HHsearch alignment of GI: 254780308 and MMDB domain: 2fbd_A_

>2fbd_A (A:) Lysozyme 1; digestive lysozime, hydrolase; HET: PEG; 1.90A {Musca domestica} PDB: 2h5z_A* 3cb7_A
Probab=96.42  E-value=0.0078  Score=37.39  Aligned_cols=94  Identities=19%  Similarity=0.254  Sum_probs=67.8

Q ss_pred             HHHHHHHHHHCCCHHHH---HHHHHCCCCCHHHCCCCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHCCCCCH-HCCCC
Q ss_conf             69999999838998894---452310022101025641899998753275315665478999999864387770-00367
Q gi|254780308|r  116 RLLINLKKEYGVPPGIL---MALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISS-HALGA  191 (288)
Q Consensus       116 ~~L~~ie~~yGV~~~ii---~AiwGiET~yG~~~G~~~vl~aLaTLA~d~RR~~ff~~el~a~l~~~~~g~~~~-~~~GS  191 (288)
                      =.|.++-++||||+..|   |||.-.||+|=..                                     -+.+ +.-||
T Consensus         6 Cela~~~~~~gi~~~~L~~wvaIa~~ES~~~~~-------------------------------------Av~~~n~ngs   48 (122)
T 2fbd_A            6 CSLAREMYALGVPKSELPQWTCIAEHESSYRTN-------------------------------------VVGPTNSNGS   48 (122)
T ss_dssp             HHHHHHHHHTTCCGGGHHHHHHHHHHHHTTBSS-------------------------------------CBCCCCTTSC
T ss_pred             HHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCC-------------------------------------CEECCCCCCC
T ss_conf             899999999599887999999999998289704-------------------------------------1317778998


Q ss_pred             CCCCCCCCCCCHHHHHHC---CCCCCCCCCC---CCCCCHHHHHHHHHHHHHHCCCCCCCCCC
Q ss_conf             523578666552244421---5367899987---88789888999999999972988858976
Q gi|254780308|r  192 TFGEIGQFQFLPVNVVKY---AIDADEDGKI---DLVKSNIDAIASAAKFLAKLGWTKCAGYQ  248 (288)
Q Consensus       192 ~aGa~G~~QFmPs~~~~y---avD~dgdG~~---dl~~~~~Da~aS~AnyL~~~GW~~g~~~~  248 (288)
                        ...|.+|..+..+-..   ++..++.+..   .|-.++.|.+.-++-+|+.+|++.+..|.
T Consensus        49 --~d~GlmQIn~~~~~~~~~~~~~~~~c~~~c~~ll~~D~~~ni~ca~~il~~~g~~~w~~W~  109 (122)
T 2fbd_A           49 --NDYGIFQINNYYWCQPSNGRFSYNECHLSCDALLTDNISNSVTCARKIKSQQGWTAWSTWK  109 (122)
T ss_dssp             --CEETTTTEETTTTSBCTTCCCCCCTTCSBGGGGGSSSCHHHHHHHHHHHHHHCGGGSTTHH
T ss_pred             --CCCCEEEECHHHHHHCCCCCCCCCCCCCCHHHHCCCCHHHHHHHHHHHHHHCCCCCCCCCC
T ss_conf             --6655056322766503568888664558599981687799999999999974877682540