HHsearch alignment for GI: 254780308 and conserved domain: PRK12713

>PRK12713 flgJ peptidoglycan hydrolase; Provisional.
Probab=94.04  E-value=0.063  Score=32.30  Aligned_cols=39  Identities=21%  Similarity=0.316  Sum_probs=35.9

Q ss_pred             HHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCCCHHHC
Q ss_conf             998532346999999983899889445231002210102
Q gi|254780308|r  108 IALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETM  146 (288)
Q Consensus       108 r~~~~~~~~~L~~ie~~yGV~~~ii~AiwGiET~yG~~~  146 (288)
T Consensus       182 ~eFV~~L~P~Aq~AA~~~Gv~~~~~iAQAALESGWGk~~  220 (339)
T PRK12713        182 VDFVSRMSRAANVAAQQSGVPARLILGQAALESGWGRRE  220 (339)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHCCCCCCC
T ss_conf             999999799999999997939999999999970346021