HHsearch alignment of GI: 254780308 and MMDB domain: 2vb1_A_

>2vb1_A (A:) Lysozyme C; antimicrobial, triclinic HEWL, atomic resolution, allergen, hydrolase, glycosidase, bacteriolytic enzyme; HET: EDO; 0.65A {Gallus gallus}
Probab=96.53  E-value=0.00097  Score=42.87  Aligned_cols=83  Identities=12%  Similarity=-0.034  Sum_probs=49.8

Q ss_pred             HHHHHHHHHCCCHHHHHHHHHCCCCCHHHCCCCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHCCCCCHHCCCCCCCCC
Q ss_conf             99999998389988944523100221010256418999987532753156654789999998643877700036752357
Q gi|254780308|r  117 LLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEI  196 (288)
Q Consensus       117 ~L~~ie~~yGV~~~ii~AiwGiET~yG~~~G~~~vl~aLaTLA~d~RR~~ff~~el~a~l~~~~~g~~~~~~~GS~aGa~  196 (288)
                      .+..+.++|||||.+|+||.-+||+|=-.                                     .+.+  .+--.+++
T Consensus        13 ~~~~~a~~~~v~~~ll~ai~~~ES~~np~-------------------------------------a~s~--~~~gs~~~   53 (129)
T 2vb1_A           13 KRHGLDNYRGYSLGNWVCAAKFESNFNTQ-------------------------------------ATNR--NTDGSTDY   53 (129)
T ss_dssp             HHTTCTTBTTBCHHHHHHHHHHHHTTBTT-------------------------------------CEEE--CTTSCEEE
T ss_pred             HHCCCCCCCCCCHHHHHHHHHHHCCCCCC-------------------------------------CCCC--CCCCCCCC
T ss_conf             98599855545488889998875268674-------------------------------------6235--89998766


Q ss_pred             CCCCCCHHHHHHCCCCCC-CCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             866655224442153678-999878878988899999999997
Q gi|254780308|r  197 GQFQFLPVNVVKYAIDAD-EDGKIDLVKSNIDAIASAAKFLAK  238 (288)
Q Consensus       197 G~~QFmPs~~~~yavD~d-gdG~~dl~~~~~Da~aS~AnyL~~  238 (288)
                      |+||+||.++-..+..+- .+.-.|.-.++.+.+...+-||..
T Consensus        54 GlmQi~~~~~~~~~~~~g~~~~~~~~~~n~~~ni~~ga~~l~~   96 (129)
T 2vb1_A           54 GILQINSRWWCNDGRTPGSRNLCNIPCSALLSSDITASVNCAK   96 (129)
T ss_dssp             TTTTEETTTTCBCSSCTTCCCTTCSBGGGGGCSSCHHHHHHHH
T ss_pred             CEEEECCCCCCCCCCCCCCCCCCCCCHHHHCCCCCHHHHHHHH
T ss_conf             6166435102559999998786789889984887089999999