATRRSMLAQLTRGPASVSELARPLGMSLPAVMQHLAVLEHSGLVRSEKTGRVRTCRIE 79

Query: 92 PS 93
          P 
Sbjct: 80 PQ 81


>gi|229097286|ref|ZP_04228248.1| Transcriptional regulator, DeoR [Bacillus cereus Rock3-29]
 gi|229103375|ref|ZP_04234057.1| Transcriptional regulator, DeoR [Bacillus cereus Rock3-28]
 gi|229116283|ref|ZP_04245673.1| Transcriptional regulator, DeoR [Bacillus cereus Rock1-3]
 gi|228667115|gb|EEL22567.1| Transcriptional regulator, DeoR [Bacillus cereus Rock1-3]
 gi|228679871|gb|EEL34066.1| Transcriptional regulator, DeoR [Bacillus cereus Rock3-28]
 gi|228686097|gb|EEL40013.1| Transcriptional regulator, DeoR [Bacillus cereus Rock3-29]
          Length = 261

 Score = 38.3 bits (88), Expect = 0.34,   Method: Composition-based stats.
 Identities = 10/54 (18%), Positives = 21/54 (38%), Gaps = 1/54 (1%)

Query: 36 RVRIKQSLNNVP-IHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
          R +I + L+    + + D+     +    +   L  ++  G L     G + LT
Sbjct: 7  REKILELLSTDGRVIVKDLAERFDMSIDSIRRDLSIMEKDGLLKRTHGGAIELT 60


>gi|13542034|ref|NP_111722.1| hypothetical protein TVN1203 [Thermoplasma volcanium GSS1]
 gi|14325464|dbj|BAB60368.1| TVG1262718 [Thermoplasma volcanium GSS1]
          Length = 167

 Score = 38.3 bits (88), Expect = 0.34,   Method: Composition-based stats.
 Identities = 8/34 (23%), Positives = 17/34 (50%)

Query: 51  DDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGK 84
           + ++  +G+ AP V  +L  L+  G +    +G 
Sbjct: 121 NVLVRESGLSAPTVSRILFSLENYGLIERQRKGM 154


>gi|253687931|ref|YP_003017121.1| transcriptional regulator, DeoR family [Pectobacterium
          carotovorum subsp. carotovorum PC1]
 gi|251754509|gb|ACT12585.1| transcriptional regulator, DeoR family [Pectobacterium
          carotovorum subsp. carotovorum PC1]
          Length = 256

 Score = 38.3 bits (88), Expect = 0.34,   Method: Composition-based stats.
 Identities = 15/58 (25%), Positives = 25/58 (43%), Gaps = 2/58 (3%)

Query: 37 VRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHLPSP 94
            +  +LN   +  + II H G+    V   +++L+ AG L     G V+ T     P
Sbjct: 11 QALLSTLNR--VSTEKIIQHLGVSRETVRRDIVKLEAAGVLRRVHGGIVATTQEPEPP 66


>gi|188535540|ref|YP_001909337.1| Transcriptional regulator, DeoR family [Erwinia tasmaniensis
          Et1/99]
 gi|188030582|emb|CAO98477.1| Transcriptional regulator, DeoR family [Erwinia tasmaniensis
          Et1/99]
          Length = 258

 Score = 38.3 bits (88), Expect = 0.34,   Method: Composition-based stats.
 Identities = 15/59 (25%), Positives = 22/59 (37%), Gaps = 1/59 (1%)

Query: 37 VRIKQSLN-NVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHLPSP 94
           RI+  L+    I  + II   GI        ++EL+  G       G V+L      P
Sbjct: 8  HRIRALLSTFSRIGTEQIIKELGISRETARRDIIELEAQGLAKRVHGGLVALDTAPEPP 66


>gi|223936550|ref|ZP_03628461.1| ribonuclease R [bacterium Ellin514]
 gi|223894714|gb|EEF61164.1| ribonuclease R [bacterium Ellin514]
          Length = 740

 Score = 38.3 bits (88), Expect = 0.34,   Method: Composition-based stats.
 Identities = 11/58 (18%), Positives = 20/58 (34%), Gaps = 6/58 (10%)

Query: 36 RVRIKQSLN---NVPIHIDDIIHHTGIEA---PVVYLVLLELDLAGRLCHHPEGKVSL 87
            +I +        PI+I  ++    +     P V   L  L+  GR+      +  L
Sbjct: 2  EDKILKLFGQPDYTPINISQLMRRLKLAPNDKPEVEKRLARLEREGRIARIKGNRFIL 59


>gi|318041930|ref|ZP_07973886.1| regulatory proteins, ArsR family protein [Synechococcus sp.
          CB0101]
          Length = 101

 Score = 38.3 bits (88), Expect = 0.34,   Method: Composition-based stats.
 Identities = 12/51 (23%), Positives = 26/51 (50%)

Query: 33 QCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEG 83
          +  R+ + ++L   P+++  ++  T +   +V   L  L +AG +   PEG
Sbjct: 13 EPNRLAVLEALRGGPLNVTAVVEKTALSQALVSKHLKLLTIAGVVQRRPEG 63


>gi|312876485|ref|ZP_07736468.1| DNA protecting protein DprA [Caldicellulosiruptor lactoaceticus 6A]
 gi|311796696|gb|EFR13042.1| DNA protecting protein DprA [Caldicellulosiruptor lactoaceticus 6A]
          Length = 365

 Score = 38.3 bits (88), Expect = 0.34,   Method: Composition-based stats.
 Identities = 9/50 (18%), Positives = 25/50 (50%), Gaps = 1/50 (2%)

Query: 38  RIKQSLN-NVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
           R+ + L+ N  +H++ +I  TG +   +  ++  L++  ++       +S
Sbjct: 314 RLIKLLDENGEMHMESLIALTGWDPGKIASLITSLEIKSKVVRTRGNIIS 363


>gi|296125638|ref|YP_003632890.1| DeoR family transcriptional regulator [Brachyspira murdochii DSM
          12563]
 gi|296017454|gb|ADG70691.1| transcriptional regulator, DeoR family [Brachyspira murdochii DSM
          12563]
          Length = 247

 Score = 38.3 bits (88), Expect = 0.34,   Method: Composition-based stats.
 Identities = 9/38 (23%), Positives = 17/38 (44%)

Query: 48 IHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
          I I+++I    +    +   L  L+ AG++     G V
Sbjct: 20 IKIEELIERLNVSEATIRRDLTFLEEAGKIKRVHGGAV 57


>gi|41409059|ref|NP_961895.1| hypothetical protein MAP2961c [Mycobacterium avium subsp.
           paratuberculosis K-10]
 gi|41397418|gb|AAS05278.1| hypothetical protein MAP_2961c [Mycobacterium avium subsp.
           paratuberculosis K-10]
          Length = 388

 Score = 38.3 bits (88), Expect = 0.34,   Method: Composition-based stats.
 Identities = 9/64 (14%), Positives = 18/64 (28%), Gaps = 4/64 (6%)

Query: 23  INITHYPEYTQ---CERVRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLC 78
               H             R+ ++L       ++ +    G+        L  L+LAG + 
Sbjct: 309 AEEPHPVTPLDGLGEAERRVYEALPGRGAATVEQLAAGCGLLPEQALGPLAMLELAGLVR 368

Query: 79  HHPE 82
               
Sbjct: 369 RQDG 372


>gi|299136024|ref|ZP_07029208.1| transcriptional regulator, IclR family [Acidobacterium sp.
          MP5ACTX8]
 gi|298602148|gb|EFI58302.1| transcriptional regulator, IclR family [Acidobacterium sp.
          MP5ACTX8]
          Length = 273

 Score = 38.3 bits (88), Expect = 0.35,   Method: Composition-based stats.
 Identities = 12/78 (15%), Positives = 29/78 (37%), Gaps = 2/78 (2%)

Query: 14 QSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHID--DIIHHTGIEAPVVYLVLLEL 71
          ++      N    +Y      + + + + L + P  +    +          ++ +LL L
Sbjct: 5  RTAKAAVTNEKTLNYATPALEKGLDVLELLAHQPAGLTKSQMARELNRTVSEIFRMLLCL 64

Query: 72 DLAGRLCHHPEGKVSLTM 89
          +  G +    E + SLT+
Sbjct: 65 ERRGYIAQLAEDRYSLTL 82


>gi|209884137|ref|YP_002287994.1| transcriptional regulator, IclR family [Oligotropha
          carboxidovorans OM5]
 gi|209872333|gb|ACI92129.1| transcriptional regulator, IclR family [Oligotropha
          carboxidovorans OM5]
          Length = 249

 Score = 38.3 bits (88), Expect = 0.35,   Method: Composition-based stats.
 Identities = 9/51 (17%), Positives = 24/51 (47%), Gaps = 2/51 (3%)

Query: 39 IKQSL--NNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
          I +++  +  P  + +I   T +    +  +L+ L+  G +    +G+ +L
Sbjct: 23 IVEAVEASAEPQTLAEIAQRTDLYKSTILRLLVTLEGRGLIVRWSDGRYAL 73


>gi|330839578|ref|YP_004414158.1| DNA protecting protein DprA [Selenomonas sputigena ATCC 35185]
 gi|329747342|gb|AEC00699.1| DNA protecting protein DprA [Selenomonas sputigena ATCC 35185]
          Length = 364

 Score = 38.3 bits (88), Expect = 0.36,   Method: Composition-based stats.
 Identities = 12/62 (19%), Positives = 24/62 (38%), Gaps = 1/62 (1%)

Query: 21  KNINITHYPEYTQCERVRIKQSLNNVP-IHIDDIIHHTGIEAPVVYLVLLELDLAGRLCH 79
            +      P+    E   +   L+    + +D++I     +A  V  +LL L + G +  
Sbjct: 290 ASRTSASPPQELTEEEAAVYALLSREAALSLDELICRLQGKAANVAFLLLGLRVKGLVEE 349

Query: 80  HP 81
            P
Sbjct: 350 TP 351


>gi|260424749|ref|ZP_05733144.2| DNA processing protein DprA [Dialister invisus DSM 15470]
 gi|260403042|gb|EEW96589.1| DNA processing protein DprA [Dialister invisus DSM 15470]
          Length = 363

 Score = 38.3 bits (88), Expect = 0.36,   Method: Composition-based stats.
 Identities = 12/59 (20%), Positives = 24/59 (40%), Gaps = 1/59 (1%)

Query: 28  YPEYTQCERVRIKQ-SLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
            PE    E   + +       +  +DI+  +G+    + ++LL L L G +     G+ 
Sbjct: 299 SPEQLTLEEEVVYRFCCTGEEVTAEDILQQSGMSVMKITMLLLRLQLKGFIKETGSGRF 357


>gi|255530594|ref|YP_003090966.1| regulatory protein DeoR [Pedobacter heparinus DSM 2366]
 gi|255343578|gb|ACU02904.1| regulatory protein DeoR [Pedobacter heparinus DSM 2366]
          Length = 247

 Score = 38.3 bits (88), Expect = 0.36,   Method: Composition-based stats.
 Identities = 14/64 (21%), Positives = 25/64 (39%), Gaps = 3/64 (4%)

Query: 35 ERVR--IKQSLN-NVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHL 91
          E  +  I   ++    +H  D+     +    V   L +L+  G+L     G +S + H 
Sbjct: 4  EERQNYILNQISIYSKVHTSDLCAALDVSLDTVRRDLSDLENEGKLVKVHGGAISKSFHY 63

Query: 92 PSPQ 95
          P  Q
Sbjct: 64 PFQQ 67


>gi|239616979|ref|YP_002940301.1| transcriptional regulator, ArsR family [Kosmotoga olearia TBF
           19.5.1]
 gi|239505810|gb|ACR79297.1| transcriptional regulator, ArsR family [Kosmotoga olearia TBF
           19.5.1]
          Length = 352

 Score = 38.3 bits (88), Expect = 0.36,   Method: Composition-based stats.
 Identities = 10/46 (21%), Positives = 19/46 (41%)

Query: 33  QCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLC 78
              R  I ++L+  P ++D++    G+    +   L  L   G L 
Sbjct: 273 DPTRFMIIKALSERPKYVDELAAFCGLSKATISHHLSYLQSLGLLE 318


>gi|163855233|ref|YP_001629531.1| IclR family transcriptional regulator [Bordetella petrii DSM
          12804]
 gi|163258961|emb|CAP41260.1| transcriptional regulator, IclR family [Bordetella petrii]
          Length = 283

 Score = 38.3 bits (88), Expect = 0.36,   Method: Composition-based stats.
 Identities = 16/83 (19%), Positives = 29/83 (34%), Gaps = 6/83 (7%)

Query: 15 SDTNHTKNINITHYPEYTQC---ERV-RIKQSLN--NVPIHIDDIIHHTGIEAPVVYLVL 68
          S T    +               ER  R+  +L     P+ + ++   TG+ A   + +L
Sbjct: 2  SATAPGSDSEHAPGQSPIAIQVIERAMRLLDALAAHPDPVTLKELSATTGLHASTAHRIL 61

Query: 69 LELDLAGRLCHHPEGKVSLTMHL 91
           +L +   +     G   L M L
Sbjct: 62 NDLVVGRYVERVDNGLYQLGMRL 84


>gi|206895407|ref|YP_002246584.1| transcriptional regulator of sugar metabolism [Coprothermobacter
          proteolyticus DSM 5265]
 gi|206738024|gb|ACI17102.1| transcriptional regulator of sugar metabolism [Coprothermobacter
          proteolyticus DSM 5265]
          Length = 258

 Score = 38.3 bits (88), Expect = 0.36,   Method: Composition-based stats.
 Identities = 11/61 (18%), Positives = 26/61 (42%), Gaps = 3/61 (4%)

Query: 36 RVRIKQSLNNV-PIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV--SLTMHLP 92
          R +I + +++   + ++++     +    V   L  L+  G L     G +   L+ + P
Sbjct: 8  RQKILEVVSSGKAVTVEELSRILDVSPSTVRRDLRFLESKGLLYRTHGGAMPPVLSSYEP 67

Query: 93 S 93
          S
Sbjct: 68 S 68


>gi|154509162|ref|ZP_02044804.1| hypothetical protein ACTODO_01683 [Actinomyces odontolyticus ATCC
           17982]
 gi|153798796|gb|EDN81216.1| hypothetical protein ACTODO_01683 [Actinomyces odontolyticus ATCC
           17982]
          Length = 386

 Score = 38.3 bits (88), Expect = 0.36,   Method: Composition-based stats.
 Identities = 12/71 (16%), Positives = 28/71 (39%), Gaps = 8/71 (11%)

Query: 22  NINITHYPEYTQCERVRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLC-- 78
            ++  H  +  +  + R+ ++L  + P  ++ I     +    V   L+EL +AG +   
Sbjct: 315 PVDDDHGVDALEPTQRRVWEALPRSAPASVEAICVAAALSREEVNYALMELSVAGLVAGS 374

Query: 79  -----HHPEGK 84
                    G+
Sbjct: 375 TRGWTRTGGGR 385


>gi|20977189|gb|AAM33317.1|AF503595_1 putative regulatory protein [Erwinia chrysanthemi]
          Length = 257

 Score = 38.3 bits (88), Expect = 0.37,   Method: Composition-based stats.
 Identities = 13/47 (27%), Positives = 19/47 (40%)

Query: 48 IHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHLPSP 94
          +  D II H G+    V   +L+L+  G L     G V+       P
Sbjct: 20 VTTDHIIQHLGVSRETVRRDVLKLEAQGVLRRVHGGIVATGTEPEPP 66


>gi|332158519|ref|YP_004423798.1| ArsR family transcriptional regulator [Pyrococcus sp. NA2]
 gi|331033982|gb|AEC51794.1| ArsR family transcriptional regulator [Pyrococcus sp. NA2]
          Length = 185

 Score = 38.3 bits (88), Expect = 0.37,   Method: Composition-based stats.
 Identities = 10/46 (21%), Positives = 22/46 (47%)

Query: 33 QCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLC 78
             R++I + L + P+ + +I    G +   +Y  +  L+ AG + 
Sbjct: 20 DPTRMKILELLRSHPMSVAEIAEKLGKDKSTIYRHIRALEEAGLVE 65


>gi|293189842|ref|ZP_06608556.1| DNA protecting protein DprA [Actinomyces odontolyticus F0309]
 gi|292821257|gb|EFF80202.1| DNA protecting protein DprA [Actinomyces odontolyticus F0309]
          Length = 386

 Score = 38.3 bits (88), Expect = 0.37,   Method: Composition-based stats.
 Identities = 12/71 (16%), Positives = 28/71 (39%), Gaps = 8/71 (11%)

Query: 22  NINITHYPEYTQCERVRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLC-- 78
            ++  H  +  +  + R+ ++L  + P  ++ I     +    V   L+EL +AG +   
Sbjct: 315 PVDDDHGVDALEPTQRRVWEALPRSAPASVEAICVAAALSREEVNYALMELSVAGLVAGS 374

Query: 79  -----HHPEGK 84
                    G+
Sbjct: 375 TRGWTRTGGGR 385


>gi|329921987|ref|ZP_08277794.1| transcriptional regulator, ArsR family [Paenibacillus sp. HGF5]
 gi|328942447|gb|EGG38710.1| transcriptional regulator, ArsR family [Paenibacillus sp. HGF5]
          Length = 305

 Score = 38.3 bits (88), Expect = 0.38,   Method: Composition-based stats.
 Identities = 12/76 (15%), Positives = 28/76 (36%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVV 64
            ++      + D +    + +         ER+R+ + + + P  + ++    G     +
Sbjct: 200 LLQYPIDIPEEDEDEPPVVLLRMTEALADPERLRLLRYIADEPKAVSEMASELGQPYEQL 259

Query: 65  YLVLLELDLAGRLCHH 80
              L+ L  AG L  H
Sbjct: 260 MHHLMILRAAGLLRSH 275


>gi|330901371|gb|EGH32790.1| putative IclR family regulatory protein [Pseudomonas syringae pv.
          japonica str. M301072PT]
 gi|330982865|gb|EGH80968.1| putative IclR family regulatory protein [Pseudomonas syringae pv.
          aptata str. DSM 50252]
          Length = 228

 Score = 38.3 bits (88), Expect = 0.40,   Method: Composition-based stats.
 Identities = 6/48 (12%), Positives = 22/48 (45%)

Query: 43 LNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMH 90
          + +  + + +++  TG+    +  +++ L+  G +    +G+  L   
Sbjct: 10 IGDSALSLVELVERTGLIKSTIMRLMVSLETYGFVNRLADGRYMLASE 57


>gi|240170585|ref|ZP_04749244.1| hypothetical protein MkanA1_14825 [Mycobacterium kansasii ATCC
           12478]
          Length = 388

 Score = 38.3 bits (88), Expect = 0.40,   Method: Composition-based stats.
 Identities = 9/52 (17%), Positives = 18/52 (34%), Gaps = 1/52 (1%)

Query: 32  TQCERVRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPE 82
                 R+ ++L       +D+I   +G+    V   L  L++ G       
Sbjct: 318 LSEAERRVYEALPGRGAATVDEIAAASGLLPEQVLGQLAILEVTGLARRDDG 369


>gi|228908507|ref|ZP_04072348.1| Transcriptional regulator, DeoR [Bacillus thuringiensis IBL 200]
 gi|228851154|gb|EEM95967.1| Transcriptional regulator, DeoR [Bacillus thuringiensis IBL 200]
          Length = 261

 Score = 38.3 bits (88), Expect = 0.40,   Method: Composition-based stats.
 Identities = 11/54 (20%), Positives = 20/54 (37%), Gaps = 1/54 (1%)

Query: 36 RVRIKQSLNNVPIHI-DDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
          R +I + L+     I  D+     +    +   L  ++  G L     G + LT
Sbjct: 7  REKILELLSTDGRVIAKDLAERFDMSIDSIRRDLSIMEKDGLLQRTHGGAIELT 60


>gi|154150697|ref|YP_001404315.1| 4-vinyl reductase, 4VR [Candidatus Methanoregula boonei 6A8]
 gi|153999249|gb|ABS55672.1| 4-vinyl reductase, 4VR [Methanoregula boonei 6A8]
          Length = 267

 Score = 38.3 bits (88), Expect = 0.40,   Method: Composition-based stats.
 Identities = 10/66 (15%), Positives = 20/66 (30%)

Query: 12 SSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLEL 71
             +          +         R +I   L    +  D+I+  +G     V + L  L
Sbjct: 12 RPDATPAVGLFATPSGIRAVQSPARAKILSVLAEHELPFDEIVRQSGKAKSTVSVQLQGL 71

Query: 72 DLAGRL 77
          +  G +
Sbjct: 72 EHEGII 77


>gi|86356084|ref|YP_467976.1| ArsR family transcriptional regulator [Rhizobium etli CFN 42]
 gi|86280186|gb|ABC89249.1| probable transcriptional regulator protein, ArsR family
          [Rhizobium etli CFN 42]
          Length = 129

 Score = 38.3 bits (88), Expect = 0.40,   Method: Composition-based stats.
 Identities = 11/47 (23%), Positives = 17/47 (36%)

Query: 33 QCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCH 79
             R +I   L+   +   +I     I  P V   L  L+ AG +  
Sbjct: 35 SAPRRKILAYLSASGLTAGEIAERFSISKPAVSQHLSILETAGLIRR 81


>gi|218461389|ref|ZP_03501480.1| transcriptional regulator, ArsR family protein [Rhizobium etli
          Kim 5]
          Length = 121

 Score = 38.3 bits (88), Expect = 0.40,   Method: Composition-based stats.
 Identities = 10/47 (21%), Positives = 17/47 (36%)

Query: 33 QCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCH 79
             R +I   L+   +   +I     +  P V   L  L+ AG +  
Sbjct: 27 SAPRRKILAYLSASGLTAGEIADRFNMSKPAVSQHLSILETAGLIRR 73


>gi|262197810|ref|YP_003269019.1| SMF family protein [Haliangium ochraceum DSM 14365]
 gi|262081157|gb|ACY17126.1| SMF family protein [Haliangium ochraceum DSM 14365]
          Length = 297

 Score = 38.3 bits (88), Expect = 0.41,   Method: Composition-based stats.
 Identities = 8/42 (19%), Positives = 15/42 (35%)

Query: 48  IHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTM 89
           +  D +    G+ A      L+ L+L G     P    + + 
Sbjct: 248 LDPDQLAERAGLSARACARALIGLELCGLAVAMPGQSYARST 289


>gi|313898783|ref|ZP_07832317.1| transcriptional regulator, DeoR family [Clostridium sp. HGF2]
 gi|312956365|gb|EFR37999.1| transcriptional regulator, DeoR family [Clostridium sp. HGF2]
          Length = 253

 Score = 38.3 bits (88), Expect = 0.41,   Method: Composition-based stats.
 Identities = 10/44 (22%), Positives = 20/44 (45%)

Query: 48 IHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHL 91
          IH+ D+     I    +   L+EL+  G++     G V  +++ 
Sbjct: 20 IHVRDVAKQLNISETTIRRDLMELEQEGKVRRVHGGAVRESLNQ 63


>gi|229587598|ref|YP_002869717.1| hypothetical protein PFLU0020 [Pseudomonas fluorescens SBW25]
 gi|229359464|emb|CAY46305.1| conserved SMF-related protein [Pseudomonas fluorescens SBW25]
          Length = 364

 Score = 38.3 bits (88), Expect = 0.41,   Method: Composition-based stats.
 Identities = 9/63 (14%), Positives = 19/63 (30%)

Query: 25  ITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGK 84
                         +   L+  P   + +   +G     V   L EL+L G++       
Sbjct: 301 QALSRPTPMPVVHPLVALLHAAPHTSEGLAIASGRSLSHVLATLTELELEGQVICESGRW 360

Query: 85  VSL 87
           ++ 
Sbjct: 361 LAR 363


>gi|227496302|ref|ZP_03926598.1| DNA-binding transcriptional regulator [Actinomyces urogenitalis
          DSM 15434]
 gi|226834171|gb|EEH66554.1| DNA-binding transcriptional regulator [Actinomyces urogenitalis
          DSM 15434]
          Length = 244

 Score = 38.3 bits (88), Expect = 0.41,   Method: Composition-based stats.
 Identities = 8/51 (15%), Positives = 16/51 (31%), Gaps = 1/51 (1%)

Query: 32 TQCERVRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHP 81
              R R+   +    P+    +     +    V   L  L+ +G +  H 
Sbjct: 6  DDSTRARVLDLIVEKGPVSAAQLARVLDLTPAAVRRHLTALEESGEIQVHA 56


>gi|332300411|ref|YP_004442332.1| DNA protecting protein DprA [Porphyromonas asaccharolytica DSM
           20707]
 gi|332177474|gb|AEE13164.1| DNA protecting protein DprA [Porphyromonas asaccharolytica DSM
           20707]
          Length = 384

 Score = 38.3 bits (88), Expect = 0.42,   Method: Composition-based stats.
 Identities = 12/58 (20%), Positives = 21/58 (36%), Gaps = 2/58 (3%)

Query: 32  TQCERVRIKQSL--NNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
            + E   +   L  +   + ID     T +    V   L  L+  G +   P+G+  L
Sbjct: 325 LEPETRSLLDLLIESGDGLSIDAFCDQTLMGVDEVSFRLFLLESEGAVSLQPDGRYKL 382


>gi|119962262|ref|YP_946571.1| ArsR family transcriptional regulator [Arthrobacter aurescens
          TC1]
 gi|119949121|gb|ABM08032.1| putative transcriptional regulator, ArsR family [Arthrobacter
          aurescens TC1]
          Length = 216

 Score = 38.3 bits (88), Expect = 0.42,   Method: Composition-based stats.
 Identities = 11/56 (19%), Positives = 17/56 (30%), Gaps = 1/56 (1%)

Query: 23 INITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLC 78
           +           R RI Q L+  P     +    G+    V   L  L+  G + 
Sbjct: 8  EDPAAAEASLDPIRTRILQELS-EPASATQLAAKVGLPRQKVNYHLKSLERHGLVE 62


>gi|271963352|ref|YP_003337548.1| hydroxyneurosporene-O-methyltransferase [Streptosporangium roseum
          DSM 43021]
 gi|270506527|gb|ACZ84805.1| hydroxyneurosporene-O-methyltransferase [Streptosporangium roseum
          DSM 43021]
          Length = 334

 Score = 37.9 bits (87), Expect = 0.42,   Method: Composition-based stats.
 Identities = 10/48 (20%), Positives = 20/48 (41%)

Query: 41 QSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
            L + P+ ++++    G +   +  VL +L   G +     G   LT
Sbjct: 31 DHLKDGPLSVEELAVRCGADPAALGRVLRQLAAMGMVATAAAGTYELT 78


>gi|86741982|ref|YP_482382.1| putative transcriptional regulator [Frankia sp. CcI3]
 gi|86568844|gb|ABD12653.1| putative transcriptional regulator [Frankia sp. CcI3]
          Length = 478

 Score = 37.9 bits (87), Expect = 0.42,   Method: Composition-based stats.
 Identities = 10/63 (15%), Positives = 18/63 (28%)

Query: 20  TKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCH 79
                +            R+ Q+L      + D+    G+ AP +   L  L   G +  
Sbjct: 404 ATATPVATAEPPLGATERRVYQALTRQGRTVSDLAEELGLSAPNIRKALRNLRGRGLILQ 463

Query: 80  HPE 82
              
Sbjct: 464 LGG 466


>gi|229179052|ref|ZP_04306409.1| Transcriptional regulator, DeoR [Bacillus cereus 172560W]
 gi|228604420|gb|EEK61884.1| Transcriptional regulator, DeoR [Bacillus cereus 172560W]
          Length = 261

 Score = 37.9 bits (87), Expect = 0.43,   Method: Composition-based stats.
 Identities = 12/54 (22%), Positives = 20/54 (37%), Gaps = 1/54 (1%)

Query: 36 RVRIKQSLNNVPIHI-DDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
          R RI + LN     I  ++     +    +   L  ++  G L     G + LT
Sbjct: 7  RERILELLNTDGRVIAKELAERFDMSIDSIRRDLSIMEKDGLLKRTHGGAIELT 60


>gi|308234477|ref|ZP_07665214.1| DNA protecting protein DprA [Atopobium vaginae DSM 15829]
 gi|328944070|ref|ZP_08241535.1| DNA protecting protein DprA [Atopobium vaginae DSM 15829]
 gi|327492039|gb|EGF23813.1| DNA protecting protein DprA [Atopobium vaginae DSM 15829]
          Length = 340

 Score = 37.9 bits (87), Expect = 0.44,   Method: Composition-based stats.
 Identities = 10/57 (17%), Positives = 22/57 (38%)

Query: 30  EYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
           E  +    +I  +L   P+  DD+      +   +   L + +  G +    +G+ S
Sbjct: 267 ESLKPHLGKIMSALFANPMRADDLAQQLDEKIITILSTLGDFEAQGLVKRLIDGRFS 323


>gi|328955540|ref|YP_004372873.1| DeoR family transcriptional regulator [Coriobacterium glomerans
          PW2]
 gi|328455864|gb|AEB07058.1| transcriptional regulator, DeoR family [Coriobacterium glomerans
          PW2]
          Length = 270

 Score = 37.9 bits (87), Expect = 0.44,   Method: Composition-based stats.
 Identities = 15/62 (24%), Positives = 27/62 (43%), Gaps = 4/62 (6%)

Query: 36 RVRIKQSLNNVP-IHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV---SLTMHL 91
          R RI + L +   + + D+    G+    +   L +LD AG L     G V   ++ +  
Sbjct: 21 RNRILELLASESRVLVGDLSMRFGVSPATLRNDLRDLDAAGLLRRTHGGAVVREAVAVEQ 80

Query: 92 PS 93
          P+
Sbjct: 81 PA 82


>gi|257063753|ref|YP_003143425.1| DNA protecting protein DprA [Slackia heliotrinireducens DSM 20476]
 gi|256791406|gb|ACV22076.1| DNA protecting protein DprA [Slackia heliotrinireducens DSM 20476]
          Length = 319

 Score = 37.9 bits (87), Expect = 0.45,   Method: Composition-based stats.
 Identities = 12/52 (23%), Positives = 24/52 (46%), Gaps = 4/52 (7%)

Query: 38  RIKQSLNNVPIHIDDIIHHT----GIEAPVVYLVLLELDLAGRLCHHPEGKV 85
            + +SL   P+ +D+II       G     +   + EL+  G +  +P+G+ 
Sbjct: 265 EVFRSLEANPMRMDEIIEKCSEGVGQGPQGIVKAIAELEARGVVERYPDGRF 316


>gi|116696149|ref|YP_841725.1| IclR family transcriptional regulator [Ralstonia eutropha H16]
 gi|113530648|emb|CAJ96995.1| transcriptional regulator, IclR-family [Ralstonia eutropha H16]
          Length = 249

 Score = 37.9 bits (87), Expect = 0.45,   Method: Composition-based stats.
 Identities = 8/46 (17%), Positives = 21/46 (45%)

Query: 42 SLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
           L +  + + ++   +G+    +  +L  L+ AG +    +G+  L
Sbjct: 34 RLGDTALGLAELAQRSGLYKSTLLRLLASLEHAGLVRRQSDGRYGL 79


>gi|289764615|ref|ZP_06523993.1| smf protein [Fusobacterium sp. D11]
 gi|289716170|gb|EFD80182.1| smf protein [Fusobacterium sp. D11]
          Length = 288

 Score = 37.9 bits (87), Expect = 0.45,   Method: Composition-based stats.
 Identities = 10/48 (20%), Positives = 22/48 (45%), Gaps = 1/48 (2%)

Query: 39  IKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
           I   L++   ++D I+  T I+   +   L+ L++ G +     G+  
Sbjct: 239 ILNCLSSE-KNLDGILAETKIKETEILAELMTLEIMGVIKSITGGRYK 285


>gi|260494674|ref|ZP_05814804.1| DNA protecting protein DprA [Fusobacterium sp. 3_1_33]
 gi|260197836|gb|EEW95353.1| DNA protecting protein DprA [Fusobacterium sp. 3_1_33]
          Length = 288

 Score = 37.9 bits (87), Expect = 0.45,   Method: Composition-based stats.
 Identities = 10/48 (20%), Positives = 22/48 (45%), Gaps = 1/48 (2%)

Query: 39  IKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
           I   L++   ++D I+  T I+   +   L+ L++ G +     G+  
Sbjct: 239 ILNCLSSE-KNLDGILAETKIKETEILAELMTLEIMGVIKSITGGRYK 285


>gi|256026614|ref|ZP_05440448.1| Smf protein [Fusobacterium sp. D11]
          Length = 284

 Score = 37.9 bits (87), Expect = 0.45,   Method: Composition-based stats.
 Identities = 10/48 (20%), Positives = 22/48 (45%), Gaps = 1/48 (2%)

Query: 39  IKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
           I   L++   ++D I+  T I+   +   L+ L++ G +     G+  
Sbjct: 235 ILNCLSSE-KNLDGILAETKIKETEILAELMTLEIMGVIKSITGGRYK 281


>gi|269838140|ref|YP_003320368.1| putative transcriptional regulator [Sphaerobacter thermophilus
          DSM 20745]
 gi|269787403|gb|ACZ39546.1| putative transcriptional regulator [Sphaerobacter thermophilus
          DSM 20745]
          Length = 244

 Score = 37.9 bits (87), Expect = 0.45,   Method: Composition-based stats.
 Identities = 14/80 (17%), Positives = 24/80 (30%), Gaps = 4/80 (5%)

Query: 15 SDTNHTKNINITHYPEYTQCERVRIKQSLN-NVPIHIDDIIHHTGIEAPVVYLVLLELDL 73
          S  +                 R +I  +L  +  +  D +    GI A  V   L  L+ 
Sbjct: 13 SSRHAGTPEPPLGTQAPRGATRRKILTTLKKSDGLTADQLAALLGITAMAVRKHLTALER 72

Query: 74 AGRLCHHPEGKVSLTMHLPS 93
           G +       V   +  P+
Sbjct: 73 DGLVESTA---VRRPVGRPA 89


>gi|237744892|ref|ZP_04575373.1| SMF family protein [Fusobacterium sp. 7_1]
 gi|229432121|gb|EEO42333.1| SMF family protein [Fusobacterium sp. 7_1]
          Length = 288

 Score = 37.9 bits (87), Expect = 0.45,   Method: Composition-based stats.
 Identities = 10/48 (20%), Positives = 22/48 (45%), Gaps = 1/48 (2%)

Query: 39  IKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
           I   L++   ++D I+  T I+   +   L+ L++ G +     G+  
Sbjct: 239 ILNCLSSE-KNLDGILAETKIKETEILAELMTLEIMGVIKSITGGRYK 285


>gi|325067042|ref|ZP_08125715.1| DNA protecting protein DprA [Actinomyces oris K20]
          Length = 459

 Score = 37.9 bits (87), Expect = 0.46,   Method: Composition-based stats.
 Identities = 8/53 (15%), Positives = 19/53 (35%), Gaps = 1/53 (1%)

Query: 32  TQCERVRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEG 83
            +     +  ++        D I+  +G+        L  L+L+G++     G
Sbjct: 394 LEPNASLVLDAMPARAAASTDSIVRSSGLSPKETTSALGILELSGKVERTASG 446


>gi|227497528|ref|ZP_03927756.1| DNA protecting protein DprA [Actinomyces urogenitalis DSM 15434]
 gi|226833009|gb|EEH65392.1| DNA protecting protein DprA [Actinomyces urogenitalis DSM 15434]
          Length = 437

 Score = 37.9 bits (87), Expect = 0.48,   Method: Composition-based stats.
 Identities = 13/89 (14%), Positives = 27/89 (30%), Gaps = 5/89 (5%)

Query: 5   QIEQNFFSSQSDTNHTKNINITHY----PEYTQCERVRIKQSL-NNVPIHIDDIIHHTGI 59
            +E       +D    K  +         +        +  ++       ++ +    G+
Sbjct: 342 ALELVLPLGLTDPEADKEADPARAGSGLLDGLDRSSAAVLDAMPARGAASVEALARSAGL 401

Query: 60  EAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
               V   L  L+LAG++C  P G     
Sbjct: 402 AESEVRAALGLLELAGKVCRDPRGWWRRA 430


>gi|152965377|ref|YP_001361161.1| DNA protecting protein DprA [Kineococcus radiotolerans SRS30216]
 gi|151359894|gb|ABS02897.1| DNA protecting protein DprA [Kineococcus radiotolerans SRS30216]
          Length = 395

 Score = 37.9 bits (87), Expect = 0.49,   Method: Composition-based stats.
 Identities = 13/76 (17%), Positives = 25/76 (32%), Gaps = 1/76 (1%)

Query: 9   NFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLV 67
                                +    + +R+ + L       ++ ++   G+E  VV  V
Sbjct: 313 ELLGELGREPAPVRSVERRAFDGLDRDELRVAECLPRRGGCDLERLVLDAGLELAVVQSV 372

Query: 68  LLELDLAGRLCHHPEG 83
           L  L+L+G     P G
Sbjct: 373 LGRLELSGIAVRVPGG 388


>gi|90425897|ref|YP_534267.1| DeoR family transcriptional regulator [Rhodopseudomonas palustris
          BisB18]
 gi|90107911|gb|ABD89948.1| transcriptional regulator, DeoR family [Rhodopseudomonas
          palustris BisB18]
          Length = 258

 Score = 37.9 bits (87), Expect = 0.49,   Method: Composition-based stats.
 Identities = 15/56 (26%), Positives = 23/56 (41%), Gaps = 1/56 (1%)

Query: 36 RVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHL 91
            R+ ++LN   I IDD+     + A  V   L +L     +     G + LT H 
Sbjct: 9  HARLLEALNAGEIDIDDLARRFEVSASTVRRDLQQLSKINAVRRTYGGAI-LTGHA 63


>gi|118592804|ref|ZP_01550193.1| transcriptional regulator, DeoR family protein [Stappia aggregata
          IAM 12614]
 gi|118434574|gb|EAV41226.1| transcriptional regulator, DeoR family protein [Stappia aggregata
          IAM 12614]
          Length = 250

 Score = 37.9 bits (87), Expect = 0.49,   Method: Composition-based stats.
 Identities = 17/63 (26%), Positives = 26/63 (41%), Gaps = 7/63 (11%)

Query: 35 ERVR-IKQSLNN-VPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHLP 92
          ER R I   L     +  +D+     +    V   LL+L+ AG++     G V     LP
Sbjct: 5  ERHRLILSMLGAKQQVSANDLAQMLNVSRETVRRDLLDLEEAGQVNRVHGGAV-----LP 59

Query: 93 SPQ 95
           P+
Sbjct: 60 DPR 62


>gi|116672682|ref|YP_833615.1| DeoR family transcriptional regulator [Arthrobacter sp. FB24]
 gi|116612791|gb|ABK05515.1| transcriptional regulator, DeoR family [Arthrobacter sp. FB24]
          Length = 256

 Score = 37.9 bits (87), Expect = 0.49,   Method: Composition-based stats.
 Identities = 14/62 (22%), Positives = 25/62 (40%), Gaps = 2/62 (3%)

Query: 35 ERVRIKQSL--NNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHLP 92
          ER R+   L  +   + +D+++   G     +   L  L + G L     G  SL +   
Sbjct: 5  ERHRLIGELLRSREEVTVDELMAECGASGATIRRDLDTLAVHGVLRRVHGGAKSLVLRGE 64

Query: 93 SP 94
          +P
Sbjct: 65 NP 66


>gi|302557788|ref|ZP_07310130.1| LOW QUALITY PROTEIN: DeoR family transcriptional regulator
          [Streptomyces griseoflavus Tu4000]
 gi|302475406|gb|EFL38499.1| LOW QUALITY PROTEIN: DeoR family transcriptional regulator
          [Streptomyces griseoflavus Tu4000]
          Length = 259

 Score = 37.9 bits (87), Expect = 0.49,   Method: Composition-based stats.
 Identities = 15/68 (22%), Positives = 27/68 (39%), Gaps = 1/68 (1%)

Query: 27 HYPEYTQCERVRIKQSLNNVPI-HIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
            P  +Q  R  I +      +  ++++  H G+ A  +   L  L   GRL     G +
Sbjct: 1  MPPNGSQARREEILRLATTTGLASVEELSRHFGVTASTIRRDLARLTADGRLARTYGGAM 60

Query: 86 SLTMHLPS 93
          +L  H  +
Sbjct: 61 ALNAHPEA 68


>gi|119715580|ref|YP_922545.1| transcriptional regulator [Nocardioides sp. JS614]
 gi|119536241|gb|ABL80858.1| transcriptional regulator, ArsR family [Nocardioides sp. JS614]
          Length = 229

 Score = 37.9 bits (87), Expect = 0.49,   Method: Composition-based stats.
 Identities = 10/54 (18%), Positives = 16/54 (29%), Gaps = 2/54 (3%)

Query: 31 YTQCERVRIKQSL--NNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPE 82
               R  I + L     P+ +  +   TG+    V   L  L   G +     
Sbjct: 25 PLSPSRRAILEHLHGQPQPLTLAALARITGLHPNTVREHLDALVRRGLVRRLAG 78


>gi|11499852|ref|NP_071096.1| hypothetical protein AF2271 [Archaeoglobus fulgidus DSM 4304]
 gi|2648262|gb|AAB88995.1| predicted coding region AF_2271 [Archaeoglobus fulgidus DSM 4304]
          Length = 255

 Score = 37.9 bits (87), Expect = 0.50,   Method: Composition-based stats.
 Identities = 15/47 (31%), Positives = 22/47 (46%), Gaps = 2/47 (4%)

Query: 33 QCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLEL-DLAGRLC 78
            +R  I   L+  P  I +I   TGI  P+V   L +L +L G + 
Sbjct: 10 SGQRKEILNILSISPKSIKEISELTGISPPLVSRHLKKLGEL-GLVE 55


>gi|89067524|ref|ZP_01155037.1| hypothetical protein OG2516_11806 [Oceanicola granulosus
          HTCC2516]
 gi|89047093|gb|EAR53147.1| hypothetical protein OG2516_11806 [Oceanicola granulosus
          HTCC2516]
          Length = 309

 Score = 37.9 bits (87), Expect = 0.50,   Method: Composition-based stats.
 Identities = 10/49 (20%), Positives = 20/49 (40%), Gaps = 1/49 (2%)

Query: 32 TQCERVRIKQSLNNV-PIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCH 79
              R RI + L+   P++++DI     +    V   +  L+  G +  
Sbjct: 21 ASVARARILKLLHTDGPMNLNDIAARLELPQSSVSSNVALLESGGLIRS 69


>gi|134293431|ref|YP_001117167.1| DEAD/DEAH box helicase domain-containing protein [Burkholderia
            vietnamiensis G4]
 gi|134136588|gb|ABO57702.1| ATP dependent helicase, Lhr family [Burkholderia vietnamiensis G4]
          Length = 1505

 Score = 37.9 bits (87), Expect = 0.50,   Method: Composition-based stats.
 Identities = 13/78 (16%), Positives = 20/78 (25%), Gaps = 6/78 (7%)

Query: 2    VHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEA 61
            +HP      FS                       R R+       P+ +  I    G+  
Sbjct: 1020 LHPDAR---FSPALKVPAACAQPWEADAALVDVIRARLT---GFGPLTVGAIAEPLGLPP 1073

Query: 62   PVVYLVLLELDLAGRLCH 79
              V   L  L+  G +  
Sbjct: 1074 ASVETALAALEREGYVMR 1091


>gi|194209543|ref|XP_001915905.1| PREDICTED: similar to Adenylate cyclase type 1 (Adenylate cyclase
           type I) (ATP pyrophosphate-lyase 1) (Adenylyl cyclase 1)
           (Ca(2+)/calmodulin-activated adenylyl cyclase) [Equus
           caballus]
          Length = 1176

 Score = 37.9 bits (87), Expect = 0.50,   Method: Composition-based stats.
 Identities = 13/76 (17%), Positives = 25/76 (32%), Gaps = 7/76 (9%)

Query: 22  NINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVL-----LELDLAGR 76
              +   P         +   +  +P+ I   +  + +   ++  VL     L L+L+G 
Sbjct: 759 RSPVLPAPPCESAPHALLCGLVGTLPLAI--FLRVSSLPKMILLSVLTASYILVLELSGY 816

Query: 77  LCHHPEGKVSLTMHLP 92
                 G VS     P
Sbjct: 817 TKAVGGGTVSGRSFEP 832


>gi|27381752|ref|NP_773281.1| hypothetical protein blr6641 [Bradyrhizobium japonicum USDA 110]
 gi|27354921|dbj|BAC51906.1| blr6641 [Bradyrhizobium japonicum USDA 110]
          Length = 406

 Score = 37.9 bits (87), Expect = 0.50,   Method: Composition-based stats.
 Identities = 15/94 (15%), Positives = 29/94 (30%), Gaps = 1/94 (1%)

Query: 2   VHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNN-VPIHIDDIIHHTGIE 60
           + P  E +           K  ++       + +   +   L++  P     +    G  
Sbjct: 298 LKPLAEISATKPGFVLAPRKTRDVLVLARPVEEKHAAVLAFLSDGEPWSSSALALALGTS 357

Query: 61  APVVYLVLLELDLAGRLCHHPEGKVSLTMHLPSP 94
           A  V   L EL  + ++     G+    M  P P
Sbjct: 358 ARTVQRALEELARSNKVQSFGHGRARRWMTPPVP 391


>gi|170718904|ref|YP_001784075.1| DNA protecting protein DprA [Haemophilus somnus 2336]
 gi|168827033|gb|ACA32404.1| DNA protecting protein DprA [Haemophilus somnus 2336]
          Length = 368

 Score = 37.9 bits (87), Expect = 0.50,   Method: Composition-based stats.
 Identities = 7/57 (12%), Positives = 16/57 (28%), Gaps = 3/57 (5%)

Query: 10  FFSSQSDTNHTKNINITHYPE---YTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPV 63
            F         K I     P            +   +   P+ +D++ + +G+    
Sbjct: 288 PFMHYERQLTAKQIETQFPPAYKLPASPTYPELYAHIGYTPVGLDELSNKSGLSVDT 344


>gi|281355863|ref|ZP_06242357.1| DNA protecting protein DprA [Victivallis vadensis ATCC BAA-548]
 gi|281318743|gb|EFB02763.1| DNA protecting protein DprA [Victivallis vadensis ATCC BAA-548]
          Length = 380

 Score = 37.9 bits (87), Expect = 0.51,   Method: Composition-based stats.
 Identities = 12/82 (14%), Positives = 26/82 (31%)

Query: 11  FSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLE 70
            +   + N       +        E   I + L+   + +D +   TG E   +   L+ 
Sbjct: 299 LAPGGEANEDAVPYDSSSVGDLPPEAREIWKLLDGRELSLDLLAEETGRETGALLSTLMM 358

Query: 71  LDLAGRLCHHPEGKVSLTMHLP 92
           L++   + H  +         P
Sbjct: 359 LEMKLLVEHGSDMVYRRIPRRP 380


>gi|296445550|ref|ZP_06887506.1| DEAD/H associated domain protein [Methylosinus trichosporium OB3b]
 gi|296256955|gb|EFH04026.1| DEAD/H associated domain protein [Methylosinus trichosporium OB3b]
          Length = 1435

 Score = 37.9 bits (87), Expect = 0.51,   Method: Composition-based stats.
 Identities = 10/76 (13%), Positives = 20/76 (26%), Gaps = 12/76 (15%)

Query: 19   HTKNINITHYPEYTQCE----RVRIKQSL-----NNVPIHIDDIIHHTGIEAPVVYLVLL 69
                +     P   + +       + + L        P+    +    G+    V   LL
Sbjct: 952  PKARLAPQIAPPDGEAQLWSAEQALIEILRGRLEGLGPVTEHALAAALGLSPSDVAGALL 1011

Query: 70   ELDLAGRLCH---HPE 82
             L+  G +      P 
Sbjct: 1012 ALEAEGAVMRGRFLPG 1027


>gi|289547863|ref|YP_003472851.1| DeoR family transcriptional regulator [Thermocrinis albus DSM
          14484]
 gi|289181480|gb|ADC88724.1| transcriptional regulator, DeoR family [Thermocrinis albus DSM
          14484]
          Length = 184

 Score = 37.9 bits (87), Expect = 0.51,   Method: Composition-based stats.
 Identities = 11/47 (23%), Positives = 20/47 (42%)

Query: 36 RVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPE 82
          + RI Q +     ++  +    G+    VY  + EL+L GR+     
Sbjct: 4  KERILQLIEEGHTNVKSLAQKLGVSLMTVYRDIKELELEGRVVRKHG 50


>gi|266621733|ref|ZP_06114668.1| putative glycerol-3-phosphate regulon repressor [Clostridium
          hathewayi DSM 13479]
 gi|288866595|gb|EFC98893.1| putative glycerol-3-phosphate regulon repressor [Clostridium
          hathewayi DSM 13479]
          Length = 249

 Score = 37.9 bits (87), Expect = 0.51,   Method: Composition-based stats.
 Identities = 9/54 (16%), Positives = 20/54 (37%), Gaps = 2/54 (3%)

Query: 34 CERV-RIKQSLNN-VPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
           ER  +I   + +   + +D++     +    +   L +L   G +     G V
Sbjct: 5  AERQLKILGMIQDNGSVQVDELARKLDVSPMTIRRDLEKLQKDGLIERCHGGAV 58


>gi|91787260|ref|YP_548212.1| ArsR family transcriptional regulator [Polaromonas sp. JS666]
 gi|91696485|gb|ABE43314.1| transcriptional regulator, ArsR family [Polaromonas sp. JS666]
          Length = 169

 Score = 37.9 bits (87), Expect = 0.51,   Method: Composition-based stats.
 Identities = 14/63 (22%), Positives = 25/63 (39%)

Query: 32 TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHL 91
              R ++ Q+L    + +  +    G+  P     L  L+ AG +    +G+V     L
Sbjct: 20 ADPTRRKVLQTLEQGSLSVGQLAEPHGMSLPGFMKHLRVLETAGLVTRAKDGRVVNLALL 79

Query: 92 PSP 94
          P P
Sbjct: 80 PEP 82


>gi|154482594|ref|ZP_02025042.1| hypothetical protein EUBVEN_00261 [Eubacterium ventriosum ATCC
           27560]
 gi|149736619|gb|EDM52505.1| hypothetical protein EUBVEN_00261 [Eubacterium ventriosum ATCC
           27560]
          Length = 333

 Score = 37.9 bits (87), Expect = 0.51,   Method: Composition-based stats.
 Identities = 12/78 (15%), Positives = 29/78 (37%)

Query: 9   NFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVL 68
           +  +    +            +  + +   +   L   P +I ++++ TG +   +  +L
Sbjct: 254 DVLNDIQYSGSKNENEKKQKEKSLEKDLALLYSGLRLQPKNIYELMNETGFKYEELTGML 313

Query: 69  LELDLAGRLCHHPEGKVS 86
           L+L L G +    E   S
Sbjct: 314 LKLQLMGLVEQPSENYYS 331


>gi|323358535|ref|YP_004224931.1| transcriptional regulator [Microbacterium testaceum StLB037]
 gi|323274906|dbj|BAJ75051.1| transcriptional regulator [Microbacterium testaceum StLB037]
          Length = 366

 Score = 37.9 bits (87), Expect = 0.52,   Method: Composition-based stats.
 Identities = 14/73 (19%), Positives = 27/73 (36%), Gaps = 1/73 (1%)

Query: 24 NITHYPEYTQCERVRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPE 82
          + T +       R  I  +L ++  + I  +    G+    +   L +L+  G L     
Sbjct: 3  DTTPHQPLAAERRAHILSALHSDGAVRISQLTEDLGVATVTLRRDLAQLEKEGVLRRVHG 62

Query: 83 GKVSLTMHLPSPQ 95
          G V+     P P+
Sbjct: 63 GAVAGENTPPRPE 75


>gi|170718737|ref|YP_001783925.1| DeoR family transcriptional regulator [Haemophilus somnus 2336]
 gi|168826866|gb|ACA32237.1| transcriptional regulator, DeoR family [Haemophilus somnus 2336]
          Length = 250

 Score = 37.9 bits (87), Expect = 0.54,   Method: Composition-based stats.
 Identities = 11/57 (19%), Positives = 22/57 (38%), Gaps = 1/57 (1%)

Query: 32 TQCERVRIKQSLNNVP-IHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
                 I Q +N+   ++++D+     +    +   L +LD  G +     G VS 
Sbjct: 1  MSSRETLILQLINSSGKVNVNDLAKQFDVSVETIRRDLTDLDKRGLIHRVHGGAVSR 57


>gi|113461589|ref|YP_719658.1| L-fucose operon activator [Haemophilus somnus 129PT]
 gi|112823632|gb|ABI25721.1| L-fucose operon activator [Haemophilus somnus 129PT]
          Length = 250

 Score = 37.9 bits (87), Expect = 0.54,   Method: Composition-based stats.
 Identities = 11/57 (19%), Positives = 22/57 (38%), Gaps = 1/57 (1%)

Query: 32 TQCERVRIKQSLNNVP-IHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
                 I Q +N+   ++++D+     +    +   L +LD  G +     G VS 
Sbjct: 1  MSSRETLILQLINSSGKVNVNDLAKQFDVSVETIRRDLTDLDKRGLIHRVHGGAVSR 57


>gi|56963041|ref|YP_174768.1| DeoR family transcriptional regulator [Bacillus clausii KSM-K16]
 gi|56909280|dbj|BAD63807.1| DeoR family transcriptional regulator [Bacillus clausii KSM-K16]
          Length = 254

 Score = 37.9 bits (87), Expect = 0.54,   Method: Composition-based stats.
 Identities = 14/60 (23%), Positives = 22/60 (36%), Gaps = 1/60 (1%)

Query: 36 RVRIKQSLN-NVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHLPSP 94
          + +I   L  N  + I ++I  TG     +   L EL+   +L     G   L      P
Sbjct: 7  QEKILALLAKNEVVKIQELIVETGASESTIRRDLTELEQRNKLKRIHGGATLLKKMRDEP 66


>gi|289763072|ref|ZP_06522450.1| smf family protein [Mycobacterium tuberculosis GM 1503]
 gi|289710578|gb|EFD74594.1| smf family protein [Mycobacterium tuberculosis GM 1503]
          Length = 308

 Score = 37.9 bits (87), Expect = 0.54,   Method: Composition-based stats.
 Identities = 10/63 (15%), Positives = 20/63 (31%), Gaps = 1/63 (1%)

Query: 21  KNINITHYPEYTQCERVRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCH 79
                    +       ++ ++L       ID+I   +G+    V   L  L++AG    
Sbjct: 224 DEPRPGAALDVLSEAERQVYEALPGRGAATIDEIAVGSGLLPAQVLGPLAILEVAGLAEC 283

Query: 80  HPE 82
              
Sbjct: 284 RDG 286


>gi|319902764|ref|YP_004162492.1| hypothetical protein Bache_2972 [Bacteroides helcogenes P 36-108]
 gi|319417795|gb|ADV44906.1| hypothetical protein Bache_2972 [Bacteroides helcogenes P 36-108]
          Length = 72

 Score = 37.9 bits (87), Expect = 0.55,   Method: Composition-based stats.
 Identities = 13/46 (28%), Positives = 22/46 (47%), Gaps = 2/46 (4%)

Query: 35 ERVRIKQSLN--NVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLC 78
          +  RI   ++     + ++ II H+G +   VY  L EL+  G L 
Sbjct: 9  DTQRIMDYISSFPEAVSVESIILHSGADKLRVYPALFELEQNGWLA 54


>gi|284990922|ref|YP_003409476.1| IclR family transcriptional regulator [Geodermatophilus obscurus
          DSM 43160]
 gi|284064167|gb|ADB75105.1| transcriptional regulator, IclR family [Geodermatophilus obscurus
          DSM 43160]
          Length = 255

 Score = 37.5 bits (86), Expect = 0.55,   Method: Composition-based stats.
 Identities = 14/76 (18%), Positives = 28/76 (36%), Gaps = 3/76 (3%)

Query: 15 SDTNHTKNINITHYPEYTQCERVRI-KQSLNNV--PIHIDDIIHHTGIEAPVVYLVLLEL 71
           + + T++      P      +  +  Q+L      + + ++    GI  P  + VL  L
Sbjct: 2  PEPSATESGTAASSPAPGSTAKALVVLQALAEDGGAVQLAELARRCGISKPTAHRVLAGL 61

Query: 72 DLAGRLCHHPEGKVSL 87
               +  H  G+ SL
Sbjct: 62 RALAWVRAHEGGRYSL 77


>gi|108798955|ref|YP_639152.1| DNA processing protein DprA, putative [Mycobacterium sp. MCS]
 gi|119868070|ref|YP_938022.1| DNA protecting protein DprA [Mycobacterium sp. KMS]
 gi|108769374|gb|ABG08096.1| DNA protecting protein DprA [Mycobacterium sp. MCS]
 gi|119694159|gb|ABL91232.1| DNA protecting protein DprA [Mycobacterium sp. KMS]
          Length = 376

 Score = 37.5 bits (86), Expect = 0.55,   Method: Composition-based stats.
 Identities = 18/81 (22%), Positives = 28/81 (34%), Gaps = 3/81 (3%)

Query: 9   NFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLV 67
                  +    +    T     T  ER RI  +L        D++    GI A  V   
Sbjct: 295 ELVGRMGELPPVEAGPATPLDGLTDAER-RIYDALPKRGARSADEVAVAAGIPAYQVVGP 353

Query: 68  LLELDLAGRLCHHPEGKVSLT 88
           L  L++AG +  H  G+  + 
Sbjct: 354 LAMLEVAGLVV-HEGGRWRMA 373


>gi|296243078|ref|YP_003650565.1| transcriptional regulator TrmB [Thermosphaera aggregans DSM
          11486]
 gi|296095662|gb|ADG91613.1| transcriptional regulator, TrmB [Thermosphaera aggregans DSM
          11486]
          Length = 140

 Score = 37.5 bits (86), Expect = 0.55,   Method: Composition-based stats.
 Identities = 9/42 (21%), Positives = 16/42 (38%)

Query: 44 NNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
          +  P  + D+     +    V+  L  L+  G +   P G V
Sbjct: 22 SREPRGVRDVARALNMPVSSVHYHLKRLEELGVIARAPGGYV 63


>gi|228953098|ref|ZP_04115158.1| Transcriptional regulator, DeoR [Bacillus thuringiensis serovar
          kurstaki str. T03a001]
 gi|228806604|gb|EEM53163.1| Transcriptional regulator, DeoR [Bacillus thuringiensis serovar
          kurstaki str. T03a001]
          Length = 194

 Score = 37.5 bits (86), Expect = 0.55,   Method: Composition-based stats.
 Identities = 12/54 (22%), Positives = 20/54 (37%), Gaps = 1/54 (1%)

Query: 36 RVRIKQSLNNVPIHI-DDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
          R RI + LN     I  ++     +    +   L  ++  G L     G + LT
Sbjct: 7  RERILELLNTDGRVIAKELAERFEMSIDSIRRDLSIMEKDGLLKRTHGGAIELT 60


>gi|229070246|ref|ZP_04203497.1| Transcriptional regulator, DeoR [Bacillus cereus F65185]
 gi|228712864|gb|EEL64788.1| Transcriptional regulator, DeoR [Bacillus cereus F65185]
          Length = 254

 Score = 37.5 bits (86), Expect = 0.55,   Method: Composition-based stats.
 Identities = 12/54 (22%), Positives = 20/54 (37%), Gaps = 1/54 (1%)

Query: 36 RVRIKQSLNNVPIHI-DDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
          R RI + LN     I  ++     +    +   L  ++  G L     G + LT
Sbjct: 7  RERILELLNTDGRVIAKELAERFEMSIDSIRRDLSIMEKDGLLKRTHGGAIELT 60


>gi|229079957|ref|ZP_04212488.1| Transcriptional regulator, DeoR [Bacillus cereus Rock4-2]
 gi|228703336|gb|EEL55791.1| Transcriptional regulator, DeoR [Bacillus cereus Rock4-2]
          Length = 254

 Score = 37.5 bits (86), Expect = 0.55,   Method: Composition-based stats.
 Identities = 12/54 (22%), Positives = 20/54 (37%), Gaps = 1/54 (1%)

Query: 36 RVRIKQSLNNVPIHI-DDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
          R RI + LN     I  ++     +    +   L  ++  G L     G + LT
Sbjct: 7  RERILELLNTDGRVIAKELAERFEMSIDSIRRDLSIMEKDGLLKRTHGGAIELT 60


>gi|206971794|ref|ZP_03232743.1| transcriptional regulator, DeoR family [Bacillus cereus AH1134]
 gi|206733179|gb|EDZ50352.1| transcriptional regulator, DeoR family [Bacillus cereus AH1134]
          Length = 261

 Score = 37.5 bits (86), Expect = 0.55,   Method: Composition-based stats.
 Identities = 12/54 (22%), Positives = 20/54 (37%), Gaps = 1/54 (1%)

Query: 36 RVRIKQSLNNVPIHI-DDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLT 88
          R RI + LN     I  ++     +    +   L  ++  G L     G + LT
Sbjct: 7  RERILELLNTDGRVIAKELAERFEMSIDSIRRDLSIMEKDGLLKRTHGGAIELT 60


>gi|238916740|ref|YP_002930257.1| DNA processing protein [Eubacterium eligens ATCC 27750]
 gi|238872100|gb|ACR71810.1| DNA processing protein [Eubacterium eligens ATCC 27750]
          Length = 379

 Score = 37.5 bits (86), Expect = 0.56,   Method: Composition-based stats.
 Identities = 10/47 (21%), Positives = 23/47 (48%)

Query: 39  IKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
           +   +N  P+ ++ I++++ I       +LLEL+L G +    +   
Sbjct: 328 VYSQINLFPVSLETIVNNSRISLVEAEGILLELELDGLIEEVSKNYY 374


>gi|315185685|gb|EFU19452.1| transcriptional regulator, ArsR family [Spirochaeta thermophila
          DSM 6578]
          Length = 313

 Score = 37.5 bits (86), Expect = 0.57,   Method: Composition-based stats.
 Identities = 8/46 (17%), Positives = 17/46 (36%)

Query: 33 QCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLC 78
             R+ I   L    ++++ I     +    V   +  L+ AG + 
Sbjct: 24 SEIRINILNLLTTETLNVNQIAERLKLPQSTVATNIAILEKAGLIE 69


>gi|307719148|ref|YP_003874680.1| transcriptional regulatory protein [Spirochaeta thermophila DSM
          6192]
 gi|306532873|gb|ADN02407.1| transcriptional regulatory protein [Spirochaeta thermophila DSM
          6192]
          Length = 313

 Score = 37.5 bits (86), Expect = 0.57,   Method: Composition-based stats.
 Identities = 8/46 (17%), Positives = 17/46 (36%)

Query: 33 QCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLC 78
             R+ I   L    ++++ I     +    V   +  L+ AG + 
Sbjct: 24 SEIRINILNLLTTETLNVNQIAERLKLPQSTVATNIAILEKAGLIE 69


>gi|218289346|ref|ZP_03493580.1| transcriptional regulator, DeoR family [Alicyclobacillus
          acidocaldarius LAA1]
 gi|218240452|gb|EED07633.1| transcriptional regulator, DeoR family [Alicyclobacillus
          acidocaldarius LAA1]
          Length = 256

 Score = 37.5 bits (86), Expect = 0.57,   Method: Composition-based stats.
 Identities = 16/62 (25%), Positives = 25/62 (40%), Gaps = 2/62 (3%)

Query: 34 CERVR-IKQSLNN-VPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHL 91
           ER R I Q LN    I + ++     +    V   L  L++ G+L     G V +    
Sbjct: 4  AERQRAILQYLNERGSIRVKELSRMFSVTEETVRRDLHILEMEGKLRRSHGGAVRIDDDT 63

Query: 92 PS 93
          P+
Sbjct: 64 PA 65


>gi|317475984|ref|ZP_07935239.1| leucyl-tRNA synthetase [Bacteroides eggerthii 1_2_48FAA]
 gi|316907916|gb|EFV29615.1| leucyl-tRNA synthetase [Bacteroides eggerthii 1_2_48FAA]
          Length = 74

 Score = 37.5 bits (86), Expect = 0.57,   Method: Composition-based stats.
 Identities = 13/46 (28%), Positives = 22/46 (47%), Gaps = 2/46 (4%)

Query: 35 ERVRIKQSLN--NVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLC 78
          +  +I   +      + +DDII ++G +   VY  L EL+  G L 
Sbjct: 7  DTQKIIDYIASFYGAVSVDDIIQNSGADKLRVYPALFELEQNGFLE 52


>gi|309774980|ref|ZP_07669997.1| transcriptional regulator, DeoR family [Erysipelotrichaceae
          bacterium 3_1_53]
 gi|308917257|gb|EFP62980.1| transcriptional regulator, DeoR family [Erysipelotrichaceae
          bacterium 3_1_53]
          Length = 253

 Score = 37.5 bits (86), Expect = 0.58,   Method: Composition-based stats.
 Identities = 10/39 (25%), Positives = 17/39 (43%)

Query: 48 IHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
          IH+ D+     I    +   L+EL+  G++     G V 
Sbjct: 20 IHVRDVAKQLNISETTIRRDLMELEQEGKIRRVHGGAVR 58


>gi|315231572|ref|YP_004072008.1| transcriptional regulator [Thermococcus barophilus MP]
 gi|315184600|gb|ADT84785.1| predicted transcription regulator [Thermococcus barophilus MP]
          Length = 175

 Score = 37.5 bits (86), Expect = 0.58,   Method: Composition-based stats.
 Identities = 9/40 (22%), Positives = 15/40 (37%), Gaps = 2/40 (5%)

Query: 45 NVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHH--PE 82
          + P+ + +I   TG     V   L  L+  G +     P 
Sbjct: 38 DEPLSLGEIAEKTGYSISHVSSALKLLESVGLVTRIKKPG 77


>gi|126434555|ref|YP_001070246.1| DNA protecting protein DprA [Mycobacterium sp. JLS]
 gi|126234355|gb|ABN97755.1| DNA protecting protein DprA [Mycobacterium sp. JLS]
          Length = 376

 Score = 37.5 bits (86), Expect = 0.58,   Method: Composition-based stats.
 Identities = 18/81 (22%), Positives = 28/81 (34%), Gaps = 3/81 (3%)

Query: 9   NFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLV 67
                  +    +    T     T  ER RI  +L        D++    GI A  V   
Sbjct: 295 ELVGRMGELPPVEAGPATPLDGLTDAER-RIYDALPKRGARSADEVAVAAGIPAYQVVGP 353

Query: 68  LLELDLAGRLCHHPEGKVSLT 88
           L  L++AG +  H  G+  + 
Sbjct: 354 LAMLEVAGLVV-HEGGRWRMA 373


>gi|167043468|gb|ABZ08165.1| putative DEAD/DEAH box helicase [uncultured marine microorganism
            HF4000_APKG2H5]
          Length = 1763

 Score = 37.5 bits (86), Expect = 0.59,   Method: Composition-based stats.
 Identities = 9/49 (18%), Positives = 18/49 (36%), Gaps = 1/49 (2%)

Query: 30   EYTQCERVRIKQSLNNV-PIHIDDIIHHTGIEAPVVYLVLLELDLAGRL 77
            +   C R+++   L +  P     +          V  VL EL++   +
Sbjct: 995  DPLDCLRLKLLDMLGSEGPQTSVALCERLPFPPAQVDSVLQELEMRNLV 1043


>gi|118469804|ref|YP_887727.1| IclR family protein regulator [Mycobacterium smegmatis str. MC2
          155]
 gi|118171091|gb|ABK71987.1| probable IclR family protein regulator [Mycobacterium smegmatis
          str. MC2 155]
          Length = 260

 Score = 37.5 bits (86), Expect = 0.59,   Method: Composition-based stats.
 Identities = 10/69 (14%), Positives = 18/69 (26%), Gaps = 3/69 (4%)

Query: 20 TKNINITHYPEYTQCERVRIKQSLNNV---PIHIDDIIHHTGIEAPVVYLVLLELDLAGR 76
                           +RI   L      P  + +I    G+    V  +   L+  G 
Sbjct: 2  ADEAERAAGNSPAVTRSIRILDLLAEARGVPRTLTEIARELGLAKSSVSNLCAALEEGGL 61

Query: 77 LCHHPEGKV 85
          +     G +
Sbjct: 62 VRRSTGGYL 70


>gi|326436689|gb|EGD82259.1| hypothetical protein PTSG_02929 [Salpingoeca sp. ATCC 50818]
          Length = 826

 Score = 37.5 bits (86), Expect = 0.60,   Method: Composition-based stats.
 Identities = 15/67 (22%), Positives = 24/67 (35%), Gaps = 7/67 (10%)

Query: 2   VHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEA 61
           + P    + F+ Q    H      T  P     E      +L       D ++HHTG+  
Sbjct: 121 LAPIQRYDPFTRQPAVGHEPEPYTTAAPPPAHGEDDE--AALGP----FDVLVHHTGM-L 173

Query: 62  PVVYLVL 68
            +V  +L
Sbjct: 174 ELVRALL 180


>gi|323704781|ref|ZP_08116358.1| transcriptional regulator, DeoR family [Thermoanaerobacterium
          xylanolyticum LX-11]
 gi|323535707|gb|EGB25481.1| transcriptional regulator, DeoR family [Thermoanaerobacterium
          xylanolyticum LX-11]
          Length = 275

 Score = 37.5 bits (86), Expect = 0.60,   Method: Composition-based stats.
 Identities = 11/57 (19%), Positives = 24/57 (42%), Gaps = 2/57 (3%)

Query: 36 RVRIKQSLNNV-PIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHL 91
          R++I + L+    I + ++    G+    +   L  L++ G +     G + L  H 
Sbjct: 7  RMKIAEILSKDKSITVSELSEILGVSESTIRRDLKMLEIDGFIQRTHGGAI-LNTHT 62


>gi|28572469|ref|NP_789249.1| DNA processing protein [Tropheryma whipplei TW08/27]
 gi|28410601|emb|CAD66987.1| putative DNA processing protein [Tropheryma whipplei TW08/27]
          Length = 381

 Score = 37.5 bits (86), Expect = 0.60,   Method: Composition-based stats.
 Identities = 13/67 (19%), Positives = 26/67 (38%), Gaps = 1/67 (1%)

Query: 18  NHTKNINITHYPEYTQCERVRIKQSLNNV-PIHIDDIIHHTGIEAPVVYLVLLELDLAGR 76
                  I       Q  R+R+  +L+      I +I   +G+    V  ++  L+L+G+
Sbjct: 307 APLVVSPIQKDSFGLQASRIRVIDALSKKYDRDISEICRLSGMLFDDVSSLMRLLELSGQ 366

Query: 77  LCHHPEG 83
           +     G
Sbjct: 367 VIRSGSG 373


>gi|28493420|ref|NP_787581.1| nucleotide-binding protein [Tropheryma whipplei str. Twist]
 gi|28476461|gb|AAO44550.1| nucleotide-binding protein [Tropheryma whipplei str. Twist]
          Length = 399

 Score = 37.5 bits (86), Expect = 0.60,   Method: Composition-based stats.
 Identities = 13/67 (19%), Positives = 26/67 (38%), Gaps = 1/67 (1%)

Query: 18  NHTKNINITHYPEYTQCERVRIKQSLNNV-PIHIDDIIHHTGIEAPVVYLVLLELDLAGR 76
                  I       Q  R+R+  +L+      I +I   +G+    V  ++  L+L+G+
Sbjct: 325 APLVVSPIQKDSFGLQASRIRVIDALSKKYDRDISEICRLSGMLFDDVSSLMRLLELSGQ 384

Query: 77  LCHHPEG 83
           +     G
Sbjct: 385 VIRSGSG 391


>gi|78185425|ref|YP_377860.1| SMF protein [Synechococcus sp. CC9902]
 gi|78169719|gb|ABB26816.1| SMF protein [Synechococcus sp. CC9902]
          Length = 355

 Score = 37.5 bits (86), Expect = 0.61,   Method: Composition-based stats.
 Identities = 6/53 (11%), Positives = 17/53 (32%), Gaps = 1/53 (1%)

Query: 30  EYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPE 82
                 +  +  ++ +    I+ +    G     +   LL L+  G++     
Sbjct: 298 ASASVAQDALLAAIGDGA-SIETLQRRLGPRGHQLSSRLLALECEGQVVCEAG 349


>gi|113460558|ref|YP_718622.1| DNA processing chain A [Haemophilus somnus 129PT]
 gi|112822601|gb|ABI24690.1| DNA processing chain A [Haemophilus somnus 129PT]
          Length = 368

 Score = 37.5 bits (86), Expect = 0.61,   Method: Composition-based stats.
 Identities = 7/57 (12%), Positives = 16/57 (28%), Gaps = 3/57 (5%)

Query: 10  FFSSQSDTNHTKNINITHYPE---YTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPV 63
            F         K I     P            +   +   P+ +D++ + +G+    
Sbjct: 288 PFMHYERQLTAKQIETQFPPAYKLPASPTYPELYAHIGYTPVGLDELSNKSGLSVDT 344


>gi|327311942|ref|YP_004338839.1| regulatory protein ArsR [Thermoproteus uzoniensis 768-20]
 gi|326948421|gb|AEA13527.1| regulatory protein ArsR [Thermoproteus uzoniensis 768-20]
          Length = 83

 Score = 37.5 bits (86), Expect = 0.61,   Method: Composition-based stats.
 Identities = 12/50 (24%), Positives = 19/50 (38%), Gaps = 1/50 (2%)

Query: 36 RVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
          R +I   L   P +I+ I    GI+   V   L  L+  G +      + 
Sbjct: 2  RSKILMLLKERPTNINQISKELGIDYKTVKYHLSLLEKNGLVKRL-GMRY 50


>gi|317488107|ref|ZP_07946684.1| DNA protecting protein DprA [Eggerthella sp. 1_3_56FAA]
 gi|316912815|gb|EFV34347.1| DNA protecting protein DprA [Eggerthella sp. 1_3_56FAA]
          Length = 227

 Score = 37.5 bits (86), Expect = 0.61,   Method: Composition-based stats.
 Identities = 14/76 (18%), Positives = 29/76 (38%), Gaps = 7/76 (9%)

Query: 15  SDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDI----IHHTGIEAPV--VYLVL 68
                  ++  T  P   +     +  +L   P+ ++ +        G E     +   L
Sbjct: 147 LKQETVPSVERTGAPRADEPS-NPVADALRAEPLSMEQLYAIAASSCGGEDARSWLMERL 205

Query: 69  LELDLAGRLCHHPEGK 84
           +E +LAG +  HP+G+
Sbjct: 206 VEAELAGAVARHPDGR 221


>gi|307326907|ref|ZP_07606098.1| transcriptional regulator, DeoR family [Streptomyces
          violaceusniger Tu 4113]
 gi|306887443|gb|EFN18438.1| transcriptional regulator, DeoR family [Streptomyces
          violaceusniger Tu 4113]
          Length = 253

 Score = 37.5 bits (86), Expect = 0.62,   Method: Composition-based stats.
 Identities = 14/55 (25%), Positives = 20/55 (36%), Gaps = 1/55 (1%)

Query: 33 QCERVRIKQSLNNVPI-HIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS 86
          +    ++   L    +  I +I    GI        L EL  AGRL     G V+
Sbjct: 4  ETRHEKLLSILGEEGVLPIGEIATRLGISEATARRDLTELGRAGRLTRVYGGAVA 58


>gi|299131761|ref|ZP_07024956.1| transcriptional regulator, ArsR family [Afipia sp. 1NLS2]
 gi|298591898|gb|EFI52098.1| transcriptional regulator, ArsR family [Afipia sp. 1NLS2]
          Length = 128

 Score = 37.5 bits (86), Expect = 0.62,   Method: Composition-based stats.
 Identities = 9/48 (18%), Positives = 16/48 (33%)

Query: 32 TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCH 79
              R  I   L      ++++     +  P V   L  L+ AG +  
Sbjct: 12 ADPTRRAILARLALGETSVNELAEPFDMSLPAVSKHLKVLEGAGLITR 59


>gi|83312852|ref|YP_423116.1| Zn peptidase [Magnetospirillum magneticum AMB-1]
 gi|82947693|dbj|BAE52557.1| Predicted Zn peptidase [Magnetospirillum magneticum AMB-1]
          Length = 171

 Score = 37.5 bits (86), Expect = 0.62,   Method: Composition-based stats.
 Identities = 6/59 (10%), Positives = 26/59 (44%), Gaps = 10/59 (16%)

Query: 37 VRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDL----AGRLCHHPEGKVSLTMHL 91
            +   +++ P+ +D +    G++        L+ ++    +G++     G+  ++++ 
Sbjct: 12 EIVSDFMSSAPVDLDAMARALGLDVT------LDAEIPPDVSGKIERVAGGRFRVSINQ 64


>gi|160880760|ref|YP_001559728.1| ArsR family transcriptional regulator [Clostridium
          phytofermentans ISDg]
 gi|160429426|gb|ABX42989.1| transcriptional regulator, ArsR family [Clostridium
          phytofermentans ISDg]
          Length = 192

 Score = 37.5 bits (86), Expect = 0.63,   Method: Composition-based stats.
 Identities = 12/58 (20%), Positives = 28/58 (48%)

Query: 20 TKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRL 77
          T++  I  +       R+ I +SL   P++++ + +   +  P +   L +L+ AG +
Sbjct: 9  TESDAIKLFKSLADKSRLMILKSLAEQPMYVELLANRLNLTPPTISFHLKKLEEAGVV 66


>gi|91780801|ref|YP_556008.1| IclR family transcriptional regulator [Burkholderia xenovorans
          LB400]
 gi|91693461|gb|ABE36658.1| transcriptional regulator, IclR family [Burkholderia xenovorans
          LB400]
          Length = 276

 Score = 37.5 bits (86), Expect = 0.63,   Method: Composition-based stats.
 Identities = 11/79 (13%), Positives = 25/79 (31%), Gaps = 1/79 (1%)

Query: 6  IEQNFFSSQSDTNHTKNINITHYPEYTQCERV-RIKQSLNNVPIHIDDIIHHTGIEAPVV 64
          +  +  S     N     +           R  ++ ++L N P+ +  +    G+     
Sbjct: 1  MRTDELSRTVYRNANAATDTGTRTPPRAPVRAMQVLEALANSPMSLGALSVELGMPKTSA 60

Query: 65 YLVLLELDLAGRLCHHPEG 83
            +L  L+ A  +     G
Sbjct: 61 MHMLRALEAAAYVRRTAAG 79


>gi|329955166|ref|ZP_08296123.1| toxin-antitoxin system, toxin component, RelE domain protein
          [Bacteroides clarus YIT 12056]
 gi|328526165|gb|EGF53184.1| toxin-antitoxin system, toxin component, RelE domain protein
          [Bacteroides clarus YIT 12056]
          Length = 77

 Score = 37.5 bits (86), Expect = 0.63,   Method: Composition-based stats.
 Identities = 11/31 (35%), Positives = 18/31 (58%)

Query: 48 IHIDDIIHHTGIEAPVVYLVLLELDLAGRLC 78
          + +DDII ++G +   VY  L EL+  G + 
Sbjct: 24 VAVDDIIRNSGADKLRVYPALFELEHDGYIE 54


>gi|259089742|gb|ACV91704.1| putative transcriptional regulator, DeoR family [Klebsiella
          pneumoniae]
          Length = 253

 Score = 37.5 bits (86), Expect = 0.64,   Method: Composition-based stats.
 Identities = 13/58 (22%), Positives = 26/58 (44%), Gaps = 2/58 (3%)

Query: 37 VRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHLPS 93
           +I   L ++  + +D ++  T      +   L++LD  G +     G V+L   +PS
Sbjct: 8  EQIMDFLKSHNLVTVDQLVAATNASPATIRRDLIKLDQEGVISRTHGG-VTLNRFIPS 64


>gi|238894666|ref|YP_002919400.1| putative transcriptional regulator [Klebsiella pneumoniae
          NTUH-K2044]
 gi|330006446|ref|ZP_08305610.1| transcriptional regulator, DeoR family [Klebsiella sp. MS 92-3]
 gi|238546982|dbj|BAH63333.1| putative transcriptional regulator [Klebsiella pneumoniae subsp.
          pneumoniae NTUH-K2044]
 gi|328535844|gb|EGF62276.1| transcriptional regulator, DeoR family [Klebsiella sp. MS 92-3]
          Length = 253

 Score = 37.5 bits (86), Expect = 0.64,   Method: Composition-based stats.
 Identities = 13/58 (22%), Positives = 26/58 (44%), Gaps = 2/58 (3%)

Query: 37 VRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHLPS 93
           +I   L ++  + +D ++  T      +   L++LD  G +     G V+L   +PS
Sbjct: 8  EQIMDFLKSHNLVTVDQLVAATNASPATIRRDLIKLDQEGVISRTHGG-VTLNRFIPS 64


>gi|70727195|ref|YP_254111.1| hypothetical protein SH2196 [Staphylococcus haemolyticus
          JCSC1435]
 gi|68447921|dbj|BAE05505.1| unnamed protein product [Staphylococcus haemolyticus JCSC1435]
          Length = 251

 Score = 37.5 bits (86), Expect = 0.64,   Method: Composition-based stats.
 Identities = 11/36 (30%), Positives = 16/36 (44%)

Query: 48 IHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEG 83
          + + ++I  TG  A  V   L +L   GRL     G
Sbjct: 20 LTLQELIERTGCSASTVRRDLSKLQQQGRLQRVHGG 55


>gi|94986442|ref|YP_605806.1| DNA processing protein DprA, putative [Deinococcus geothermalis DSM
           11300]
 gi|94556723|gb|ABF46637.1| DNA protecting protein DprA [Deinococcus geothermalis DSM 11300]
          Length = 358

 Score = 37.5 bits (86), Expect = 0.64,   Method: Composition-based stats.
 Identities = 13/60 (21%), Positives = 20/60 (33%), Gaps = 1/60 (1%)

Query: 23  INITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPE 82
                       E+ R   +L   P  +DD+   TG+  P +   L+ L L G       
Sbjct: 295 EAPAAPTSDLPPEQARTYAAL-TTPATLDDLQAATGLTLPDLQTALVMLQLLGLAEEVGG 353


>gi|319786294|ref|YP_004145769.1| DEAD/DEAH box helicase [Pseudoxanthomonas suwonensis 11-1]
 gi|317464806|gb|ADV26538.1| DEAD/H associated domain protein [Pseudoxanthomonas suwonensis 11-1]
          Length = 1498

 Score = 37.5 bits (86), Expect = 0.65,   Method: Composition-based stats.
 Identities = 9/75 (12%), Positives = 19/75 (25%), Gaps = 8/75 (10%)

Query: 11   FSSQSDTNHTKNINITHYPEYTQCERVRI------KQSLNNVPIHIDDIIHHTGIEAPVV 64
               Q++      +           E  R+        +L   P+ +  +     +    +
Sbjct: 992  LHPQANQEPVPRVPEEFARVPWSTEDARVALLRSRLTALG--PVTVTALAASLALPPSAI 1049

Query: 65   YLVLLELDLAGRLCH 79
               LL L   G    
Sbjct: 1050 EQALLALQTQGYAMQ 1064


>gi|290509599|ref|ZP_06548970.1| DeoR family transcriptional regulator [Klebsiella sp. 1_1_55]
 gi|289778993|gb|EFD86990.1| DeoR family transcriptional regulator [Klebsiella sp. 1_1_55]
          Length = 253

 Score = 37.5 bits (86), Expect = 0.66,   Method: Composition-based stats.
 Identities = 13/58 (22%), Positives = 26/58 (44%), Gaps = 2/58 (3%)

Query: 37 VRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHLPS 93
           +I   L ++  + +D ++  T      +   L++LD  G +     G V+L   +PS
Sbjct: 8  EQIMDFLKSHNLVTVDQLVAATNASPATIRRDLIKLDQEGVISRTHGG-VTLNRFIPS 64


>gi|325264543|ref|ZP_08131273.1| putative transcriptional regulator, IclR family [Clostridium sp.
          D5]
 gi|324030205|gb|EGB91490.1| putative transcriptional regulator, IclR family [Clostridium sp.
          D5]
          Length = 258

 Score = 37.5 bits (86), Expect = 0.67,   Method: Composition-based stats.
 Identities = 7/50 (14%), Positives = 21/50 (42%), Gaps = 2/50 (4%)

Query: 38 RIKQSLNNV--PIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKV 85
           +   L     P+ +++I  +  +     + +L  L++ G +    +G+ 
Sbjct: 17 EVLDILRKERSPLGVNEIAKNCELNPSTAFRILKTLEVNGWVYQCMDGRY 66


>gi|219883315|ref|YP_002478476.1| transcriptional regulator, ArsR family [Arthrobacter
           chlorophenolicus A6]
 gi|219862160|gb|ACL42500.1| transcriptional regulator, ArsR family [Arthrobacter
           chlorophenolicus A6]
          Length = 287

 Score = 37.5 bits (86), Expect = 0.68,   Method: Composition-based stats.
 Identities = 13/60 (21%), Positives = 23/60 (38%), Gaps = 3/60 (5%)

Query: 30  EYTQCERVRIKQSLN--NVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSL 87
                  +RI ++LN    P   +++     +   +V   L  L+ AG +     G V L
Sbjct: 199 AAASTPSLRILRALNLLQAPQRPEELAEGLELCPSIVSHELSTLEAAGII-RTAGGHVHL 257


>gi|62390392|ref|YP_225794.1| ArsR family regulatory protein [Corynebacterium glutamicum ATCC
           13032]
 gi|41411213|emb|CAF21518.2| Bacterial regulatory proteins, ArsR family [Corynebacterium
           glutamicum ATCC 13032]
          Length = 119

 Score = 37.5 bits (86), Expect = 0.68,   Method: Composition-based stats.
 Identities = 20/87 (22%), Positives = 33/87 (37%), Gaps = 7/87 (8%)

Query: 14  QSDTNHTKNINITHYPEY----TQCERVRIKQSL---NNVPIHIDDIIHHTGIEAPVVYL 66
              T    +    HY +         R+RI   L      P+ ++++    G+  P +  
Sbjct: 17  TLATGPLSSDESEHYADLFKVLGDPVRLRILSQLAAGGCGPVSVNELTDLMGLSQPTISH 76

Query: 67  VLLELDLAGRLCHHPEGKVSLTMHLPS 93
            L ++  AG L   PEG+V L    P 
Sbjct: 77  HLKKMTEAGFLDRVPEGRVVLHRVRPE 103


>gi|297526361|ref|YP_003668385.1| type III restriction protein res subunit [Staphylothermus
           hellenicus DSM 12710]
 gi|297255277|gb|ADI31486.1| type III restriction protein res subunit [Staphylothermus
           hellenicus DSM 12710]
          Length = 612

 Score = 37.5 bits (86), Expect = 0.69,   Method: Composition-based stats.
 Identities = 12/76 (15%), Positives = 28/76 (36%), Gaps = 5/76 (6%)

Query: 7   EQNFFSSQSDTNHTKNINITHYPEYTQCE-----RVRIKQSLNNVPIHIDDIIHHTGIEA 61
           + +      +      +++    E  +       R RI   L+  P+ ++ I   TG+  
Sbjct: 400 DMDSLLDALELARKNGVDVPIDEETLEALWRRTTRNRILSVLSGKPMPLEWISEITGMPR 459

Query: 62  PVVYLVLLELDLAGRL 77
            +V   +  L+  G +
Sbjct: 460 DLVEKAIKRLEDKGLV 475


>gi|293401838|ref|ZP_06645979.1| transcriptional regulator, DeoR family [Erysipelotrichaceae
          bacterium 5_2_54FAA]
 gi|291304790|gb|EFE46038.1| transcriptional regulator, DeoR family [Erysipelotrichaceae
          bacterium 5_2_54FAA]
          Length = 254

 Score = 37.5 bits (86), Expect = 0.70,   Method: Composition-based stats.
 Identities = 10/64 (15%), Positives = 22/64 (34%), Gaps = 7/64 (10%)

Query: 38 RIKQSLNNVP-IHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVS------LTMH 90
          RI + +     + I +++         +   L+EL+  G +     G +       L+  
Sbjct: 9  RIMEVIEEQSFVTISELMEFLNASKSTITRDLMELERQGLIQRERGGAIRKELPQTLSSS 68

Query: 91 LPSP 94
             P
Sbjct: 69 TDLP 72


>gi|288935563|ref|YP_003439622.1| DeoR family transcriptional regulator [Klebsiella variicola
          At-22]
 gi|288890272|gb|ADC58590.1| transcriptional regulator, DeoR family [Klebsiella variicola
          At-22]
          Length = 253

 Score = 37.5 bits (86), Expect = 0.70,   Method: Composition-based stats.
 Identities = 13/58 (22%), Positives = 26/58 (44%), Gaps = 2/58 (3%)

Query: 37 VRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHLPS 93
           +I   L ++  + +D ++  T      +   L++LD  G +     G V+L   +PS
Sbjct: 8  EQIMDFLKSHNLVTVDQLVAATNASPATIRRDLIKLDQEGVISRTHGG-VTLNRFIPS 64


>gi|206580138|ref|YP_002238578.1| transcriptional regulator, DeoR family [Klebsiella pneumoniae
          342]
 gi|206569196|gb|ACI10972.1| transcriptional regulator, DeoR family [Klebsiella pneumoniae
          342]
          Length = 253

 Score = 37.5 bits (86), Expect = 0.70,   Method: Composition-based stats.
 Identities = 13/58 (22%), Positives = 26/58 (44%), Gaps = 2/58 (3%)

Query: 37 VRIKQSL-NNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHLPS 93
           +I   L ++  + +D ++  T      +   L++LD  G +     G V+L   +PS
Sbjct: 8  EQIMDFLKSHNLVTVDQLVAATNASPATIRRDLIKLDQEGVISRTHGG-VTLNRFIPS 64


>gi|110635404|ref|YP_675612.1| ArsR family transcriptional regulator [Mesorhizobium sp. BNC1]
 gi|110286388|gb|ABG64447.1| transcriptional regulator, ArsR family [Chelativorans sp. BNC1]
          Length = 117

 Score = 37.5 bits (86), Expect = 0.70,   Method: Composition-based stats.
 Identities = 11/61 (18%), Positives = 19/61 (31%)

Query: 19 HTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLC 78
          H  +             R  I   L+     ++++     I  P V   L  L+ AG + 
Sbjct: 3  HADDPLSVTLSALADPTRRAILARLSQGAATVNELAEPFDISLPSVSRHLKVLEGAGLIS 62

Query: 79 H 79
           
Sbjct: 63 R 63


>gi|288932364|ref|YP_003436424.1| hypothetical protein Ferp_2012 [Ferroglobus placidus DSM 10642]
 gi|288894612|gb|ADC66149.1| conserved hypothetical protein [Ferroglobus placidus DSM 10642]
          Length = 313

 Score = 37.5 bits (86), Expect = 0.70,   Method: Composition-based stats.
 Identities = 11/47 (23%), Positives = 17/47 (36%), Gaps = 4/47 (8%)

Query: 52 DIIHHTGIEAPVVYLVLLELDLAGRLCH--HPEG--KVSLTMHLPSP 94
          +++   G     V  VL EL+  G +          +V L    P P
Sbjct: 23 ELVRRIGASKSTVSDVLSELEGKGIVVREKEAGKSLRVWLAEFYPKP 69


>gi|156547761|ref|XP_001605800.1| PREDICTED: similar to GH15213p [Nasonia vitripennis]
          Length = 580

 Score = 37.5 bits (86), Expect = 0.70,   Method: Composition-based stats.
 Identities = 13/87 (14%), Positives = 24/87 (27%), Gaps = 16/87 (18%)

Query: 22  NINITHYPEYTQCER-------------VRIKQSLN---NVPIHIDDIIHHTGIEAPVVY 65
              I         +               +I + +      P+ I ++    G +A  V 
Sbjct: 155 EEPIELPVRPLSTDETILGGAQIIELTTEKILELIESAYPNPLTIYNLAEDHGWDADAVA 214

Query: 66  LVLLELDLAGRLCHHPEGKVSLTMHLP 92
             L EL   G +     G  +  +H  
Sbjct: 215 EKLAELQKKGLVVAMENGAFTRVVHQD 241


>gi|329910748|ref|ZP_08275374.1| putative transcriptional regulator (IclR family)
          [Oxalobacteraceae bacterium IMCC9480]
 gi|327546084|gb|EGF31151.1| putative transcriptional regulator (IclR family)
          [Oxalobacteraceae bacterium IMCC9480]
          Length = 261

 Score = 37.5 bits (86), Expect = 0.71,   Method: Composition-based stats.
 Identities = 11/55 (20%), Positives = 21/55 (38%), Gaps = 2/55 (3%)

Query: 39 IKQSLN--NVPIHIDDIIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHL 91
          +  +L     P+ +  +   TG+     + +L +L L   +     G   L M L
Sbjct: 23 LLDALARYPDPVSLKQLSADTGLHPSTAHRILNDLVLKRFVERAEPGAYRLGMRL 77


>gi|323342665|ref|ZP_08082897.1| cadmium efflux system accessory protein [Erysipelothrix
          rhusiopathiae ATCC 19414]
 gi|322463777|gb|EFY08971.1| cadmium efflux system accessory protein [Erysipelothrix
          rhusiopathiae ATCC 19414]
          Length = 117

 Score = 37.5 bits (86), Expect = 0.71,   Method: Composition-based stats.
 Identities = 10/40 (25%), Positives = 17/40 (42%)

Query: 32 TQCERVRIKQSLNNVPIHIDDIIHHTGIEAPVVYLVLLEL 71
              R+RI   L++  + +DD+    G+    V   L  L
Sbjct: 41 ADPTRLRIFTILSHQTVCVDDLAEILGMTQSAVSHQLASL 80


>gi|222109030|ref|YP_002551296.1| transcriptional repressor [Agrobacterium radiobacter K84]
 gi|221727952|gb|ACM31002.1| transcriptional repressor [Agrobacterium radiobacter K84]
          Length = 257

 Score = 37.1 bits (85),