HHsearch results for GI: 254780308 and protein with PDBid: 2zyc_A

>2zyc_A Peptidoglycan hydrolase FLGJ; 1.74A {Sphingomonas SP}
Probab=96.46  E-value=0.0019  Score=40.20  Aligned_cols=39  Identities=28%  Similarity=0.345  Sum_probs=35.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCCCHHH
Q ss_conf             999853234699999998389988944523100221010
Q gi|254780308|r  107 GIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGET  145 (288)
Q Consensus       107 Gr~~~~~~~~~L~~ie~~yGV~~~ii~AiwGiET~yG~~  145 (288)
                      .++|.++....=.++.++|||||++++|-+.+||.+|+.
T Consensus         2 ~~~Fi~~~~~~A~~~a~~~GIp~si~lAQA~lESGwG~S   40 (170)
T 2zyc_A            2 AQAFVDATWPQAAKAAQSLGVPAHFLVAQAALETGWGKS   40 (170)
T ss_dssp             CHHHHHHHHHHHHHHHHHHTSCHHHHHHHHHHHHTTTTT
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHCCCCCC
T ss_conf             699999999999999999397989999999998479987