BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780305|ref|YP_003064718.1| hypothetical protein CLIBASIA_00950 [Candidatus Liberibacter asiaticus str. psy62] (95 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780305|ref|YP_003064718.1| hypothetical protein CLIBASIA_00950 [Candidatus Liberibacter asiaticus str. psy62] Length = 95 Score = 196 bits (499), Expect = 5e-53, Method: Compositional matrix adjust. Identities = 95/95 (100%), Positives = 95/95 (100%) Query: 1 MVHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIE 60 MVHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIE Sbjct: 1 MVHPQIEQNFFSSQSDTNHTKNINITHYPEYTQCERVRIKQSLNNVPIHIDDIIHHTGIE 60 Query: 61 APVVYLVLLELDLAGRLCHHPEGKVSLTMHLPSPQ 95 APVVYLVLLELDLAGRLCHHPEGKVSLTMHLPSPQ Sbjct: 61 APVVYLVLLELDLAGRLCHHPEGKVSLTMHLPSPQ 95 >gi|254780445|ref|YP_003064858.1| isoleucyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 963 Score = 23.5 bits (49), Expect = 0.80, Method: Composition-based stats. Identities = 13/40 (32%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Query: 53 IIHHTGIEAPVVYLVLLELDLAGRLCHHPEGKVSLTMHLP 92 I + T ++ +V V E DL+ +C HP K+ T +P Sbjct: 290 IANQTNVKIALVCDVKAE-DLSKTMCSHPLKKLGYTFSVP 328 >gi|254780142|ref|YP_003064555.1| DNA-directed RNA polymerase subunit beta' [Candidatus Liberibacter asiaticus str. psy62] Length = 1398 Score = 22.7 bits (47), Expect = 1.4, Method: Composition-based stats. Identities = 13/46 (28%), Positives = 23/46 (50%), Gaps = 5/46 (10%) Query: 6 IEQNFFSSQSDTNHTKNINITHYPE-----YTQCERVRIKQSLNNV 46 + QN +Q D N K + ITH + Y+ RV + +L+++ Sbjct: 800 VAQNCVVNQVDCNTKKGLTITHIVDSGQVVYSLGSRVLGRTALDDI 845 >gi|254781181|ref|YP_003065594.1| hypothetical protein CLIBASIA_05440 [Candidatus Liberibacter asiaticus str. psy62] Length = 85 Score = 21.9 bits (45), Expect = 2.3, Method: Compositional matrix adjust. Identities = 11/25 (44%), Positives = 14/25 (56%) Query: 28 YPEYTQCERVRIKQSLNNVPIHIDD 52 YPE Q R K+ N+V IH+ D Sbjct: 61 YPEQRQELAKRYKEKYNDVLIHLPD 85 >537021.9.peg.410_1 Length = 952 Score = 21.6 bits (44), Expect = 3.2, Method: Compositional matrix adjust. Identities = 7/10 (70%), Positives = 10/10 (100%) Query: 58 GIEAPVVYLV 67 G+E+PVV+LV Sbjct: 582 GLESPVVFLV 591 >gi|254780601|ref|YP_003065014.1| ATP-dependent RNA helicase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 573 Score = 20.4 bits (41), Expect = 6.9, Method: Composition-based stats. Identities = 9/19 (47%), Positives = 10/19 (52%) Query: 75 GRLCHHPEGKVSLTMHLPS 93 GRLC H GK HL + Sbjct: 133 GRLCDHIRGKGLNISHLKA 151 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.320 0.136 0.415 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 64,539 Number of Sequences: 1233 Number of extensions: 2370 Number of successful extensions: 7 Number of sequences better than 100.0: 7 Number of HSP's better than 100.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of query: 95 length of database: 328,796 effective HSP length: 60 effective length of query: 35 effective length of database: 254,816 effective search space: 8918560 effective search space used: 8918560 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.4 bits) S2: 31 (16.5 bits)