HHsearch alignment for GI: 254780308 and conserved domain: smart00047

>smart00047 LYZ2 Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
Probab=95.15  E-value=0.024  Score=34.83  Aligned_cols=38  Identities=24%  Similarity=0.245  Sum_probs=34.3

Q ss_pred             HHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCCCHHH
Q ss_conf             99853234699999998389988944523100221010
Q gi|254780308|r  108 IALKKANSRLLINLKKEYGVPPGILMALWGLETHFGET  145 (288)
Q Consensus       108 r~~~~~~~~~L~~ie~~yGV~~~ii~AiwGiET~yG~~  145 (288)
T Consensus         9 ~~Fi~~i~~~A~~~~~~~gi~~Si~iAQa~LESgwG~S   46 (147)
T smart00047        9 LEFVGKIFNEAQKAYQINGVYPSILIAQAALESGWGTS   46 (147)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHCCCCCC
T ss_conf             99999999999999998499989999999997448877