BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780308|ref|YP_003064721.1| putative membrane-bound lytic
murein transglycosylase signal peptide protein [Candidatus
Liberibacter asiaticus str. psy62]
         (288 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780308|ref|YP_003064721.1| putative membrane-bound lytic murein transglycosylase signal
           peptide protein [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254039985|gb|ACT56781.1| putative membrane-bound lytic murein transglycosylase signal
           peptide protein [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 288

 Score =  595 bits (1533), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 288/288 (100%), Positives = 288/288 (100%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSP 60
           MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSP
Sbjct: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSP 60

Query: 61  KTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLIN 120
           KTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLIN
Sbjct: 61  KTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLIN 120

Query: 121 LKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVK 180
           LKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVK
Sbjct: 121 LKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVK 180

Query: 181 KGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLG 240
           KGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLG
Sbjct: 181 KGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLG 240

Query: 241 WTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHIDGVPIGKGYDT 288
           WTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHIDGVPIGKGYDT
Sbjct: 241 WTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHIDGVPIGKGYDT 288


>gi|315122267|ref|YP_004062756.1| putative membrane-bound lytic murein transglycosylase signal
           peptide protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495669|gb|ADR52268.1| putative membrane-bound lytic murein transglycosylase signal
           peptide protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 171

 Score =  231 bits (590), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 107/166 (64%), Positives = 128/166 (77%)

Query: 121 LKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVK 180
           ++K+YGVP GIL+ LWGLE+ FG+ MG+ P  STLATLAYDCRR+  FTEQFF AL+LV 
Sbjct: 5   IQKDYGVPAGILITLWGLESRFGDRMGEVPTFSTLATLAYDCRRSALFTEQFFVALELVN 64

Query: 181 KGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLG 240
           +G+IS+ + GA  GEIG FQFLP NV K+++D D DGK  ++ SNIDAI SAA FL K G
Sbjct: 65  QGIISAESRGALHGEIGPFQFLPSNVKKFSVDGDGDGKASIITSNIDAIESAANFLKKNG 124

Query: 241 WTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHIDGVPIGKGY 286
           WTK  GYQP EKNF ILK WNAS NY K +AYIAAHIDG+ +  GY
Sbjct: 125 WTKNKGYQPKEKNFLILKRWNASTNYIKAVAYIAAHIDGIRLKDGY 170


>gi|241206916|ref|YP_002978012.1| lytic murein transglycosylase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240860806|gb|ACS58473.1| lytic murein transglycosylase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 290

 Score =  224 bits (572), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 108/245 (44%), Positives = 150/245 (61%), Gaps = 1/245 (0%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDY 94
           C + +  FG W +  +  A   G+S       FA++ Y   TIA DR    S  +SF  +
Sbjct: 46  CGNNSSGFGAWVADFKQEAAANGVSRSVLDRAFANVNYNRPTIAADRGQ-KSFKLSFDAF 104

Query: 95  LDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLST 154
           +     + +I++G ++K AN  L  ++++ +GVP G L+A+WG+ET FG  MG    LS 
Sbjct: 105 MQKRGGATVISRGRSMKAANKALFASIERRFGVPAGPLVAIWGMETGFGSYMGNQHTLSA 164

Query: 155 LATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDAD 214
           ++TLAYDCRR+ +FT+Q + AL LV +G +S  A GA  GEIGQ QFLP NVV++  D D
Sbjct: 165 VSTLAYDCRRSDYFTDQLYAALQLVSEGYLSPQAKGAAHGEIGQTQFLPRNVVRFGADGD 224

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIA 274
            DG++D+V S  DA+AS A FL   GW   AGYQPGE NF  ++ WNA+  Y + IAYI 
Sbjct: 225 GDGRVDMVGSRADALASTANFLKGHGWRAGAGYQPGEPNFVAIQGWNAASVYQQAIAYIG 284

Query: 275 AHIDG 279
             IDG
Sbjct: 285 QQIDG 289


>gi|307316137|ref|ZP_07595581.1| lytic murein transglycosylase [Sinorhizobium meliloti AK83]
 gi|306897977|gb|EFN28719.1| lytic murein transglycosylase [Sinorhizobium meliloti AK83]
          Length = 273

 Score =  223 bits (569), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 109/245 (44%), Positives = 148/245 (60%), Gaps = 1/245 (0%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDY 94
           C +    F  W S  +  A   G+SP       A++ Y   TI  DR    S  +S   +
Sbjct: 29  CGNDGSGFSAWLSEFKREAAGNGISPSVVDQALANVSYSRATIRADRGQ-KSFKLSLDQF 87

Query: 95  LDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLST 154
           +       II++G  L+  N+RL  ++++ YGVP G L+A+WG+ET FG  +GK   LS 
Sbjct: 88  MQKRGGQVIISRGKKLRAQNARLFQSIEQRYGVPAGPLIAIWGMETGFGSFLGKEHTLSA 147

Query: 155 LATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDAD 214
           ++TLAYDCRR+ +FT Q + AL LV++G +S  A GA  GEIGQ QFLPVNV+KY +D D
Sbjct: 148 VSTLAYDCRRSDYFTNQLYAALQLVERGDLSPAARGAAHGEIGQTQFLPVNVLKYGVDGD 207

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIA 274
            +G +D+V+S  DA+AS A FL   GW    GYQPGE NFA ++ WNA+  Y + IA I 
Sbjct: 208 GNGHVDMVRSKADALASTANFLRGHGWQPGGGYQPGEVNFAAIQGWNAASVYQQAIAIIG 267

Query: 275 AHIDG 279
           A IDG
Sbjct: 268 AEIDG 272


>gi|15967070|ref|NP_387423.1| putative membrane-bound lytic murein transglycosylase signal
           peptide protein [Sinorhizobium meliloti 1021]
 gi|307302532|ref|ZP_07582289.1| lytic murein transglycosylase [Sinorhizobium meliloti BL225C]
 gi|15076343|emb|CAC47896.1| Membrane-bound lytic murein transglycosylase [Sinorhizobium
           meliloti 1021]
 gi|306903202|gb|EFN33792.1| lytic murein transglycosylase [Sinorhizobium meliloti BL225C]
          Length = 273

 Score =  223 bits (569), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 109/245 (44%), Positives = 148/245 (60%), Gaps = 1/245 (0%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDY 94
           C +    F  W S  +  A   G+SP       A++ Y   TI  DR    S  +S   +
Sbjct: 29  CGNDGSGFSAWLSEFKREAAGNGISPSVVDQALANVSYSRATIRADRGQ-KSFKLSLDQF 87

Query: 95  LDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLST 154
           +       II++G  L+  N+RL  ++++ YGVP G L+A+WG+ET FG  +GK   LS 
Sbjct: 88  MQKRGGQMIISRGKKLRAQNARLFQSIEQRYGVPAGPLIAIWGMETGFGSFLGKEHTLSA 147

Query: 155 LATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDAD 214
           ++TLAYDCRR+ +FT Q + AL LV++G +S  A GA  GEIGQ QFLPVNV+KY +D D
Sbjct: 148 VSTLAYDCRRSDYFTNQLYAALQLVERGDLSPAARGAAHGEIGQTQFLPVNVLKYGVDGD 207

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIA 274
            +G +D+V+S  DA+AS A FL   GW    GYQPGE NFA ++ WNA+  Y + IA I 
Sbjct: 208 GNGHVDMVRSKADALASTANFLRGHGWQPGGGYQPGEVNFAAIQGWNAASVYQQAIAIIG 267

Query: 275 AHIDG 279
           A IDG
Sbjct: 268 AEIDG 272


>gi|86359679|ref|YP_471571.1| putative membrane-bound lytic murein transglycosylase protein
           [Rhizobium etli CFN 42]
 gi|86283781|gb|ABC92844.1| putative membrane-bound lytic murein transglycosylase protein
           [Rhizobium etli CFN 42]
          Length = 274

 Score =  223 bits (568), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 108/245 (44%), Positives = 150/245 (61%), Gaps = 1/245 (0%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDY 94
           C +T+  F  W +  +  A   G+S       FA++ Y   TIA DR    S  +SF  +
Sbjct: 29  CGNTSAGFDAWVADFKQTAAANGVSQSVLSRAFANVNYNKPTIAADRGQ-KSFKLSFDAF 87

Query: 95  LDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLST 154
           +     + +I++G ++K AN  L  ++++ +GVP G L+A+WG+ET FG  MG    LS 
Sbjct: 88  MQKRGGAAVISRGRSMKAANQALFASIERRFGVPAGPLIAIWGMETGFGSYMGNQHTLSA 147

Query: 155 LATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDAD 214
           ++TLAYDCRR+ +FT+Q + AL LV +G +S  A GA  GEIGQ QFLP NVV++  D D
Sbjct: 148 VSTLAYDCRRSDYFTDQLYAALQLVSEGYLSPQAKGAAHGEIGQTQFLPRNVVRFGADGD 207

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIA 274
            DG++D+V S  DA+AS A FL   GW   AGYQPGE NF  ++ WNA+  Y + IAYI 
Sbjct: 208 GDGRVDMVGSRADALASTANFLKGHGWRAGAGYQPGEPNFTAIQGWNAASVYQQAIAYIG 267

Query: 275 AHIDG 279
             IDG
Sbjct: 268 QQIDG 272


>gi|209551480|ref|YP_002283397.1| lytic murein transglycosylase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|209537236|gb|ACI57171.1| lytic murein transglycosylase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 273

 Score =  223 bits (568), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 108/245 (44%), Positives = 151/245 (61%), Gaps = 1/245 (0%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDY 94
           C +T+  F  W +  +  A   G+S       FA++ Y   TIA DR    S  +SF  +
Sbjct: 29  CGNTSAGFEAWVADFKQTAAANGVSQAVLSRAFANVNYNKPTIAADRGQ-KSFKLSFDAF 87

Query: 95  LDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLST 154
           +     + +I++G ++K AN  L  ++++ +GVP G L+A+WG+ET FG  MG    LS 
Sbjct: 88  MQKRGGTAVISRGRSMKAANQALFASIERRFGVPAGPLIAIWGMETGFGSYMGNQHTLSA 147

Query: 155 LATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDAD 214
           ++TLAYDCRR+ +FT+Q + AL LV +G +S  A GA  GEIGQ QFLP NVV++  D D
Sbjct: 148 VSTLAYDCRRSDYFTDQLYAALQLVSEGYLSPQAKGAAHGEIGQTQFLPRNVVRFGADGD 207

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIA 274
            DG++D+V S  DA+AS A FL   GW   AGYQPGE NF  ++ WNA+  Y ++IAYI 
Sbjct: 208 GDGRVDMVGSRADALASTANFLKGHGWRAGAGYQPGEPNFVAIQGWNAASVYQQSIAYIG 267

Query: 275 AHIDG 279
             IDG
Sbjct: 268 QQIDG 272


>gi|222087909|ref|YP_002546447.1| membrane-bound lytic murein transglycosylase protein [Agrobacterium
           radiobacter K84]
 gi|221725357|gb|ACM28513.1| membrane-bound lytic murein transglycosylase protein [Agrobacterium
           radiobacter K84]
          Length = 273

 Score =  223 bits (568), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 110/245 (44%), Positives = 151/245 (61%), Gaps = 1/245 (0%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDY 94
           CS+T+  F  W    +  A  +G+S  T    FA++ Y   TI  DR    S  +SF ++
Sbjct: 29  CSNTSAGFDNWVREFKQEAQGQGISQSTLDRAFANVHYNQPTIRADRGQ-KSFKLSFDEF 87

Query: 95  LDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLST 154
           +       II++G ++K+AN+ L   ++K YGVPPG ++A+WG+ET FG  MG    LS 
Sbjct: 88  MKKRGGQTIISRGKSMKQANAALFSRIEKRYGVPPGPIIAIWGMETGFGSFMGDQNTLSA 147

Query: 155 LATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDAD 214
           ++TLA+DCRR+ +FT+Q + AL LV +G +S  A GA  GEIGQ QF+P NVV Y +D D
Sbjct: 148 VSTLAFDCRRSAYFTDQLYAALKLVGEGYLSPSARGAAHGEIGQTQFMPKNVVLYGVDGD 207

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIA 274
            DGK+DLV S  DA++S A FL   GW   A YQPGE NF+ +  WN +  Y + IAYI 
Sbjct: 208 GDGKVDLVGSRADALSSTANFLKGHGWQAGAPYQPGEPNFSAIGGWNDARVYQEAIAYIG 267

Query: 275 AHIDG 279
             IDG
Sbjct: 268 KQIDG 272


>gi|190893955|ref|YP_001980497.1| membrane-bound lytic murein transglycosylase [Rhizobium etli CIAT
           652]
 gi|190699234|gb|ACE93319.1| putative membrane-bound lytic murein transglycosylase protein
           [Rhizobium etli CIAT 652]
 gi|327191231|gb|EGE58274.1| putative membrane-bound lytic murein transglycosylase protein
           [Rhizobium etli CNPAF512]
          Length = 274

 Score =  223 bits (567), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 108/245 (44%), Positives = 150/245 (61%), Gaps = 1/245 (0%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDY 94
           C +T+  F  W +  +  A   G+S       FA++ Y   TIA DR    S  +SF  +
Sbjct: 29  CGNTSAGFDAWVADFKQTAAANGVSQSVLSRAFANVNYNKPTIAADRGQ-KSFKLSFDAF 87

Query: 95  LDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLST 154
           +     + +I++G ++K AN  L  ++++ +GVP G L+A+WG+ET FG  MG    LS 
Sbjct: 88  MQKRGGAAVISRGRSMKAANQALFASIERRFGVPAGPLIAIWGMETGFGSYMGNQHTLSA 147

Query: 155 LATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDAD 214
           ++TLAYDCRR+ +FT+Q + AL LV +G +S  A GA  GEIGQ QFLP NVV++  D D
Sbjct: 148 VSTLAYDCRRSDYFTDQLYAALQLVSEGYLSPQAKGAAHGEIGQTQFLPRNVVRFGADGD 207

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIA 274
            DG++D+V S  DA+AS A FL   GW   AGYQPGE NF  ++ WNA+  Y + IAYI 
Sbjct: 208 GDGRVDMVGSRADALASTANFLKGHGWRAGAGYQPGEPNFVAIQGWNAASVYQQAIAYIG 267

Query: 275 AHIDG 279
             IDG
Sbjct: 268 QQIDG 272


>gi|159185238|ref|NP_355437.2| hypothetical protein Atu2489 [Agrobacterium tumefaciens str. C58]
 gi|159140500|gb|AAK88222.2| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 271

 Score =  222 bits (565), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 109/245 (44%), Positives = 152/245 (62%), Gaps = 1/245 (0%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDY 94
           C +T+  F  W SA +  A   G+S       F+ + Y   TI  DR    S  +SF+ +
Sbjct: 27  CGNTSAGFDAWVSAFKQEAAGRGVSASVLDRAFSGVSYNQATIRADRGQ-HSFKLSFEQF 85

Query: 95  LDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLST 154
           +       II++G  +KK N+ L  ++++ YGVP G L+A+WG+ET FG  MG    LS 
Sbjct: 86  MQKRGGQTIISRGKTMKKNNAALFASIERTYGVPAGPLLAIWGMETGFGGFMGNQHTLSA 145

Query: 155 LATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDAD 214
           +ATL++DCRR+ +FTEQ + AL LV  G ++ +A GA  GEIGQ QFLP+NVV+Y +D D
Sbjct: 146 VATLSFDCRRSDYFTEQLYAALKLVGSGSLNVNAKGAAHGEIGQTQFLPLNVVRYGVDFD 205

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIA 274
            DG+IDLV S  DA+AS A FL   GW + AGYQ G+ +FA ++ WNA+  Y + IA+I 
Sbjct: 206 RDGRIDLVGSRADALASTANFLVGHGWQRGAGYQQGQPSFAAIQGWNAASVYQQAIAFIG 265

Query: 275 AHIDG 279
             IDG
Sbjct: 266 KAIDG 270


>gi|163757436|ref|ZP_02164525.1| putative membrane-bound lytic murein transglycosylase signal
           peptide protein [Hoeflea phototrophica DFL-43]
 gi|162284938|gb|EDQ35220.1| putative membrane-bound lytic murein transglycosylase signal
           peptide protein [Hoeflea phototrophica DFL-43]
          Length = 272

 Score =  221 bits (563), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 114/268 (42%), Positives = 159/268 (59%), Gaps = 5/268 (1%)

Query: 11  LLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADL 70
           +L     +LA  ++ P  +     C + +  F  W    +  A R G+S +T    FA++
Sbjct: 9   MLWSAATLLAMGLSTPAMSAQ---CGNNSAGFPAWIEQFKKEAARAGISDRTISRAFANV 65

Query: 71  EYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPG 130
            Y   TI+ DR    S  +SF+ ++    ++ II+QG  LK+ N+RL   L+++YGVP G
Sbjct: 66  RYASKTISLDRNQ-RSFKLSFEQFMQKRGANSIISQGKKLKQRNARLFNALEQKYGVPAG 124

Query: 131 ILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALG 190
            L+A+WG+E+ FG   G    +S +ATLAYDCRR+ FFTEQ +  L L++KG +S    G
Sbjct: 125 PLIAIWGMESGFGRFSGNQHTMSAVATLAYDCRRSAFFTEQLYAQLQLIQKGWLSPDFKG 184

Query: 191 ATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPG 250
           A  GEIGQ QFLP NVV++ +D D +G I+L  S  DA+AS A FL   GW +  GYQPG
Sbjct: 185 AAHGEIGQTQFLPANVVRFGVDGDRNGSINL-GSTADALASTANFLRGHGWKRGGGYQPG 243

Query: 251 EKNFAILKHWNASLNYNKTIAYIAAHID 278
           E NF  +K WNA+  Y K IA I A ID
Sbjct: 244 ETNFRAIKGWNAAGVYQKAIAKIGAEID 271


>gi|325293843|ref|YP_004279707.1| lytic murein transglycosylase [Agrobacterium sp. H13-3]
 gi|325061696|gb|ADY65387.1| lytic murein transglycosylase [Agrobacterium sp. H13-3]
          Length = 259

 Score =  221 bits (563), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 109/245 (44%), Positives = 150/245 (61%), Gaps = 1/245 (0%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDY 94
           C +T+  F  W  A +  A   G+S       F+ + Y   TI  DR    S  +SF  +
Sbjct: 15  CGNTSAGFDAWVGAFKQEAASRGVSASVLDRAFSGVSYNQPTIRADRGQ-HSFKLSFDQF 73

Query: 95  LDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLST 154
           +       II++G  +KK N+ L  +++K YGVP G L+A+WG+ET FG  MG    LS 
Sbjct: 74  MQKRGGQTIISRGKTMKKNNAALFASIEKAYGVPAGPLLAIWGMETGFGGFMGNQHTLSA 133

Query: 155 LATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDAD 214
           +ATL++DCRR+ +FTEQ + AL LV  G ++ +A GA  GEIGQ QFLP+NVV+Y +D D
Sbjct: 134 VATLSFDCRRSDYFTEQLYAALKLVGSGSLNVNAKGAAHGEIGQTQFLPLNVVRYGVDFD 193

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIA 274
            DG+IDLV S  DA+AS A FL   GW + AGYQ G+ N+A ++ WNA+  Y + IA+I 
Sbjct: 194 RDGRIDLVGSRADALASTANFLVGHGWQRGAGYQQGQTNYAAIQGWNAASVYQQAIAFIG 253

Query: 275 AHIDG 279
             IDG
Sbjct: 254 KAIDG 258


>gi|116254440|ref|YP_770278.1| hypothetical protein RL4716 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115259088|emb|CAK10199.1| conserved hypothetical exported protein [Rhizobium leguminosarum
           bv. viciae 3841]
          Length = 273

 Score =  221 bits (562), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 107/245 (43%), Positives = 149/245 (60%), Gaps = 1/245 (0%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDY 94
           C + +  F  W +  +  A   G+S       FA++ Y   TIA DR    S  +SF  +
Sbjct: 29  CGNNSSGFNAWVADFKQEAAANGVSRSVLDRAFANVNYNRPTIAADRGQ-KSFKLSFDAF 87

Query: 95  LDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLST 154
           +     + II++G ++K +N  L  ++++ +GVP G L+A+WG+ET FG  MG    LS 
Sbjct: 88  MQKRGGATIISRGRSMKASNKALFASIERRFGVPAGPLIAIWGMETGFGSYMGNQHTLSA 147

Query: 155 LATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDAD 214
           ++TLAYDCRR ++FT+Q + AL LV +G +S  A GA  GEIGQ QFLP NVV++  D D
Sbjct: 148 VSTLAYDCRRTEYFTDQLYAALQLVAEGYLSPQAKGAAHGEIGQTQFLPRNVVRFGADGD 207

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIA 274
            DG++D+V S  DA+AS A FL   GW   AGYQPGE NF  ++ WNA+  Y + IAYI 
Sbjct: 208 GDGRVDMVGSRADALASTANFLKGHGWRAGAGYQPGEPNFVAIQGWNAASVYQQAIAYIG 267

Query: 275 AHIDG 279
             IDG
Sbjct: 268 QQIDG 272


>gi|225628379|ref|ZP_03786413.1| lytic murein transglycosylase [Brucella ceti str. Cudo]
 gi|225616225|gb|EEH13273.1| lytic murein transglycosylase [Brucella ceti str. Cudo]
          Length = 291

 Score =  215 bits (547), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 112/278 (40%), Positives = 159/278 (57%), Gaps = 12/278 (4%)

Query: 2   SFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPK 61
           S+    +I++ MM    +A+A            C + A  +  W       A   G+  K
Sbjct: 25  SWTAAAVIAVGMMAGAGIAEAAQ----------CGNNAAGYNAWLQQTMKEAASRGIG-K 73

Query: 62  TAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINL 121
              +  A+ +Y   TI  DR    S  +SF+ ++    +  II +G A+K+ N+ L  N+
Sbjct: 74  AGINALANTKYAQATINADRNQ-KSFKLSFEQFMQKRGADTIIKRGRAMKQQNAALFANI 132

Query: 122 KKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKK 181
           +K YGVP G L+A+WG+ET FG  MGK   LS +ATLAYDCRR+ +FT+Q + AL L+ +
Sbjct: 133 EKRYGVPAGPLIAIWGMETGFGSYMGKQHTLSAVATLAYDCRRSDYFTDQLYAALKLIDR 192

Query: 182 GVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
             +S  A+GA  GEIGQ QFLPVNV+ Y +D D  G ID+ +S  DA+ S A FL   GW
Sbjct: 193 EDLSPAAIGAMHGEIGQTQFLPVNVLNYGVDGDGSGHIDMARSKADALYSTANFLVGHGW 252

Query: 242 TKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHIDG 279
            + AGYQPGE N+A ++ WNA+  Y + IA +   IDG
Sbjct: 253 QRGAGYQPGEPNYAAIQGWNAAQVYQRAIAVMGKAIDG 290


>gi|23502681|ref|NP_698808.1| lytic murein transglycosylase [Brucella suis 1330]
 gi|148559968|ref|YP_001259664.1| putative lytic murein transglycosylase [Brucella ovis ATCC 25840]
 gi|161619747|ref|YP_001593634.1| lytic murein transglycosylase [Brucella canis ATCC 23365]
 gi|163845405|ref|YP_001623060.1| lytic murein transglycosylase [Brucella suis ATCC 23445]
 gi|225853270|ref|YP_002733503.1| lytic murein transglycosylase [Brucella melitensis ATCC 23457]
 gi|254700469|ref|ZP_05162297.1| lytic murein transglycosylase [Brucella suis bv. 5 str. 513]
 gi|254703592|ref|ZP_05165420.1| lytic murein transglycosylase [Brucella suis bv. 3 str. 686]
 gi|254708826|ref|ZP_05170637.1| lytic murein transglycosylase [Brucella pinnipedialis B2/94]
 gi|254714666|ref|ZP_05176477.1| lytic murein transglycosylase [Brucella ceti M644/93/1]
 gi|254717564|ref|ZP_05179375.1| lytic murein transglycosylase [Brucella ceti M13/05/1]
 gi|256030352|ref|ZP_05443966.1| lytic murein transglycosylase [Brucella pinnipedialis M292/94/1]
 gi|256045425|ref|ZP_05448317.1| lytic murein transglycosylase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256114400|ref|ZP_05455125.1| lytic murein transglycosylase [Brucella melitensis bv. 3 str.
           Ether]
 gi|256160522|ref|ZP_05458211.1| lytic murein transglycosylase [Brucella ceti M490/95/1]
 gi|256255728|ref|ZP_05461264.1| lytic murein transglycosylase [Brucella ceti B1/94]
 gi|256263242|ref|ZP_05465774.1| lytic Murein transglycosylase [Brucella melitensis bv. 2 str. 63/9]
 gi|256370232|ref|YP_003107743.1| lytic murein transglycosylase, putative [Brucella microti CCM 4915]
 gi|260168025|ref|ZP_05754836.1| lytic murein transglycosylase, putative [Brucella sp. F5/99]
 gi|260565684|ref|ZP_05836167.1| lytic murein transglycosylase [Brucella melitensis bv. 1 str. 16M]
 gi|260568898|ref|ZP_05839366.1| lytic murein transglycosylase [Brucella suis bv. 4 str. 40]
 gi|261219399|ref|ZP_05933680.1| lytic Murein transglycosylase [Brucella ceti M13/05/1]
 gi|261222943|ref|ZP_05937224.1| lytic Murein transglycosylase [Brucella ceti B1/94]
 gi|261316320|ref|ZP_05955517.1| lytic Murein transglycosylase [Brucella pinnipedialis B2/94]
 gi|261322461|ref|ZP_05961658.1| lytic Murein transglycosylase [Brucella ceti M644/93/1]
 gi|261750973|ref|ZP_05994682.1| lytic Murein transglycosylase [Brucella suis bv. 5 str. 513]
 gi|261754227|ref|ZP_05997936.1| lytic Murein transglycosylase [Brucella suis bv. 3 str. 686]
 gi|261757473|ref|ZP_06001182.1| lytic Murein transglycosylase [Brucella sp. F5/99]
 gi|265987389|ref|ZP_06099946.1| lytic Murein transglycosylase [Brucella pinnipedialis M292/94/1]
 gi|265991855|ref|ZP_06104412.1| lytic Murein transglycosylase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265995694|ref|ZP_06108251.1| lytic Murein transglycosylase [Brucella melitensis bv. 3 str.
           Ether]
 gi|265998902|ref|ZP_06111459.1| lytic Murein transglycosylase [Brucella ceti M490/95/1]
 gi|294851066|ref|ZP_06791742.1| membrane-bound lytic murein transglycosylase B [Brucella sp. NVSL
           07-0026]
 gi|23348692|gb|AAN30723.1| lytic murein transglycosylase, putative [Brucella suis 1330]
 gi|148371225|gb|ABQ61204.1| putative lytic murein transglycosylase [Brucella ovis ATCC 25840]
 gi|161336558|gb|ABX62863.1| lytic murein transglycosylase [Brucella canis ATCC 23365]
 gi|163676128|gb|ABY40238.1| lytic murein transglycosylase [Brucella suis ATCC 23445]
 gi|225641635|gb|ACO01549.1| lytic murein transglycosylase [Brucella melitensis ATCC 23457]
 gi|256000395|gb|ACU48794.1| lytic murein transglycosylase, putative [Brucella microti CCM 4915]
 gi|260151057|gb|EEW86152.1| lytic murein transglycosylase [Brucella melitensis bv. 1 str. 16M]
 gi|260154282|gb|EEW89364.1| lytic murein transglycosylase [Brucella suis bv. 4 str. 40]
 gi|260921527|gb|EEX88180.1| lytic Murein transglycosylase [Brucella ceti B1/94]
 gi|260924488|gb|EEX91056.1| lytic Murein transglycosylase [Brucella ceti M13/05/1]
 gi|261295151|gb|EEX98647.1| lytic Murein transglycosylase [Brucella ceti M644/93/1]
 gi|261295543|gb|EEX99039.1| lytic Murein transglycosylase [Brucella pinnipedialis B2/94]
 gi|261737457|gb|EEY25453.1| lytic Murein transglycosylase [Brucella sp. F5/99]
 gi|261740726|gb|EEY28652.1| lytic Murein transglycosylase [Brucella suis bv. 5 str. 513]
 gi|261743980|gb|EEY31906.1| lytic Murein transglycosylase [Brucella suis bv. 3 str. 686]
 gi|262553591|gb|EEZ09360.1| lytic Murein transglycosylase [Brucella ceti M490/95/1]
 gi|262766978|gb|EEZ12596.1| lytic Murein transglycosylase [Brucella melitensis bv. 3 str.
           Ether]
 gi|263002811|gb|EEZ15214.1| lytic Murein transglycosylase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263093203|gb|EEZ17300.1| lytic Murein transglycosylase [Brucella melitensis bv. 2 str. 63/9]
 gi|264659586|gb|EEZ29847.1| lytic Murein transglycosylase [Brucella pinnipedialis M292/94/1]
 gi|294821709|gb|EFG38705.1| membrane-bound lytic murein transglycosylase B [Brucella sp. NVSL
           07-0026]
 gi|326409831|gb|ADZ66896.1| lytic murein transglycosylase [Brucella melitensis M28]
 gi|326539547|gb|ADZ87762.1| lytic murein transglycosylase [Brucella melitensis M5-90]
          Length = 275

 Score =  215 bits (547), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 112/278 (40%), Positives = 159/278 (57%), Gaps = 12/278 (4%)

Query: 2   SFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPK 61
           S+    +I++ MM    +A+A            C + A  +  W       A   G+  K
Sbjct: 9   SWTAAAVIAVGMMAGAGIAEAAQ----------CGNNAAGYNAWLQQTMKEAASRGIG-K 57

Query: 62  TAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINL 121
              +  A+ +Y   TI  DR    S  +SF+ ++    +  II +G A+K+ N+ L  N+
Sbjct: 58  AGINALANTKYAQATINADRNQ-KSFKLSFEQFMQKRGADTIIKRGRAMKQQNAALFANI 116

Query: 122 KKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKK 181
           +K YGVP G L+A+WG+ET FG  MGK   LS +ATLAYDCRR+ +FT+Q + AL L+ +
Sbjct: 117 EKRYGVPAGPLIAIWGMETGFGSYMGKQHTLSAVATLAYDCRRSDYFTDQLYAALKLIDR 176

Query: 182 GVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
             +S  A+GA  GEIGQ QFLPVNV+ Y +D D  G ID+ +S  DA+ S A FL   GW
Sbjct: 177 EDLSPAAIGAMHGEIGQTQFLPVNVLNYGVDGDGSGHIDMARSKADALYSTANFLVGHGW 236

Query: 242 TKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHIDG 279
            + AGYQPGE N+A ++ WNA+  Y + IA +   IDG
Sbjct: 237 QRGAGYQPGEPNYAAIQGWNAAQVYQRAIAVMGKAIDG 274


>gi|254719814|ref|ZP_05181625.1| lytic murein transglycosylase [Brucella sp. 83/13]
 gi|265984833|ref|ZP_06097568.1| lytic Murein transglycosylase [Brucella sp. 83/13]
 gi|306839512|ref|ZP_07472320.1| lytic murein transglycosylase [Brucella sp. NF 2653]
 gi|264663425|gb|EEZ33686.1| lytic Murein transglycosylase [Brucella sp. 83/13]
 gi|306405457|gb|EFM61728.1| lytic murein transglycosylase [Brucella sp. NF 2653]
          Length = 275

 Score =  215 bits (547), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 112/278 (40%), Positives = 159/278 (57%), Gaps = 12/278 (4%)

Query: 2   SFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPK 61
           S+    +I++ MM    +A+A            C + A  +  W       A   G+  K
Sbjct: 9   SWTAAAVIAVGMMTGAGIAEAAQ----------CGNNAAGYNAWLQQTMKEAASRGIG-K 57

Query: 62  TAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINL 121
              +  A+ +Y   TI  DR    S  +SF+ ++    +  II +G A+K+ N+ L  N+
Sbjct: 58  AGINALANTKYAQATINADRNQ-KSFKLSFEQFMQKRGADTIIKRGRAMKQQNAALFANI 116

Query: 122 KKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKK 181
           +K YGVP G L+A+WG+ET FG  MGK   LS +ATLAYDCRR+ +FT+Q + AL L+ +
Sbjct: 117 EKRYGVPAGPLIAIWGMETGFGSYMGKQHTLSAVATLAYDCRRSDYFTDQLYAALKLIDR 176

Query: 182 GVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
             +S  A+GA  GEIGQ QFLPVNV+ Y +D D  G ID+ +S  DA+ S A FL   GW
Sbjct: 177 EDLSPAAIGAMHGEIGQTQFLPVNVLNYGVDGDGSGHIDMARSKADALYSTANFLVGHGW 236

Query: 242 TKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHIDG 279
            + AGYQPGE N+A ++ WNA+  Y + IA +   IDG
Sbjct: 237 QRGAGYQPGEPNYAAIQGWNAAQVYQRAIAVMGKAIDG 274


>gi|306841606|ref|ZP_07474303.1| lytic murein transglycosylase [Brucella sp. BO2]
 gi|306844809|ref|ZP_07477394.1| lytic murein transglycosylase [Brucella sp. BO1]
 gi|306274981|gb|EFM56751.1| lytic murein transglycosylase [Brucella sp. BO1]
 gi|306288352|gb|EFM59715.1| lytic murein transglycosylase [Brucella sp. BO2]
          Length = 275

 Score =  214 bits (546), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 112/278 (40%), Positives = 159/278 (57%), Gaps = 12/278 (4%)

Query: 2   SFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPK 61
           S+    +I++ MM    +A+A            C + A  +  W       A   G+  K
Sbjct: 9   SWTAVAVIAVGMMTGAGIAEAAQ----------CGNNAAGYNAWLQQTMKEAASRGIG-K 57

Query: 62  TAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINL 121
              +  A+ +Y   TI  DR    S  +SF+ ++    +  II +G A+K+ N+ L  N+
Sbjct: 58  AGINALANTKYAQATIRADRSQ-KSFKLSFEQFMQKRGADTIIKRGRAMKQQNAALFANI 116

Query: 122 KKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKK 181
           +K YGVP G L+A+WG+ET FG  MGK   LS +ATLAYDCRR+ +FT+Q + AL L+ +
Sbjct: 117 EKRYGVPAGPLIAIWGMETGFGAYMGKQHTLSAVATLAYDCRRSDYFTDQLYAALKLIDR 176

Query: 182 GVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
             +S  A+GA  GEIGQ QFLPVNV+ Y +D D  G ID+ +S  DA+ S A FL   GW
Sbjct: 177 EDLSPAAIGAMHGEIGQTQFLPVNVLNYGVDGDGSGHIDMARSKADALYSTANFLVGHGW 236

Query: 242 TKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHIDG 279
            + AGYQPGE N+A ++ WNA+  Y + IA +   IDG
Sbjct: 237 QRGAGYQPGEPNYAAIQGWNAAQVYQRAIAVMGKAIDG 274


>gi|17986507|ref|NP_539141.1| membrane-bound lytic murein transglycosylase B [Brucella melitensis
           bv. 1 str. 16M]
 gi|17982110|gb|AAL51405.1| membrane-bound lytic murein transglycosylase b [Brucella melitensis
           bv. 1 str. 16M]
          Length = 255

 Score =  214 bits (545), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 106/245 (43%), Positives = 147/245 (60%), Gaps = 2/245 (0%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDY 94
           C + A  +  W       A   G+  K   +  A+ +Y   TI  DR    S  +SF+ +
Sbjct: 12  CGNNAAGYNAWLQQTMKEAASRGIG-KAGINALANTKYAQATINADRNQ-KSFKLSFEQF 69

Query: 95  LDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLST 154
           +    +  II +G A+K+ N+ L  N++K YGVP G L+A+WG+ET FG  MGK   LS 
Sbjct: 70  MQKRGADTIIKRGRAMKQQNAALFANIEKRYGVPAGPLIAIWGMETGFGSYMGKQHTLSA 129

Query: 155 LATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDAD 214
           +ATLAYDCRR+ +FT+Q + AL L+ +  +S  A+GA  GEIGQ QFLPVNV+ Y +D D
Sbjct: 130 VATLAYDCRRSDYFTDQLYAALKLIDREDLSPAAIGAMHGEIGQTQFLPVNVLNYGVDGD 189

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIA 274
             G ID+ +S  DA+ S A FL   GW + AGYQPGE N+A ++ WNA+  Y + IA + 
Sbjct: 190 GSGHIDMARSKADALYSTANFLVGHGWQRGAGYQPGEPNYAAIQGWNAAQVYQRAIAVMG 249

Query: 275 AHIDG 279
             IDG
Sbjct: 250 KAIDG 254


>gi|237816192|ref|ZP_04595187.1| lytic murein transglycosylase [Brucella abortus str. 2308 A]
 gi|237788654|gb|EEP62867.1| lytic murein transglycosylase [Brucella abortus str. 2308 A]
          Length = 291

 Score =  214 bits (544), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 111/278 (39%), Positives = 158/278 (56%), Gaps = 12/278 (4%)

Query: 2   SFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPK 61
           S+    +I++ MM    +A+A            C + A  +  W       A   G+  K
Sbjct: 25  SWTAAAVIAVGMMAGAGIAEAAQ----------CGNNAAGYNAWLQQTMKEAASRGIG-K 73

Query: 62  TAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINL 121
              +  A+ +Y   TI  DR    S  +SF+ ++    +  II +G A+K+ N+ L  N+
Sbjct: 74  AGINALANTKYAQATINADRNQ-KSFKLSFEQFMQKRGADTIIKRGRAMKQQNAALFANI 132

Query: 122 KKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKK 181
           +K YGVP G L+A+WG+ET FG  MGK   LS +ATLAYDCRR+ +FT+Q + AL L+ +
Sbjct: 133 EKRYGVPAGPLIAIWGMETGFGSYMGKQHTLSAVATLAYDCRRSDYFTDQLYAALKLIDR 192

Query: 182 GVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
             +S  A+GA  GEIGQ QFLPVNV+ Y +D D  G ID+ +S  DA+ S A FL   GW
Sbjct: 193 EDLSPAAIGAMHGEIGQTQFLPVNVLNYGVDGDGSGHIDMARSKADALYSTANFLVGHGW 252

Query: 242 TKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHIDG 279
            +  GYQPGE N+A ++ WNA+  Y + IA +   IDG
Sbjct: 253 QRGGGYQPGEPNYAAIQGWNAAQVYQRAIAVMGKAIDG 290


>gi|62290691|ref|YP_222484.1| lytic murein transglycosylase [Brucella abortus bv. 1 str. 9-941]
 gi|82700606|ref|YP_415180.1| lytic murein transglycosylase [Brucella melitensis biovar Abortus
           2308]
 gi|189024904|ref|YP_001935672.1| lytic murein transglycosylase [Brucella abortus S19]
 gi|254689980|ref|ZP_05153234.1| lytic murein transglycosylase, putative [Brucella abortus bv. 6
           str. 870]
 gi|254694471|ref|ZP_05156299.1| lytic murein transglycosylase, putative [Brucella abortus bv. 3
           str. Tulya]
 gi|254698131|ref|ZP_05159959.1| lytic murein transglycosylase, putative [Brucella abortus bv. 2
           str. 86/8/59]
 gi|254731015|ref|ZP_05189593.1| lytic murein transglycosylase, putative [Brucella abortus bv. 4
           str. 292]
 gi|256258235|ref|ZP_05463771.1| lytic murein transglycosylase, putative [Brucella abortus bv. 9
           str. C68]
 gi|260547071|ref|ZP_05822809.1| lytic murein transglycosylase [Brucella abortus NCTC 8038]
 gi|260755516|ref|ZP_05867864.1| lytic Murein transglycosylase [Brucella abortus bv. 6 str. 870]
 gi|260758739|ref|ZP_05871087.1| lytic Murein transglycosylase [Brucella abortus bv. 4 str. 292]
 gi|260762573|ref|ZP_05874910.1| lytic Murein transglycosylase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260884538|ref|ZP_05896152.1| lytic Murein transglycosylase [Brucella abortus bv. 9 str. C68]
 gi|261214788|ref|ZP_05929069.1| lytic Murein transglycosylase [Brucella abortus bv. 3 str. Tulya]
 gi|297249084|ref|ZP_06932792.1| membrane-bound lytic murein transglycosylase B [Brucella abortus
           bv. 5 str. B3196]
 gi|62196823|gb|AAX75123.1| lytic murein transglycosylase, hypothetical [Brucella abortus bv. 1
           str. 9-941]
 gi|82616707|emb|CAJ11792.1| lytic murein transglycosylase, putative [Brucella melitensis biovar
           Abortus 2308]
 gi|189020476|gb|ACD73198.1| lytic murein transglycosylase, putative [Brucella abortus S19]
 gi|260095436|gb|EEW79314.1| lytic murein transglycosylase [Brucella abortus NCTC 8038]
 gi|260669057|gb|EEX55997.1| lytic Murein transglycosylase [Brucella abortus bv. 4 str. 292]
 gi|260672999|gb|EEX59820.1| lytic Murein transglycosylase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675624|gb|EEX62445.1| lytic Murein transglycosylase [Brucella abortus bv. 6 str. 870]
 gi|260874066|gb|EEX81135.1| lytic Murein transglycosylase [Brucella abortus bv. 9 str. C68]
 gi|260916395|gb|EEX83256.1| lytic Murein transglycosylase [Brucella abortus bv. 3 str. Tulya]
 gi|297174217|gb|EFH33574.1| membrane-bound lytic murein transglycosylase B [Brucella abortus
           bv. 5 str. B3196]
          Length = 275

 Score =  214 bits (544), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 111/278 (39%), Positives = 158/278 (56%), Gaps = 12/278 (4%)

Query: 2   SFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPK 61
           S+    +I++ MM    +A+A            C + A  +  W       A   G+  K
Sbjct: 9   SWTAAAVIAVGMMAGAGIAEAAQ----------CGNNAAGYNAWLQQTMKEAASRGIG-K 57

Query: 62  TAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINL 121
              +  A+ +Y   TI  DR    S  +SF+ ++    +  II +G A+K+ N+ L  N+
Sbjct: 58  AGINALANTKYAQATINADRNQ-KSFKLSFEQFMQKRGADTIIKRGRAMKQQNAALFANI 116

Query: 122 KKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKK 181
           +K YGVP G L+A+WG+ET FG  MGK   LS +ATLAYDCRR+ +FT+Q + AL L+ +
Sbjct: 117 EKRYGVPAGPLIAIWGMETGFGSYMGKQHTLSAVATLAYDCRRSDYFTDQLYAALKLIDR 176

Query: 182 GVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
             +S  A+GA  GEIGQ QFLPVNV+ Y +D D  G ID+ +S  DA+ S A FL   GW
Sbjct: 177 EDLSPAAIGAMHGEIGQTQFLPVNVLNYGVDGDGSGHIDMARSKADALYSTANFLVGHGW 236

Query: 242 TKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHIDG 279
            +  GYQPGE N+A ++ WNA+  Y + IA +   IDG
Sbjct: 237 QRGGGYQPGEPNYAAIQGWNAAQVYQRAIAVMGKAIDG 274


>gi|227823833|ref|YP_002827806.1| putative lytic murein transglycosylase [Sinorhizobium fredii
           NGR234]
 gi|227342835|gb|ACP27053.1| putative lytic murein transglycosylase [Sinorhizobium fredii
           NGR234]
          Length = 273

 Score =  213 bits (541), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 104/245 (42%), Positives = 147/245 (60%), Gaps = 1/245 (0%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDY 94
           C   A  F  W +  +  A   G+S        A++ Y   TI  DR    S  +S   +
Sbjct: 29  CGSNAGGFSAWVAEFKREAAGNGISSSALNAALANVSYSRATIRADRGQ-KSFKLSLDQF 87

Query: 95  LDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLST 154
           +       II++G  ++  N+ L  ++++ YGVP G L+A+WG+ET FG  MGK   LS 
Sbjct: 88  MQKRGGQAIISRGRKMRAQNAGLFDSIEQRYGVPAGPLIAIWGMETGFGSFMGKEHTLSA 147

Query: 155 LATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDAD 214
           ++TLAYDCRR+ +FT+Q + AL LV++G +S  A GA  GEIGQ QFLP+NV+K+ +D D
Sbjct: 148 VSTLAYDCRRSAYFTDQLYAALQLVERGDLSPAARGAAHGEIGQTQFLPLNVLKFGVDGD 207

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIA 274
            +G +D+V+S  DA+AS A FL   GW    GYQPGE N+A ++ WNA+  Y + IA I 
Sbjct: 208 GNGHVDMVRSKADALASTANFLRGHGWQPGGGYQPGEVNYAAIQGWNAASVYQQAIAIIG 267

Query: 275 AHIDG 279
           A IDG
Sbjct: 268 AEIDG 272


>gi|254708322|ref|ZP_05170150.1| lytic murein transglycosylase [Brucella pinnipedialis M163/99/10]
 gi|261315820|ref|ZP_05955017.1| lytic Murein transglycosylase [Brucella pinnipedialis M163/99/10]
 gi|261304846|gb|EEY08343.1| lytic Murein transglycosylase [Brucella pinnipedialis M163/99/10]
          Length = 275

 Score =  212 bits (540), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 111/278 (39%), Positives = 158/278 (56%), Gaps = 12/278 (4%)

Query: 2   SFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPK 61
           S+    +I++ MM    +A+A            C + A  +  W       A   G+  K
Sbjct: 9   SWTAAAVIAVGMMAGAGIAEAAQ----------CGNNAAGYNAWLQQTMKEAASRGIG-K 57

Query: 62  TAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINL 121
              +  A+ +Y   TI  DR    S  +SF+ ++    +  II +G A+K+ N+ L  N+
Sbjct: 58  AGINALANTKYAQATINADRNQ-KSFKLSFEQFMQKRGADTIIKRGRAMKQQNAALFANI 116

Query: 122 KKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKK 181
           +K YGVP G L+A+WG+ET FG  MGK   LS +ATLAYDC R+ +FT+Q + AL L+ +
Sbjct: 117 EKRYGVPAGPLIAIWGMETGFGSYMGKQHTLSAVATLAYDCHRSDYFTDQLYAALKLIDR 176

Query: 182 GVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
             +S  A+GA  GEIGQ QFLPVNV+ Y +D D  G ID+ +S  DA+ S A FL   GW
Sbjct: 177 EDLSPAAIGAMHGEIGQTQFLPVNVLNYGVDGDGSGHIDMARSKADALYSTANFLVGHGW 236

Query: 242 TKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHIDG 279
            + AGYQPGE N+A ++ WNA+  Y + IA +   IDG
Sbjct: 237 QRGAGYQPGEPNYAAIQGWNAAQVYQRAIAVMGKAIDG 274


>gi|218677792|ref|ZP_03525689.1| putative membrane-bound lytic murein transglycosylase protein
           [Rhizobium etli CIAT 894]
          Length = 285

 Score =  211 bits (537), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 103/237 (43%), Positives = 145/237 (61%), Gaps = 1/237 (0%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDY 94
           C +T+  F  W +  +  A   G+S       FA++ Y   TIA DR    S  +SF  +
Sbjct: 29  CGNTSAGFDAWVADFKQTAAANGVSQSVLSRAFANVNYNKPTIAADRGQ-KSFKLSFDAF 87

Query: 95  LDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLST 154
           +     + +I++G ++K AN  L  ++++ +GVP G L+A+WG+ET FG  MG    LS 
Sbjct: 88  MQKRGGAAVISRGRSMKAANQALFASIERRFGVPAGPLIAIWGMETGFGSYMGNQHTLSA 147

Query: 155 LATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDAD 214
           ++TLAYDCRR+++FT+Q + AL LV +G +S  A GA  GEIGQ QFLP NVV++  D D
Sbjct: 148 VSTLAYDCRRSEYFTDQLYAALQLVSEGYLSPQAKGAAHGEIGQTQFLPRNVVRFGADGD 207

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIA 271
            DG++D+V S  DA+AS A FL   GW   AGYQPGE NF  ++ WNA+  Y   IA
Sbjct: 208 GDGRVDMVGSRADALASTANFLKGHGWRAGAGYQPGEPNFVAIQGWNAASVYQHAIA 264


>gi|150398375|ref|YP_001328842.1| lytic murein transglycosylase [Sinorhizobium medicae WSM419]
 gi|150029890|gb|ABR62007.1| lytic murein transglycosylase [Sinorhizobium medicae WSM419]
          Length = 273

 Score =  209 bits (531), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 100/234 (42%), Positives = 142/234 (60%), Gaps = 1/234 (0%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDY 94
           C +    F  W S  +  A   G++P   +   A++ Y   TI  DR    S  +S   +
Sbjct: 29  CGNDGSGFSAWLSEFKREAAGNGINPSVVEQALANVSYSRATIRADRGQ-KSFKLSLDQF 87

Query: 95  LDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLST 154
           +       II++G  L+  N+RL  ++++ YGVP G L+A+WG+ET FG  +GK   LS 
Sbjct: 88  MQKRGGQVIISRGKKLRAQNARLFQSIEQRYGVPAGPLIAIWGMETGFGSFLGKEHTLSA 147

Query: 155 LATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDAD 214
           ++TLAYDCRR+ +FT Q + AL LV++G +S  A GA  GEIGQ QFLPVNV+KY +D D
Sbjct: 148 VSTLAYDCRRSDYFTNQLYAALQLVERGDLSPAARGAAHGEIGQTQFLPVNVLKYGVDGD 207

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNK 268
            +G +D+V+S  DA+AS A FL   GW    GYQPG+ NFA ++ WNA+  Y +
Sbjct: 208 GNGHVDMVRSKADALASTANFLRGHGWQPGGGYQPGQVNFAAIQGWNAASVYQQ 261


>gi|261325856|ref|ZP_05965053.1| lytic Murein transglycosylase [Brucella neotomae 5K33]
 gi|261301836|gb|EEY05333.1| lytic Murein transglycosylase [Brucella neotomae 5K33]
          Length = 272

 Score =  209 bits (531), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 103/225 (45%), Positives = 142/225 (63%), Gaps = 2/225 (0%)

Query: 55  REGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKAN 114
           R G+  K   +  A+ +Y   TI  DR    S  +SF+ ++    +  II +G A+K+ N
Sbjct: 49  RRGIG-KAGINALANTKYAQATINADRNQ-KSFKLSFEQFMQKRGADTIIKRGRAMKQQN 106

Query: 115 SRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFY 174
           + L  N++K YGVP G L+A+WG+ET FG  MGK   LS +ATLAYDCRR+ +FT+Q + 
Sbjct: 107 AALFANIEKRYGVPAGPLIAIWGMETGFGSYMGKQHTLSAVATLAYDCRRSDYFTDQLYA 166

Query: 175 ALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAK 234
           AL L+ +  +S  A+GA  GEIGQ QFLPVNV+ Y +D D  G ID+ +S  DA+ S A 
Sbjct: 167 ALKLIDREDLSPAAIGAMHGEIGQTQFLPVNVLNYGVDGDGSGHIDMARSKADALYSTAN 226

Query: 235 FLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHIDG 279
           FL   GW + AGYQPGE N+A ++ WNA+  Y + IA +   IDG
Sbjct: 227 FLVGHGWQRGAGYQPGEPNYAAIQGWNAAQVYQRAIAVMGKAIDG 271


>gi|256061848|ref|ZP_05451983.1| lytic murein transglycosylase [Brucella neotomae 5K33]
          Length = 241

 Score =  208 bits (530), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 103/225 (45%), Positives = 142/225 (63%), Gaps = 2/225 (0%)

Query: 55  REGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKAN 114
           R G+  K   +  A+ +Y   TI  DR    S  +SF+ ++    +  II +G A+K+ N
Sbjct: 18  RRGIG-KAGINALANTKYAQATINADRNQ-KSFKLSFEQFMQKRGADTIIKRGRAMKQQN 75

Query: 115 SRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFY 174
           + L  N++K YGVP G L+A+WG+ET FG  MGK   LS +ATLAYDCRR+ +FT+Q + 
Sbjct: 76  AALFANIEKRYGVPAGPLIAIWGMETGFGSYMGKQHTLSAVATLAYDCRRSDYFTDQLYA 135

Query: 175 ALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAK 234
           AL L+ +  +S  A+GA  GEIGQ QFLPVNV+ Y +D D  G ID+ +S  DA+ S A 
Sbjct: 136 ALKLIDREDLSPAAIGAMHGEIGQTQFLPVNVLNYGVDGDGSGHIDMARSKADALYSTAN 195

Query: 235 FLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHIDG 279
           FL   GW + AGYQPGE N+A ++ WNA+  Y + IA +   IDG
Sbjct: 196 FLVGHGWQRGAGYQPGEPNYAAIQGWNAAQVYQRAIAVMGKAIDG 240


>gi|153008409|ref|YP_001369624.1| lytic murein transglycosylase [Ochrobactrum anthropi ATCC 49188]
 gi|151560297|gb|ABS13795.1| lytic murein transglycosylase [Ochrobactrum anthropi ATCC 49188]
          Length = 275

 Score =  207 bits (526), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 103/245 (42%), Positives = 145/245 (59%), Gaps = 2/245 (0%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDY 94
           C + A  +  W       A   G+  K A     + +Y   TI  DR    S  +SF+ +
Sbjct: 32  CGNNAAGYNAWLQQTMKEAASRGIG-KAAIGALGNTKYAQATINADRNQ-KSFKLSFEQF 89

Query: 95  LDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLST 154
           +    +  II +G A K+ N+ L   ++K YGVP G L+A+WG+ET FG  +GK   LS 
Sbjct: 90  MQKRGADTIIKRGRAQKQQNAALFAAIEKRYGVPAGPLLAIWGMETGFGAYLGKQHTLSA 149

Query: 155 LATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDAD 214
           +ATLAYDCRR+ +FT+Q + AL L+ +  ++ +A+GA  GEIGQ QFLPVNV+KY +D D
Sbjct: 150 VATLAYDCRRSDYFTDQLYAALKLIDRQDLNPNAVGAMHGEIGQTQFLPVNVLKYGVDGD 209

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIA 274
             G ID+ +S  DA+ S A FL   GW + AGYQPGE N+  ++ WNA+  Y + IA + 
Sbjct: 210 GSGHIDMARSKADALYSTANFLVGHGWQRGAGYQPGEPNYGAIQGWNAAQVYQRAIAVMG 269

Query: 275 AHIDG 279
             IDG
Sbjct: 270 KAIDG 274


>gi|222150224|ref|YP_002551181.1| hypothetical protein Avi_4364 [Agrobacterium vitis S4]
 gi|221737206|gb|ACM38169.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 316

 Score =  206 bits (523), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 102/244 (41%), Positives = 144/244 (59%), Gaps = 1/244 (0%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDY 94
           C +T+  F +W    +  AV  G+S       FA++ Y   TI  DR    S  +SF ++
Sbjct: 72  CGNTSAGFEQWVEGFKREAVGRGISQSVLDRSFANVRYNVPTIRADRGQ-KSFKLSFDEF 130

Query: 95  LDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLST 154
           +       II++G ++K+AN+ L  ++++ +GVP G ++A+WG+ET FG  MG    LS 
Sbjct: 131 MKKRGGQTIISRGKSMKRANAPLFASIERRFGVPAGPIIAIWGMETGFGSYMGNEHTLSA 190

Query: 155 LATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDAD 214
           ++TL YDCRR+ +F EQ + AL LV  G +  ++ GA  GEIGQ QFLP NV  Y +D D
Sbjct: 191 VSTLTYDCRRSDYFREQLYAALKLVADGDLDVNSRGAAHGEIGQTQFLPKNVTLYGVDGD 250

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIA 274
            D  IDL+ S  DA++S A FL   GW    GYQPGE NF+ +  WNA+  Y + IAYI 
Sbjct: 251 GDRHIDLIHSRADALSSTANFLKGHGWQPGLGYQPGEPNFSAIGGWNAATVYQQAIAYIG 310

Query: 275 AHID 278
             ID
Sbjct: 311 KQID 314


>gi|110635671|ref|YP_675879.1| lytic murein transglycosylase [Mesorhizobium sp. BNC1]
 gi|110286655|gb|ABG64714.1| lytic murein transglycosylase [Chelativorans sp. BNC1]
          Length = 271

 Score =  205 bits (522), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 109/272 (40%), Positives = 158/272 (58%), Gaps = 14/272 (5%)

Query: 8   LISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLF 67
           L + L +  P LA +            C +    F  WK+A    A   G S +TA    
Sbjct: 14  LFAFLFLGSPALAAS------------CGNGGGGFEAWKAAFIQEAAARGAS-RTALDAL 60

Query: 68  ADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGV 127
           A   Y   TIA DR       +S + ++    ++ II++G  +KK ++ L   +++++GV
Sbjct: 61  ARTSYATKTIAADRGQ-KGFKLSLESFMQKRGANVIISRGKTMKKRHAALFDRIERQFGV 119

Query: 128 PPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSH 187
           P G L+A+WG+ET FG  MG    LS +ATLAYDCRR++FFT+  + AL L+ +G++S  
Sbjct: 120 PAGPLIAIWGMETGFGGFMGNQHTLSAVATLAYDCRRSEFFTDHLYAALTLIDRGMLSPA 179

Query: 188 ALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGY 247
           A+GA  GEIGQ QFLP N +++A+D D +G+ID++ S  DA+AS A FL   GW   AGY
Sbjct: 180 AVGAAHGEIGQTQFLPGNALRFAVDGDGNGRIDMIGSTADALASTANFLRAHGWQPGAGY 239

Query: 248 QPGEKNFAILKHWNASLNYNKTIAYIAAHIDG 279
           Q G+ NF  ++ WNA+  Y + IA IA  IDG
Sbjct: 240 QQGQPNFVAIQGWNAASVYQQAIAIIAKEIDG 271


>gi|254459633|ref|ZP_05073049.1| lytic murein transglycosylase [Rhodobacterales bacterium HTCC2083]
 gi|206676222|gb|EDZ40709.1| lytic murein transglycosylase [Rhodobacteraceae bacterium HTCC2083]
          Length = 267

 Score =  194 bits (493), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 107/275 (38%), Positives = 153/275 (55%), Gaps = 13/275 (4%)

Query: 5   KYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAK 64
           K  + +++     + AQA T          C +T+  F  WK+A  + A R G+  +  +
Sbjct: 6   KAAVTAVIFTSSTVAAQAAT----------CGNTSSGFNAWKAAFASDAQRAGVGQRGIQ 55

Query: 65  HLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKE 124
            L A  +Y   TIA DR    S   S   ++    +  I++QG   K  N+     L+++
Sbjct: 56  AL-ASSQYASKTIAADRNQ-KSFKYSLDKFMKVRGAPTIVSQGRKRKAKNASFFEALERQ 113

Query: 125 YGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVI 184
           YGVP G+++A+ G+ET FG  MG + ++S + TLAYDCRR+ FF      AL LV KG I
Sbjct: 114 YGVPAGVIIAIHGMETGFGRFMGDSRIVSAITTLAYDCRRSAFFVPHAIGALKLVDKGAI 173

Query: 185 SSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKC 244
            S   GA  GE+G  QFLP N +KY IDA+ DG+++   +  DA+AS A FL + GW   
Sbjct: 174 DSSTKGAKHGELGHTQFLPGNALKYGIDANRDGRVNFY-TEADALASTANFLRQKGWKPG 232

Query: 245 AGYQPGEKNFAILKHWNASLNYNKTIAYIAAHIDG 279
           AG+Q G+ NF I+K WNA+  Y K IA + A IDG
Sbjct: 233 AGFQEGQTNFKIIKQWNAAGVYQKAIAIMGAEIDG 267


>gi|146276875|ref|YP_001167034.1| membrane-bound lytic murein transglycosylase B-like protein
           [Rhodobacter sphaeroides ATCC 17025]
 gi|145555116|gb|ABP69729.1| Membrane-bound lytic murein transglycosylase B-like protein
           [Rhodobacter sphaeroides ATCC 17025]
          Length = 247

 Score =  194 bits (493), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 106/245 (43%), Positives = 140/245 (57%), Gaps = 5/245 (2%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDY 94
           CS+T   +  WKS     A   G+  +    L     Y   TIA DR    S   S   +
Sbjct: 6   CSNTGADYESWKSLMAQEAAAVGVGQRGIAALMGS-SYSTRTIAADRNQ-KSFRYSLDKF 63

Query: 95  LDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLST 154
           +    S  II QG A K  N     +L++ YGVP G+L+A+ G+ET FG  MG T ++S 
Sbjct: 64  MQVRGSDTIIRQGRARKAKNPEFYASLERRYGVPAGVLLAIHGMETGFGSFMGDTNVVSA 123

Query: 155 LATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDAD 214
           +ATLAYDCRR+ FFT     AL LV +G IS  ++GA  GE+G  QFLP N + Y +D +
Sbjct: 124 IATLAYDCRRSDFFTPHLLAALVLVDRGSISPASVGAKHGELGHTQFLPGNALAYGVDGN 183

Query: 215 EDGKIDLVKSNI-DAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYI 273
            DG++DL   NI DA+AS A FLA+ GW    GYQP E NFA+++ WNA+  Y + IA +
Sbjct: 184 GDGRVDL--GNITDAMASTANFLARKGWQPGLGYQPAEPNFAVIREWNAASVYQQAIAIM 241

Query: 274 AAHID 278
           A  ID
Sbjct: 242 AQQID 246


>gi|77462712|ref|YP_352216.1| lytic murein transglycosylase, putative [Rhodobacter sphaeroides
           2.4.1]
 gi|126461605|ref|YP_001042719.1| lytic murein transglycosylase, putative [Rhodobacter sphaeroides
           ATCC 17029]
 gi|221638573|ref|YP_002524835.1| Lytic murein transglycosylase [Rhodobacter sphaeroides KD131]
 gi|332557595|ref|ZP_08411917.1| Lytic murein transglycosylase, putative [Rhodobacter sphaeroides
           WS8N]
 gi|77387130|gb|ABA78315.1| lytic murein transglycosylase, putative [Rhodobacter sphaeroides
           2.4.1]
 gi|126103269|gb|ABN75947.1| lytic murein transglycosylase, putative [Rhodobacter sphaeroides
           ATCC 17029]
 gi|221159354|gb|ACM00334.1| Lytic murein transglycosylase, putative [Rhodobacter sphaeroides
           KD131]
 gi|332275307|gb|EGJ20622.1| Lytic murein transglycosylase, putative [Rhodobacter sphaeroides
           WS8N]
          Length = 267

 Score =  194 bits (493), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 104/244 (42%), Positives = 137/244 (56%), Gaps = 3/244 (1%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDY 94
           CSDT   +  WK      A   G+  +    L     Y   TIA DR    S   S   +
Sbjct: 26  CSDTGANYESWKPQMAQEAAAVGVGQRGIAALMG-TSYSSRTIAADRNQ-KSFKYSLDKF 83

Query: 95  LDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLST 154
           +    S  I+ QG A K  +  L   L++ YGVP G+L+A+ G+ET FG  MG T ++S 
Sbjct: 84  MQVRGSETIVKQGRARKAKSPDLYAALERRYGVPAGVLLAIHGMETGFGNFMGDTNVVSA 143

Query: 155 LATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDAD 214
           +ATLAYDCRR+ FFT     AL LV +G IS+ ++GA  GEIG  QFLP N + Y +D +
Sbjct: 144 IATLAYDCRRSDFFTPHLLAALVLVDRGSISTASVGAKHGEIGHTQFLPGNALTYGVDGN 203

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIA 274
            DG++DL     DA+AS A FLA  GW    GYQPGE NFA+++ WNA+  Y + IA + 
Sbjct: 204 GDGRVDLTNLT-DALASTANFLAAKGWQPGLGYQPGEPNFAVIREWNAASVYQQAIAIMG 262

Query: 275 AHID 278
             ID
Sbjct: 263 QRID 266


>gi|239832907|ref|ZP_04681236.1| lytic murein transglycosylase [Ochrobactrum intermedium LMG 3301]
 gi|239825174|gb|EEQ96742.1| lytic murein transglycosylase [Ochrobactrum intermedium LMG 3301]
          Length = 274

 Score =  193 bits (490), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 99/245 (40%), Positives = 140/245 (57%), Gaps = 3/245 (1%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDY 94
           C + A  +  W       A   G+  K   +  A  +Y   TI  DR    S  +SF+D+
Sbjct: 32  CGNNAAGYNAWLQQTLKEAPSRGVG-KAGLNALAGTKYAQATINADRNQ-KSFKLSFEDF 89

Query: 95  LDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLST 154
           +    +  II +G A K+ N+ L   ++K YGVP G L+A+WG+ET FG  +GK   LS 
Sbjct: 90  MKKRGADTIIKRGRAQKQQNAALFAAIEKRYGVPAGPLIAIWGMETGFGSYLGKQHTLSA 149

Query: 155 LATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDAD 214
           +ATLAYDCRR+ +FT Q + AL L+ +G +S  A+GA  GE+GQ QF+P NV+KY +   
Sbjct: 150 VATLAYDCRRSDYFTGQLYAALKLIDQGDLSPQAVGAMHGEVGQTQFMPANVLKYGVSGS 209

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIA 274
                DL ++  DA+ S A FL   GW + AGYQPGE N+  ++ WNA+  Y + IA + 
Sbjct: 210 GGSHFDL-RNKADALHSTANFLVGHGWQRGAGYQPGEPNYGAIQGWNAAQVYQRAIAVMG 268

Query: 275 AHIDG 279
             IDG
Sbjct: 269 KAIDG 273


>gi|260433325|ref|ZP_05787296.1| lytic murein transglycosylase [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260417153|gb|EEX10412.1| lytic murein transglycosylase [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 264

 Score =  191 bits (485), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 109/273 (39%), Positives = 154/273 (56%), Gaps = 14/273 (5%)

Query: 7   LLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHL 66
           +L+S L  + P LAQA            C +    F  WK+    +A + G+S +  + L
Sbjct: 6   ILVSALSGL-PALAQAAP----------CGNDGSGFEAWKTDFAKQARKAGVSKRGLQAL 54

Query: 67  FADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYG 126
            A   Y   TIA DR    S   + + ++    +  I+AQG   K  N +    L+++YG
Sbjct: 55  -AQTRYATGTIAADRNQ-KSFKYTLEKFMRLRGADTIVAQGRKRKARNPQFYAALERQYG 112

Query: 127 VPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISS 186
           VP GIL+A+ G+ET FG  MG + ++S + TLAYDCRR++FF      AL LV +G I+ 
Sbjct: 113 VPAGILIAIHGMETGFGSFMGDSQVVSAITTLAYDCRRSEFFVPHAIGALKLVDQGSITM 172

Query: 187 HALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAG 246
              GA  GE+G  QFLP N ++Y +DA  DG++D   +  DA+AS A FL K GW    G
Sbjct: 173 ATKGAKHGELGHTQFLPGNALRYGVDATGDGRVDFY-NMTDALASTANFLRKKGWKPGRG 231

Query: 247 YQPGEKNFAILKHWNASLNYNKTIAYIAAHIDG 279
           YQPGE NFA+++ WNA+  Y + IA +AA IDG
Sbjct: 232 YQPGEPNFAVIQQWNAASVYQQAIAIMAARIDG 264


>gi|149203950|ref|ZP_01880918.1| hypothetical protein RTM1035_10530 [Roseovarius sp. TM1035]
 gi|149142392|gb|EDM30437.1| hypothetical protein RTM1035_10530 [Roseovarius sp. TM1035]
          Length = 272

 Score =  188 bits (477), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 100/245 (40%), Positives = 145/245 (59%), Gaps = 3/245 (1%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDY 94
           C ++AD F  WK+A    A  EG+ P+  + L A  +Y  +TIA DR    S   S + +
Sbjct: 30  CGNSADGFSNWKAAFAKEAAAEGVGPRGLEAL-AGAQYASSTIAADRNQ-KSFKYSLEKF 87

Query: 95  LDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLST 154
           +    +  I+AQG   +  ++     L+++YGVP G+L+A+ G+ET FG  MG + ++S 
Sbjct: 88  MQVRGAPTIVAQGRKRRAQDAAFYDALERQYGVPAGVLLAIHGMETGFGGFMGDSAVVSA 147

Query: 155 LATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDAD 214
           + TL YDCRR+ FF      AL LV +G I++   GA  GE+G  QFLP N + Y +DA+
Sbjct: 148 IVTLTYDCRRSDFFRPHAVGALKLVDRGAITAQTKGAKHGELGHTQFLPGNALNYGVDAN 207

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIA 274
            DG++D      DA+AS A FL + GW    GYQ G+ NFA+++ WNA+  Y K IA +A
Sbjct: 208 GDGRVDFYNL-TDALASTANFLRQKGWQPGQGYQEGQPNFAVIQQWNAAGVYQKAIALMA 266

Query: 275 AHIDG 279
           A IDG
Sbjct: 267 AQIDG 271


>gi|86138446|ref|ZP_01057020.1| hypothetical protein MED193_05061 [Roseobacter sp. MED193]
 gi|85824971|gb|EAQ45172.1| hypothetical protein MED193_05061 [Roseobacter sp. MED193]
          Length = 265

 Score =  188 bits (477), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 103/270 (38%), Positives = 147/270 (54%), Gaps = 6/270 (2%)

Query: 9   ISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFA 68
           +  L     +   ++TQP  A     C +T+  F  WK A  AR  R            A
Sbjct: 1   MRFLAAAIALTVSSLTQPALAAP---CGNTSAGFNAWK-ADFARTARRAGVKAPGLEALA 56

Query: 69  DLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVP 128
             +Y + TIA DR    S   S + ++    S+ I+AQG   K  N      L+++YGVP
Sbjct: 57  QAQYANRTIAADRNQ-KSFRYSLEKFMQLRGSATIVAQGRKRKARNPDFYAALERKYGVP 115

Query: 129 PGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHA 188
            G+L+A+ G+ET FG  MG + ++S + TL YDCRR+ FF      AL LV +G I+S  
Sbjct: 116 AGVLIAIHGMETAFGNYMGDSKIVSAIVTLTYDCRRSDFFEPHALGALKLVDQGAITSAT 175

Query: 189 LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
           LGA  GE+G  QFLP N +KY +D D DG+++      DA+AS A++L K GW +  GYQ
Sbjct: 176 LGAKHGELGHTQFLPGNALKYGVDWDRDGRVNFYDLE-DALASTARYLQKRGWKRGKGYQ 234

Query: 249 PGEKNFAILKHWNASLNYNKTIAYIAAHID 278
            GE N+ +LK WNA+  Y +++A +   ID
Sbjct: 235 EGEANYRVLKEWNAATVYQQSLAIMGRQID 264


>gi|90420746|ref|ZP_01228652.1| lytic murein transglycosylase [Aurantimonas manganoxydans SI85-9A1]
 gi|90335037|gb|EAS48798.1| lytic murein transglycosylase [Aurantimonas manganoxydans SI85-9A1]
          Length = 275

 Score =  188 bits (477), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 96/244 (39%), Positives = 142/244 (58%), Gaps = 2/244 (0%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDY 94
           C ++   F +WK      AVR G+S  T +       Y +  I  DR    S  +S + +
Sbjct: 31  CGNSGGGFNQWKQEFAQEAVRAGISQGTVQSALMPTSYSNQVIKLDRNQ-HSMNISLEAF 89

Query: 95  LDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLST 154
           +   + +  + +G  + + N+ LL +++K YGVP  I++A+WG+ET FG   G   + ++
Sbjct: 90  MQRRAPASFVNKGKRIIQQNAGLLNSIEKSYGVPKEIIVAIWGMETGFGANSGSMNIFNS 149

Query: 155 LATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDA 213
           LATLAYDCRR+ FFTE+   AL +V +G +  S   GA  GEIGQ QFL  N +++A+D 
Sbjct: 150 LATLAYDCRRSAFFTEELLAALAIVDRGDMKPSQMKGAWAGEIGQTQFLAKNYLRFAVDG 209

Query: 214 DEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYI 273
           D +G+ DL+ S  D +AS A FL + GW   AGYQ GE NFAIL+ WN +  Y K +A  
Sbjct: 210 DGNGRRDLINSKADVLASTANFLRQHGWRPGAGYQQGEPNFAILRDWNRAGVYQKALALF 269

Query: 274 AAHI 277
           A+ +
Sbjct: 270 ASKL 273


>gi|260577199|ref|ZP_05845175.1| conserved hypothetical protein [Rhodobacter sp. SW2]
 gi|259020579|gb|EEW23899.1| conserved hypothetical protein [Rhodobacter sp. SW2]
          Length = 271

 Score =  188 bits (477), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 100/272 (36%), Positives = 147/272 (54%), Gaps = 3/272 (1%)

Query: 8   LISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLF 67
            + L   + P++   +     A     C +T+  F  WK+     A   G+  +    L 
Sbjct: 3   FVFLHKFIMPIITAVLLTSAPAAQAATCGNTSSGFEAWKAEMADEAASAGVGKRGIAALM 62

Query: 68  ADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGV 127
               Y   TI  DR    S   +   +L    +  I++QG      +     +L++ +GV
Sbjct: 63  G-ASYATRTIGADRNQ-KSFKYTLAKFLQVRGADTIVSQGRKRLAQSPEFYASLERRFGV 120

Query: 128 PPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSH 187
           P G+++A+ G+ET FG  MG + ++S +ATLAYDCRR +FFT     AL LV +G IS+ 
Sbjct: 121 PAGVVIAIHGMETGFGGFMGDSNVVSAIATLAYDCRRTEFFTGHLLAALKLVDQGTISAA 180

Query: 188 ALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGY 247
            +GA  GE+G  QFLP NV++Y +D D DG+IDL   + DA+AS A +LA  GW   AG+
Sbjct: 181 TIGAKHGEVGHTQFLPGNVLRYGVDGDGDGRIDLSNQS-DALASTANYLAAKGWRPGAGF 239

Query: 248 QPGEKNFAILKHWNASLNYNKTIAYIAAHIDG 279
           Q GE NFA++K WNA+  Y + IA + A I G
Sbjct: 240 QKGEPNFAVIKEWNAATVYQEAIAIMGARIGG 271


>gi|148257621|ref|YP_001242206.1| putative lytic murein transglycosylase [Bradyrhizobium sp. BTAi1]
 gi|146409794|gb|ABQ38300.1| putative lytic murein transglycosylase [Bradyrhizobium sp. BTAi1]
          Length = 254

 Score =  187 bits (476), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 98/245 (40%), Positives = 142/245 (57%), Gaps = 10/245 (4%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDY 94
           C  +   F  WK      A  +G+   TA        Y   TIA DR    S  +S   +
Sbjct: 13  CGTSPAGFDAWKREFSEEARAKGVG-GTAIAALMQTNYASATIAADRGQ-RSFQLSLDQF 70

Query: 95  LDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLST 154
           L    ++ I+A+G  LK++ + +  ++++ YGVPPG L+A+WG+E+ FG   G   +LS+
Sbjct: 71  LAKRGAAAIVARGRQLKQSQAAMFASIEQRYGVPPGPLIAIWGMESAFGSQRGNQHMLSS 130

Query: 155 LATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDAD 214
           +ATLAYDCRR +FFTEQ + AL L+ +GV+S +  G+  GE+GQ QF+P N++ Y +   
Sbjct: 131 IATLAYDCRRPEFFTEQLYAALKLIDRGVLSGNTRGSMHGEVGQTQFMPKNILAYGV--- 187

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIA 274
             G +D+     +A+AS A FL   GW   AGYQPGE NFA ++ WNA+  Y K IA + 
Sbjct: 188 --GNLDVAA---NALASTANFLRANGWKAGAGYQPGEPNFAAIEAWNAAGVYQKAIALMG 242

Query: 275 AHIDG 279
             IDG
Sbjct: 243 RQIDG 247


>gi|163746833|ref|ZP_02154190.1| hypothetical protein OIHEL45_15559 [Oceanibulbus indolifex HEL-45]
 gi|161379947|gb|EDQ04359.1| hypothetical protein OIHEL45_15559 [Oceanibulbus indolifex HEL-45]
          Length = 266

 Score =  187 bits (475), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 103/247 (41%), Positives = 138/247 (55%), Gaps = 7/247 (2%)

Query: 35  CSDTADRFGEWKSA--ARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFK 92
           C +TA+ F  WK A    ARA   G S   A    A   Y + TIA DR    S   S  
Sbjct: 25  CGNTANGFDAWKGAFAQEARAAGVGQSGLNA---LASARYANGTIAADRNQ-KSFKYSLS 80

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
            ++    +  I+AQG   K  N+     L++ YGVP G+L+A+ G+ET FG  MG + ++
Sbjct: 81  KFMQVRGADTIVAQGRKRKARNAGFYSALEQRYGVPAGVLLAIHGMETGFGGFMGDSAVV 140

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAID 212
           S + TLAYDCRR+ FF      AL LV +G I+    GA  GE+G  QFLP N + Y +D
Sbjct: 141 SAITTLAYDCRRSDFFVPHAIGALKLVDQGAITPSTKGAKHGELGHTQFLPGNALSYGVD 200

Query: 213 ADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAY 272
            + DG++D   S  DA+AS A FL + GW   AGYQ G+ NF +++ WNA+  Y K IA 
Sbjct: 201 GNGDGRVDFY-SETDALASTANFLRQKGWQPGAGYQEGQPNFRVIQAWNAAGVYQKAIAI 259

Query: 273 IAAHIDG 279
           +A  IDG
Sbjct: 260 MAGRIDG 266


>gi|56697155|ref|YP_167519.1| hypothetical protein SPO2296 [Ruegeria pomeroyi DSS-3]
 gi|56678892|gb|AAV95558.1| conserved hypothetical protein [Ruegeria pomeroyi DSS-3]
          Length = 280

 Score =  186 bits (473), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 105/255 (41%), Positives = 140/255 (54%), Gaps = 6/255 (2%)

Query: 24  TQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKM 83
           T P  A T   C +T   F  WK+     A R+G+  +    L A   Y   TIA DR  
Sbjct: 31  TSPALALT---CGNTGAGFEAWKAEFAKVARRQGVGKRGLDAL-AQARYATRTIAADRNQ 86

Query: 84  VTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFG 143
             S   S + ++    +  I+AQG   K  N      L+++YGVP GIL+AL G+ET FG
Sbjct: 87  -KSFKYSLEKFMQVRGADTIVAQGRKRKARNPEFYAALERQYGVPAGILIALHGMETAFG 145

Query: 144 ETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLP 203
             MG + ++S + TLAYDCRR+ FF      AL+LV +  I+    GA  GE+G  QFLP
Sbjct: 146 SFMGDSAVVSAITTLAYDCRRSDFFIPHALAALELVDRSAITGATKGAKHGELGHTQFLP 205

Query: 204 VNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNAS 263
            N + Y +DA  DG++D      DA+AS A FL + GW    GYQPGE NFA++K WNA+
Sbjct: 206 GNALTYGVDATGDGRVDFYDMT-DALASTANFLRQKGWQPGRGYQPGEPNFAVIKQWNAA 264

Query: 264 LNYNKTIAYIAAHID 278
             Y + IA +A  ID
Sbjct: 265 SVYQQAIAIMARRID 279


>gi|146338732|ref|YP_001203780.1| putative lytic murein transglycosylase [Bradyrhizobium sp. ORS278]
 gi|146191538|emb|CAL75543.1| putative lytic murein transglycosylase [Bradyrhizobium sp. ORS278]
          Length = 254

 Score =  186 bits (473), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 98/245 (40%), Positives = 141/245 (57%), Gaps = 10/245 (4%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDY 94
           C  +   F  WK      A  +G+   TA        Y   TIA DR    S  +S   +
Sbjct: 13  CGTSPAGFEAWKRDFSEEARAKGIG-GTALSALMQTNYASATIAADRGQ-RSFQLSLDQF 70

Query: 95  LDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLST 154
           L    ++ I+A+G  LK++ + +  ++++ YGVPPG L+A+WG+E+ FG   G   +LS+
Sbjct: 71  LAKRGAAAIVARGRQLKQSQAAMFASIEQRYGVPPGPLIAIWGMESGFGSQRGNQHMLSS 130

Query: 155 LATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDAD 214
           +ATLAYDCRR +FFTEQ + AL L+ +GV+S    G+  GE+GQ QF+P N++ Y +   
Sbjct: 131 IATLAYDCRRPEFFTEQLYAALKLIDRGVLSGATRGSMHGEVGQTQFMPKNILAYGV--- 187

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIA 274
             G +D+     +A+AS A FL   GW   AGYQPGE NFA ++ WNA+  Y K IA + 
Sbjct: 188 --GNLDVAA---NALASTANFLRANGWKAGAGYQPGEPNFAAIEAWNAAGVYQKAIALMG 242

Query: 275 AHIDG 279
             IDG
Sbjct: 243 RQIDG 247


>gi|254465615|ref|ZP_05079026.1| lytic murein transglycosylase [Rhodobacterales bacterium Y4I]
 gi|206686523|gb|EDZ47005.1| lytic murein transglycosylase [Rhodobacterales bacterium Y4I]
          Length = 264

 Score =  186 bits (471), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 101/267 (37%), Positives = 149/267 (55%), Gaps = 6/267 (2%)

Query: 13  MMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEY 72
           ++   +++  +  P  A T   C +T+  F  WK A  A A R G+     + L A+ +Y
Sbjct: 4   LLASALISALLASPAVAAT---CGNTSAGFDAWKQAFSAEAKRAGVRNAGLQAL-ANAQY 59

Query: 73  LDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGIL 132
              TI+ DR    S   S + ++    S+ I+AQG   K  N      L+++YGVP G+L
Sbjct: 60  ASRTISADRNQ-KSFKYSLEKFMQVRGSATIVAQGRKRKARNPDFYAALERKYGVPAGVL 118

Query: 133 MALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGAT 192
           +A+ G+ET FG  MG + ++S + TL YDCRR+ FF      AL LV +G I+   LGA 
Sbjct: 119 IAIHGMETAFGNYMGDSQVVSAIVTLTYDCRRSDFFRPHALGALKLVDQGAITPATLGAK 178

Query: 193 FGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEK 252
            GE+G  QFLP N ++Y  D D +G++D      DA+AS A +L + GW    GYQPGE 
Sbjct: 179 HGELGHTQFLPGNALQYGQDWDGNGRVDFYNMG-DALASTANYLRQKGWKPGKGYQPGEP 237

Query: 253 NFAILKHWNASLNYNKTIAYIAAHIDG 279
           N+ +LK WNA+  Y +++A +   IDG
Sbjct: 238 NYPVLKQWNAATVYQQSLAIMGRQIDG 264


>gi|188580261|ref|YP_001923706.1| hypothetical protein Mpop_0994 [Methylobacterium populi BJ001]
 gi|179343759|gb|ACB79171.1| conserved hypothetical protein [Methylobacterium populi BJ001]
          Length = 261

 Score =  186 bits (471), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 102/245 (41%), Positives = 139/245 (56%), Gaps = 10/245 (4%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDY 94
           C +TA  F  WK    A A  +G +   A    A+  Y   TI+ DR    S  +S   +
Sbjct: 26  CGNTAAGFEAWKDEFAAEA--KGRASPAALAALANTSYSTATISADRGQ-KSFKLSLDQF 82

Query: 95  LDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLST 154
           L     + I+++G ALK  N+ L  ++++ YGVPPG L+A+WG+ET FG   G    LS 
Sbjct: 83  LAKRGGNTIVSRGRALKAQNAALFASIEQRYGVPPGPLLAIWGMETGFGAVKGNVNTLSA 142

Query: 155 LATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDAD 214
           +ATLAYDCRR+ +FT+Q + AL LV  GV++    GA  GE+G  QFLP NV+ Y +   
Sbjct: 143 VATLAYDCRRSAYFTDQLYAALKLVDSGVLTPATRGAAHGEVGHTQFLPKNVLTYGVGGS 202

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIA 274
            D       S  +A+ S A FL   GW + AGYQPGE NFA ++ WNA+  Y + IA + 
Sbjct: 203 LD-------SAPNALNSTANFLKGHGWQRGAGYQPGEPNFAAIQGWNAAGVYQRAIALLG 255

Query: 275 AHIDG 279
           A IDG
Sbjct: 256 ARIDG 260


>gi|27378970|ref|NP_770499.1| hypothetical protein blr3859 [Bradyrhizobium japonicum USDA 110]
 gi|27352120|dbj|BAC49124.1| blr3859 [Bradyrhizobium japonicum USDA 110]
          Length = 270

 Score =  185 bits (469), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 97/244 (39%), Positives = 139/244 (56%), Gaps = 10/244 (4%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDY 94
           C  +   F  WK    A A  +G+ P TA        Y   TIA DR    S  +S   +
Sbjct: 29  CGSSPAGFEGWKREFSAEAQGKGIGP-TAISALMQTNYASATIAADRGQ-RSFSLSLDQF 86

Query: 95  LDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLST 154
           L    ++ I+A+G  LK++ + L  ++++ YGVPPG L+A+WG+ET FG   G   +LS+
Sbjct: 87  LAKRGATTIVAKGRQLKQSQAALFASIQQRYGVPPGPLIAIWGMETGFGSQRGNQNMLSS 146

Query: 155 LATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDAD 214
           +ATLAYDCRR +FFT+Q + AL L+ +G +S    G+  GE+GQ QF+P N++ Y     
Sbjct: 147 IATLAYDCRRPEFFTDQLYAALKLIDRGTLSGATRGSMHGEVGQTQFMPKNILAYGT--- 203

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIA 274
             G +++     +A+ S A FL   GW   AGYQPGE NFA ++ WNA+  Y K IA + 
Sbjct: 204 --GNLEVAA---NALNSTANFLKAHGWRAGAGYQPGEPNFAAIEAWNAAGVYQKAIALMG 258

Query: 275 AHID 278
             ID
Sbjct: 259 RQID 262


>gi|85705403|ref|ZP_01036502.1| hypothetical protein ROS217_18082 [Roseovarius sp. 217]
 gi|85670276|gb|EAQ25138.1| hypothetical protein ROS217_18082 [Roseovarius sp. 217]
          Length = 261

 Score =  183 bits (465), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 98/245 (40%), Positives = 143/245 (58%), Gaps = 3/245 (1%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDY 94
           C ++AD F  WK+A    A  EG+  +    L A  +Y  +TIA DR    S   S + +
Sbjct: 19  CGNSADGFSAWKAAFAREAAAEGVGQRGLDAL-ASSQYASSTIAADRNQ-KSFKYSLEKF 76

Query: 95  LDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLST 154
           L       I+AQG   +  ++     L+++YGVP G+L+A+ G+ET FG  MG + +++ 
Sbjct: 77  LQVRGGPTIVAQGRKRRVNDAAFYDALERQYGVPAGVLIAIHGMETGFGGFMGDSAVVAA 136

Query: 155 LATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDAD 214
           + TL YDCRR+ FF      AL LV +G I++   GA  GE+G  QFLP N ++Y +DA+
Sbjct: 137 IVTLTYDCRRSDFFRPHALGALQLVDQGAITAQTKGAKHGELGHTQFLPGNALRYGVDAN 196

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIA 274
            DG++D      DA+AS A FL + GW    GYQ G+ NFA+++ WNA+  Y + IA +A
Sbjct: 197 GDGRVDFYNL-TDALASTANFLRQKGWQPGQGYQEGQPNFAVIQQWNAASVYQQAIALMA 255

Query: 275 AHIDG 279
           A IDG
Sbjct: 256 AQIDG 260


>gi|254510020|ref|ZP_05122087.1| lytic murein transglycosylase [Rhodobacteraceae bacterium KLH11]
 gi|221533731|gb|EEE36719.1| lytic murein transglycosylase [Rhodobacteraceae bacterium KLH11]
          Length = 264

 Score =  183 bits (465), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 100/244 (40%), Positives = 140/244 (57%), Gaps = 3/244 (1%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDY 94
           C +T++ F  WK+     A R G+  K  + L A  +Y   TIA DR    S   S   +
Sbjct: 23  CGNTSNGFEAWKADFAKTAKRAGVKKKGLQAL-AQTQYATRTIAADRNQ-KSFKYSLDKF 80

Query: 95  LDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLST 154
           +    +  I+AQG   K  N +    L+++YGVP G+L+A+ G+ET FG  MG + ++S 
Sbjct: 81  MQVRGADTIVAQGRKRKARNPQFYAALERQYGVPAGVLIAIHGMETGFGNFMGDSQVVSA 140

Query: 155 LATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDAD 214
           + TLAYDCRR++FF      AL LV +G I+    GA  GE+G  QFLP N + Y +DA 
Sbjct: 141 ITTLAYDCRRSEFFIPHAIGALKLVDQGSITVATKGAKHGELGHTQFLPGNALTYGVDAT 200

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIA 274
            D ++D      DA+AS A FL K GW    GYQPGE NFA+++ WNA+  Y ++IA +A
Sbjct: 201 GDRQVDFYNLT-DALASTANFLRKKGWKPGRGYQPGEPNFAVIQQWNAASVYQQSIAIMA 259

Query: 275 AHID 278
             ID
Sbjct: 260 WRID 263


>gi|83954212|ref|ZP_00962932.1| hypothetical protein NAS141_17939 [Sulfitobacter sp. NAS-14.1]
 gi|83841249|gb|EAP80419.1| hypothetical protein NAS141_17939 [Sulfitobacter sp. NAS-14.1]
          Length = 267

 Score =  183 bits (465), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 99/245 (40%), Positives = 136/245 (55%), Gaps = 3/245 (1%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDY 94
           C + A  F  WK A    A   G+  +    L A+  Y  +TIA DR    S   S   +
Sbjct: 26  CGNNAGGFDAWKPAFAKEAAAAGVGQRGLDAL-ANARYASSTIAADRNQ-KSFNYSLDKF 83

Query: 95  LDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLST 154
           +    +  I+AQG   K  N+    +L+  YGVP G+++A+ G+ET FG  MG T ++S 
Sbjct: 84  MQVRGADTIVAQGRKRKGRNASFYQSLEARYGVPAGVIIAIHGMETAFGGFMGDTSVVSA 143

Query: 155 LATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDAD 214
           + TL YDCRR+ FF      AL LV  G I+    GA  GE+G  QFLP N ++Y +D +
Sbjct: 144 ITTLTYDCRRSDFFAPHAIGALKLVDTGAINGGTKGAKHGELGHTQFLPGNALRYGVDGN 203

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIA 274
            DG++D   +  DA+AS A FL + GW   AGYQ G+ NF ++K WNA+  Y K IA +A
Sbjct: 204 GDGRVDFY-NQTDALASTANFLRQKGWQPGAGYQEGQTNFNVIKQWNAAGVYQKAIAIMA 262

Query: 275 AHIDG 279
           A IDG
Sbjct: 263 ARIDG 267


>gi|83943038|ref|ZP_00955498.1| hypothetical protein EE36_12693 [Sulfitobacter sp. EE-36]
 gi|83846046|gb|EAP83923.1| hypothetical protein EE36_12693 [Sulfitobacter sp. EE-36]
          Length = 267

 Score =  183 bits (464), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 99/245 (40%), Positives = 136/245 (55%), Gaps = 3/245 (1%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDY 94
           C + A  F  WK A    A   G+  +    L A+  Y  +TIA DR    S   S   +
Sbjct: 26  CGNNAGGFDAWKPAFAKEAAAAGVGQRGLDAL-ANARYASSTIAADRNQ-KSFNYSLDKF 83

Query: 95  LDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLST 154
           +    +  I+AQG   K  N+    +L+  YGVP G+++A+ G+ET FG  MG T ++S 
Sbjct: 84  MQVRGADTIVAQGRKRKARNASFYQSLEARYGVPAGVIIAIHGMETAFGGFMGDTSVVSA 143

Query: 155 LATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDAD 214
           + TL YDCRR+ FF      AL LV  G I+    GA  GE+G  QFLP N ++Y +D +
Sbjct: 144 ITTLTYDCRRSDFFAPHAIGALKLVDTGAINGGTKGAKHGELGHTQFLPGNALRYGVDGN 203

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIA 274
            DG++D   +  DA+AS A FL + GW   AGYQ G+ NF ++K WNA+  Y K IA +A
Sbjct: 204 GDGRVDFY-NQTDALASTANFLRQKGWQPGAGYQEGQTNFNVIKQWNAAGVYQKAIAIMA 262

Query: 275 AHIDG 279
           A IDG
Sbjct: 263 ARIDG 267


>gi|218529178|ref|YP_002419994.1| hypothetical protein Mchl_1178 [Methylobacterium chloromethanicum
           CM4]
 gi|254560016|ref|YP_003067111.1| membrane bound lytic murein transglycosylase B, mltB
           [Methylobacterium extorquens DM4]
 gi|218521481|gb|ACK82066.1| conserved hypothetical protein [Methylobacterium chloromethanicum
           CM4]
 gi|254267294|emb|CAX23126.1| putative membrane bound lytic murein transglycosylase B, mltB
           [Methylobacterium extorquens DM4]
          Length = 261

 Score =  182 bits (461), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 100/245 (40%), Positives = 137/245 (55%), Gaps = 10/245 (4%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDY 94
           C + A  F  WK    A A  +G +   +    A+  Y   TI+ DR    S  +S   +
Sbjct: 26  CGNNAAGFEAWKDEFAAEA--KGRASPASLAALANTSYSTATISADRGQ-KSFKLSLDQF 82

Query: 95  LDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLST 154
           L     + I+++G ALK  N+ L  ++++ YGVPPG L+A+WG+ET FG   G    LS 
Sbjct: 83  LAKRGGNTIVSRGRALKAQNAALFASIEQRYGVPPGPLLAIWGMETGFGAVKGNVNTLSA 142

Query: 155 LATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDAD 214
           +ATLAYDCRR+ +FT+Q + AL LV  GV++    GA  GE+G  QFLP NV+ Y +   
Sbjct: 143 VATLAYDCRRSAYFTDQLYAALKLVDSGVLTPATRGAAHGEVGHTQFLPKNVLTYGVGGS 202

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIA 274
            D       S   A+ S A FL   GW + AGYQPGE NFA ++ WNA+  Y + IA + 
Sbjct: 203 LD-------SAPVALNSTANFLKGHGWQRGAGYQPGEPNFAAIQGWNAAGVYQRAIALLG 255

Query: 275 AHIDG 279
           A IDG
Sbjct: 256 ARIDG 260


>gi|163743920|ref|ZP_02151290.1| hypothetical protein RG210_17850 [Phaeobacter gallaeciensis 2.10]
 gi|161382765|gb|EDQ07164.1| hypothetical protein RG210_17850 [Phaeobacter gallaeciensis 2.10]
          Length = 247

 Score =  182 bits (461), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 98/245 (40%), Positives = 138/245 (56%), Gaps = 3/245 (1%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDY 94
           C +T+  F  WK    A A R G+  +   +  A+  Y   TIA DR    S   S + +
Sbjct: 6   CGNTSAGFDSWKRDFAAEAKRAGVR-QAGLNALANTTYARRTIAADRNQ-KSFRYSLEKF 63

Query: 95  LDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLST 154
           +    ++ IIAQG   K  N+     L+++YGVP GIL+A+ G+ET FG  MG + ++S 
Sbjct: 64  MQIRGANTIIAQGRKRKARNAEFFAALERKYGVPAGILIAIHGMETAFGNYMGDSQVVSA 123

Query: 155 LATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDAD 214
           + TL YDCRR++FF      AL LV +G I+    GA  GE+G  QFLP N + Y +D D
Sbjct: 124 IVTLTYDCRRSEFFKPHAIGALKLVDRGAITGATKGAKHGELGHTQFLPGNALNYGVDWD 183

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIA 274
            +G++D      DA+AS A FL K GW    GYQ GE N+ +LK WNA+  Y +++A + 
Sbjct: 184 GNGRVDFYNMG-DALASTAYFLRKKGWKPGRGYQQGEPNYKVLKQWNAATVYQQSLAIMG 242

Query: 275 AHIDG 279
             IDG
Sbjct: 243 RKIDG 247


>gi|163850482|ref|YP_001638525.1| hypothetical protein Mext_1049 [Methylobacterium extorquens PA1]
 gi|163662087|gb|ABY29454.1| conserved hypothetical protein [Methylobacterium extorquens PA1]
          Length = 265

 Score =  182 bits (461), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 100/245 (40%), Positives = 137/245 (55%), Gaps = 10/245 (4%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDY 94
           C + A  F  WK    A A  +G +   +    A+  Y   TI+ DR    S  +S   +
Sbjct: 30  CGNNAAGFEAWKDEFAAEA--KGRASPASLAALANTSYSTATISADRGQ-KSFKLSLDQF 86

Query: 95  LDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLST 154
           L     + I+++G ALK  N+ L  ++++ YGVPPG L+A+WG+ET FG   G    LS 
Sbjct: 87  LAKRGGNTIVSRGRALKAQNAALFASIEQRYGVPPGPLLAIWGMETGFGAVKGNVNTLSA 146

Query: 155 LATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDAD 214
           +ATLAYDCRR+ +FT+Q + AL LV  GV++    GA  GE+G  QFLP NV+ Y +   
Sbjct: 147 VATLAYDCRRSAYFTDQLYAALKLVDSGVLTPATRGAAHGEVGHTQFLPKNVLTYGVGGS 206

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIA 274
            D       S   A+ S A FL   GW + AGYQPGE NFA ++ WNA+  Y + IA + 
Sbjct: 207 LD-------SAPVALNSTANFLKGHGWQRGAGYQPGEPNFAAIQGWNAAGVYQRAIALLG 259

Query: 275 AHIDG 279
           A IDG
Sbjct: 260 ARIDG 264


>gi|240137544|ref|YP_002962015.1| putative membrane bound lytic murein transglycosylase B, mltB
           [Methylobacterium extorquens AM1]
 gi|240007512|gb|ACS38738.1| putative membrane bound lytic murein transglycosylase B, mltB
           [Methylobacterium extorquens AM1]
          Length = 254

 Score =  181 bits (460), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 100/245 (40%), Positives = 137/245 (55%), Gaps = 10/245 (4%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDY 94
           C + A  F  WK    A A  +G +   +    A+  Y   TI+ DR    S  +S   +
Sbjct: 19  CGNNAAGFEAWKDEFAAEA--KGRASPASLAALANTSYSTATISADRGQ-KSFKLSLDQF 75

Query: 95  LDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLST 154
           L     + I+++G ALK  N+ L  ++++ YGVPPG L+A+WG+ET FG   G    LS 
Sbjct: 76  LAKRGGNTIVSRGRALKAQNAALFASIEQRYGVPPGPLLAIWGMETGFGAVKGNVNTLSA 135

Query: 155 LATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDAD 214
           +ATLAYDCRR+ +FT+Q + AL LV  GV++    GA  GE+G  QFLP NV+ Y +   
Sbjct: 136 VATLAYDCRRSAYFTDQLYAALKLVDSGVLTPATRGAAHGEVGHTQFLPKNVLTYGVGGS 195

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIA 274
            D       S   A+ S A FL   GW + AGYQPGE NFA ++ WNA+  Y + IA + 
Sbjct: 196 LD-------SAPVALNSTANFLKGHGWQRGAGYQPGEPNFAAIQGWNAAGVYQRAIALLG 248

Query: 275 AHIDG 279
           A IDG
Sbjct: 249 ARIDG 253


>gi|163736124|ref|ZP_02143543.1| hypothetical protein RGBS107_13371 [Phaeobacter gallaeciensis
           BS107]
 gi|161389994|gb|EDQ14344.1| hypothetical protein RGBS107_13371 [Phaeobacter gallaeciensis
           BS107]
          Length = 255

 Score =  181 bits (460), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 98/245 (40%), Positives = 138/245 (56%), Gaps = 3/245 (1%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDY 94
           C +T+  F  WK    A A R G+  +   +  A+  Y   TIA DR    S   S + +
Sbjct: 14  CGNTSAGFDSWKRDFAAEAKRAGVR-QAGLNALANTTYARRTIAADRNQ-KSFRYSLEKF 71

Query: 95  LDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLST 154
           +    ++ IIAQG   K  N+     L+++YGVP GIL+A+ G+ET FG  MG + ++S 
Sbjct: 72  MQIRGANTIIAQGRKRKARNAEFFAALERKYGVPAGILIAIHGMETAFGNYMGDSQVVSA 131

Query: 155 LATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDAD 214
           + TL YDCRR++FF      AL LV +G I+    GA  GE+G  QFLP N + Y +D D
Sbjct: 132 IVTLTYDCRRSEFFKPHAIGALKLVDRGAITGATKGAKHGELGHTQFLPGNALNYGVDWD 191

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIA 274
            +G++D      DA+AS A FL K GW    GYQ GE N+ +LK WNA+  Y +++A + 
Sbjct: 192 GNGRVDFYNMG-DALASTAYFLRKKGWKPGRGYQQGEPNYKVLKQWNAATVYQQSLAIMG 250

Query: 275 AHIDG 279
             IDG
Sbjct: 251 RKIDG 255


>gi|260426140|ref|ZP_05780119.1| lytic murein transglycosylase [Citreicella sp. SE45]
 gi|260420632|gb|EEX13883.1| lytic murein transglycosylase [Citreicella sp. SE45]
          Length = 270

 Score =  181 bits (459), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 101/271 (37%), Positives = 151/271 (55%), Gaps = 6/271 (2%)

Query: 11  LLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADL 70
           LL+    +LA A+T    A     C + A  F  WK    A A R G+  +  + L  + 
Sbjct: 4   LLLKAVAVLATAITFAGGAQAA-TCGNNAGGFEAWKREFAAEAQRAGVGQRGIQALM-NA 61

Query: 71  EYLDTTIARDRKMVTSPPVSFKDYLD-GLSSSEIIAQ-GIALKKANSRLLINLKKEYGVP 128
            Y  +TIA DR        S  D++   L S +  A+ G    + N +    +++ YGVP
Sbjct: 62  SYSTSTIAADRNQ-KGVKYSLNDFIRIRLGSVDGFAKTGRGRVQRNPQFYAAIEQRYGVP 120

Query: 129 PGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHA 188
            GIL+++ G+ET FG TMG  P++S+++T+AYDCRR+ FFT     AL +V +G+++ + 
Sbjct: 121 AGILVSIHGMETGFGRTMGNVPVVSSISTVAYDCRRSSFFTPHALAALQMVDRGMLAPNQ 180

Query: 189 LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQ 248
            GA  GE+G  QFLP N ++Y +D + DG++D   +  DA+AS A FL + GW     Y 
Sbjct: 181 KGAAHGELGHTQFLPGNALRYGVDGNGDGRVDFY-NEWDALASTANFLRQKGWQPGQPYN 239

Query: 249 PGEKNFAILKHWNASLNYNKTIAYIAAHIDG 279
            G +NF +L  WNA+  Y + IA +AA IDG
Sbjct: 240 EGTRNFRVLNEWNAATVYQQAIALVAARIDG 270


>gi|99080860|ref|YP_613014.1| hypothetical protein TM1040_1019 [Ruegeria sp. TM1040]
 gi|99037140|gb|ABF63752.1| hypothetical protein TM1040_1019 [Ruegeria sp. TM1040]
          Length = 270

 Score =  181 bits (459), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 101/272 (37%), Positives = 147/272 (54%), Gaps = 13/272 (4%)

Query: 8   LISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLF 67
           L++ L +  P + +A +          C +TA  F  WK A  AR  +     +   +  
Sbjct: 11  LVTCLAVATPEVVRAAS----------CGNTAAGFEAWK-ADFARTAKRAGVRQAGLNAL 59

Query: 68  ADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGV 127
           A   Y   TIA DR    S   S + ++    ++ I+AQG   K  N+     L+++YGV
Sbjct: 60  AQTRYATGTIAADRNQ-KSFRYSLEKFMQVRGATTIVAQGRRHKARNAEFFAALERKYGV 118

Query: 128 PPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSH 187
           P G+L+A+ G+ET FG  MG + ++S++ TL YDCRR++FF      AL LV +G IS  
Sbjct: 119 PAGLLIAIHGMETAFGNYMGDSQVVSSIVTLTYDCRRSEFFEPHAIGALKLVDQGAISMA 178

Query: 188 ALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGY 247
             GA  GE+G  QFLP N +KY  D + DG++D      DA+AS A FL + GW    GY
Sbjct: 179 TKGAKHGELGHTQFLPGNALKYGQDWNRDGRVDFYDMG-DALASTAHFLRQKGWRPGKGY 237

Query: 248 QPGEKNFAILKHWNASLNYNKTIAYIAAHIDG 279
           Q GE N+ +LK WNA+  Y +++A +   IDG
Sbjct: 238 QQGEPNYKVLKQWNAATVYQQSLAIMGRQIDG 269


>gi|170740321|ref|YP_001768976.1| hypothetical protein M446_2079 [Methylobacterium sp. 4-46]
 gi|168194595|gb|ACA16542.1| conserved hypothetical protein [Methylobacterium sp. 4-46]
          Length = 266

 Score =  181 bits (458), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 99/247 (40%), Positives = 136/247 (55%), Gaps = 14/247 (5%)

Query: 35  CSDTADRFGEWKS--AARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFK 92
           C +    F  WK   A  AR    G +   +        Y   TIA DR    S  +S +
Sbjct: 30  CGNGPGGFEAWKREFAEEAR----GRASAASLQALMGTSYSSPTIAADRGQ-KSFRLSLE 84

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
            ++       I+++G AL+ +N+ L   +++ YGVPPG L+A+WG+ET FG   G    L
Sbjct: 85  QFMAKRGGPAIVSRGRALRASNAALFAGIEQRYGVPPGPLLAIWGMETGFGAVKGNVNTL 144

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAID 212
           S +ATLAYDCRR+ +FT+Q + AL L+ +GV+S    GA  GE+G  QFLP NV+ Y   
Sbjct: 145 SAVATLAYDCRRSAYFTDQLYAALALIDRGVMSPSTRGAAHGEVGHTQFLPKNVLNYGT- 203

Query: 213 ADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAY 272
               G +D V    +A+ S A FL   GW + AGYQPGE NFA ++ WNA+  Y + IA 
Sbjct: 204 ---GGSLDNVS---NALNSTANFLRAHGWQRGAGYQPGEPNFAAIQGWNAASVYQRAIAI 257

Query: 273 IAAHIDG 279
           I   IDG
Sbjct: 258 IGKRIDG 264


>gi|304393133|ref|ZP_07375061.1| lytic murein transglycosylase [Ahrensia sp. R2A130]
 gi|303294140|gb|EFL88512.1| lytic murein transglycosylase [Ahrensia sp. R2A130]
          Length = 293

 Score =  181 bits (458), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 101/249 (40%), Positives = 144/249 (57%), Gaps = 7/249 (2%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDY 94
           CS+T+  F ++K    A+A R G+  K  K L  D +Y ++ I  DR+       + +  
Sbjct: 46  CSNTSAGFNQFKKNFAAKAKRNGIGRKGVKVLM-DAKYSNSVIKFDRRQAKFFKSAGRSK 104

Query: 95  LDGLSSSEIIAQGIA--LKKA---NSRLLINLKKEYGVPPGILMALWGLETHFGETMGKT 149
            +  S      +G+A  +K+A   N RL  +L+K +GV   +L  +WG+ET+FG   GK 
Sbjct: 105 TNFNSFYSKKTKGLAPRVKRALSKNKRLFRSLEKNFGVQKEVLATIWGMETNFGGYTGKI 164

Query: 150 PLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVK 208
             ++ LATL +DCRR   F++    A+ +  KG IS  A+ GA  GE+GQ QF+  N +K
Sbjct: 165 DTMNALATLTHDCRRTGLFSKNLLAAMKIYDKGWISRAAMKGAGHGELGQMQFMAENYLK 224

Query: 209 YAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNK 268
           YAID + DGK DLV+S  DA+ASAA FL + GW +   YQPG KNF +L  WN S  Y +
Sbjct: 225 YAIDYNNDGKRDLVRSRADALASAANFLVRNGWQRMGSYQPGSKNFRVLNSWNESTAYQQ 284

Query: 269 TIAYIAAHI 277
           TIA  AA +
Sbjct: 285 TIAKFAASL 293


>gi|300024543|ref|YP_003757154.1| lytic murein transglycosylase [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299526364|gb|ADJ24833.1| lytic murein transglycosylase [Hyphomicrobium denitrificans ATCC
           51888]
          Length = 281

 Score =  181 bits (458), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 93/247 (37%), Positives = 142/247 (57%), Gaps = 3/247 (1%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDY 94
           C +    F  W    ++RA  +G+ P+T     + + Y  T I  DR    S  +SF+ +
Sbjct: 34  CGNGPQGFDAWLQGFKSRAAAQGIKPETVSRALSGVTYDPTVIRLDRSQ-HSFKLSFQQF 92

Query: 95  LDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFG-ETMGKTPLLS 153
                +  +I +G +L + +   L  ++K +GVP  +++A+WGLETH+G +   +  +L 
Sbjct: 93  YARRVNGALINRGKSLMRTHRATLDRIEKRFGVPGAVIVAIWGLETHYGADASARYSILR 152

Query: 154 TLATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAID 212
           +LATLAYDCRR++FFT Q   A+ +V +G +S S   G   GEIGQ QFLP   V+YA+D
Sbjct: 153 SLATLAYDCRRSEFFTGQLLDAIRIVGRGDLSPSQMRGGWAGEIGQTQFLPTPYVRYAVD 212

Query: 213 ADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAY 272
            D +G  DLV+S  D +AS A FLA  GW +   +QPG  N+ ++  WN +  Y +TIA 
Sbjct: 213 FDGNGHRDLVRSVPDILASTANFLASHGWQRGGSWQPGSANYGVIGQWNKAEVYQRTIAA 272

Query: 273 IAAHIDG 279
           +A  + G
Sbjct: 273 MATQLAG 279


>gi|89053649|ref|YP_509100.1| hypothetical protein Jann_1158 [Jannaschia sp. CCS1]
 gi|88863198|gb|ABD54075.1| hypothetical protein Jann_1158 [Jannaschia sp. CCS1]
          Length = 273

 Score =  180 bits (456), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 104/273 (38%), Positives = 155/273 (56%), Gaps = 15/273 (5%)

Query: 8   LISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLF 67
           +++ L++  PM A A T          C + A  F  W+    A A   G+     + L 
Sbjct: 13  IVTSLLLGAPMAAVAAT----------CGNDASGFARWQQEFAAEAAAAGVGQAGLQAL- 61

Query: 68  ADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGV 127
           A   Y   TI+ DR    S   S ++++    +  I+ QG     AN     +L++ YGV
Sbjct: 62  AATTYATRTISADRNQ-RSFSYSLEEFMRIRGADAIVRQGRQRIAANPEFYASLERAYGV 120

Query: 128 PPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSH 187
           P  +++A+ G+ET FG  MG   ++S +ATLAYDCRR+ FF+E    AL LV +G IS +
Sbjct: 121 PAAVIVAIHGMETGFGNFMGDANVVSAIATLAYDCRRSAFFSEHALAALILVDRGAISPN 180

Query: 188 ALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNI-DAIASAAKFLAKLGWTKCAG 246
           ++GA  GE+G  QFLP NV++Y +D + DG+IDL  SN  DA+AS A FL + GW +  G
Sbjct: 181 SIGAMHGELGHTQFLPGNVLRYGVDGNGDGRIDL--SNFTDAMASTANFLRQNGWRQGRG 238

Query: 247 YQPGEKNFAILKHWNASLNYNKTIAYIAAHIDG 279
           YQ G++NF  ++ WNA+  Y + IA +A+ I+G
Sbjct: 239 YQEGQRNFRAIQAWNAAPVYQRAIAIMASRIEG 271


>gi|149913892|ref|ZP_01902424.1| hypothetical protein RAZWK3B_17853 [Roseobacter sp. AzwK-3b]
 gi|149812176|gb|EDM72007.1| hypothetical protein RAZWK3B_17853 [Roseobacter sp. AzwK-3b]
          Length = 268

 Score =  180 bits (456), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 101/244 (41%), Positives = 142/244 (58%), Gaps = 3/244 (1%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDY 94
           C +    F  WKSA  A A R G+     + L A+ +Y   TIA DR    S   + + +
Sbjct: 26  CGNDGAGFAAWKSAFAAEAARAGVGQPGLRAL-ANAQYASRTIAADRNQ-KSFRYTLEKF 83

Query: 95  LDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLST 154
           +    +  IIAQG   K  ++     L+++YGVP G+L+A+ G+ET FG  MG + ++S 
Sbjct: 84  MQVRGAETIIAQGRKRKARDAAFYDALERQYGVPAGVLIAIHGMETGFGGFMGDSAVVSA 143

Query: 155 LATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDAD 214
           + TLAYDCRR+ FF      AL LV +G I++   GA  GE+G  QFLP N + Y +DA+
Sbjct: 144 ITTLAYDCRRSDFFIPHAIGALKLVDRGTITADTRGAKHGELGHTQFLPGNALTYGVDAN 203

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIA 274
            DG++DL   + DA+AS A FL + GW   AGYQ GE NF +++ WNA+  Y K IA +A
Sbjct: 204 GDGRVDLYTLS-DALASTANFLRQKGWQPGAGYQEGEPNFRVIQQWNAAGVYQKAIAIMA 262

Query: 275 AHID 278
             ID
Sbjct: 263 ERID 266


>gi|217979773|ref|YP_002363920.1| hypothetical protein Msil_3674 [Methylocella silvestris BL2]
 gi|217505149|gb|ACK52558.1| conserved hypothetical protein [Methylocella silvestris BL2]
          Length = 272

 Score =  179 bits (454), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 103/272 (37%), Positives = 152/272 (55%), Gaps = 21/272 (7%)

Query: 13  MMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSA----ARARAV-REGMSPKTAKHLF 67
           ++V  M+A A+   + +  Q  C ++A  F  WKS     A+ R V   G++     H  
Sbjct: 10  VVVAAMMAFAIAPGQASAAQ--CGNSAAGFEAWKSQFANEAKGRGVGAAGIAAIQGTH-- 65

Query: 68  ADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGV 127
               Y   TI  DR       +S   ++     + I A+G ALK++N+ L  ++++ YGV
Sbjct: 66  ----YNGATIGADRGQ-HGFRLSLDQFMAKRGGNTIAARGRALKQSNAGLFASIQQRYGV 120

Query: 128 PPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSH 187
           P G L+A+WG ET FG   G    LS +ATLAYDCRR+ +FT+Q + AL L+ +G++S++
Sbjct: 121 PAGPLIAIWGFETGFGAVHGNQHALSAVATLAYDCRRSAYFTDQLYAALTLIDRGLMSAN 180

Query: 188 ALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGY 247
             G+  GEIGQ QFLP N+++Y   A+ D       +   A+ + A FL   GW+  AGY
Sbjct: 181 ERGSMHGEIGQTQFLPKNILEYGGGANLD-------TPSGALNATAAFLKAHGWSPGAGY 233

Query: 248 QPGEKNFAILKHWNASLNYNKTIAYIAAHIDG 279
           QPGE NFA L+ WNA+  Y + IA +   IDG
Sbjct: 234 QPGEANFAALQAWNAASVYQQAIAMVGQKIDG 265


>gi|259418572|ref|ZP_05742489.1| lytic murein transglycosylase [Silicibacter sp. TrichCH4B]
 gi|259344794|gb|EEW56648.1| lytic murein transglycosylase [Silicibacter sp. TrichCH4B]
          Length = 269

 Score =  178 bits (452), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 96/245 (39%), Positives = 137/245 (55%), Gaps = 3/245 (1%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDY 94
           C +T+  F  WK A  AR  +     +   +  A   Y   TIA DR    S   S + +
Sbjct: 28  CGNTSAGFEAWK-ADFARTAKRAGVRQAGLNALAQTRYATGTIAADRNQ-KSFRYSLEKF 85

Query: 95  LDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLST 154
           +    ++ I+AQG   K  N+     L+++YGVP G+L+A+ G+ET FG  MG + ++S+
Sbjct: 86  MQVRGATTIVAQGRKHKARNAEFFAALERKYGVPAGLLIAIHGMETAFGNYMGDSQVVSS 145

Query: 155 LATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDAD 214
           + TL YDCRR+KFF      AL LV +G IS    GA  GE+G  QFLP N ++Y  D +
Sbjct: 146 IVTLTYDCRRSKFFEPHAIGALKLVDQGAISMATKGAKHGELGHTQFLPGNALEYGQDWN 205

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIA 274
            DG++D      DA+AS A FL + GW    GYQ GE N+ +LK WNA+  Y +++A + 
Sbjct: 206 GDGRVDFYNMG-DALASTANFLRQKGWRPGKGYQQGEPNYKVLKQWNAATVYQQSLAIMG 264

Query: 275 AHIDG 279
             IDG
Sbjct: 265 RQIDG 269


>gi|220920475|ref|YP_002495776.1| hypothetical protein Mnod_0431 [Methylobacterium nodulans ORS 2060]
 gi|219945081|gb|ACL55473.1| conserved hypothetical protein [Methylobacterium nodulans ORS 2060]
          Length = 265

 Score =  178 bits (452), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 97/249 (38%), Positives = 139/249 (55%), Gaps = 18/249 (7%)

Query: 35  CSDTADRFGEWK----SAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVS 90
           C +    F  WK      AR R    G+S            Y   TIA DR    S  +S
Sbjct: 30  CGNGPAGFEAWKREFAEEARGRVGATGVS------ALMGTSYSSATIAADRGQ-KSFRLS 82

Query: 91  FKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTP 150
              +L       I+++G ALK++N+ L  ++++ YGVPPG L+A+WG+ET FG + G   
Sbjct: 83  LDQFLAKRGGPAIVSRGRALKQSNAALFASIEQRYGVPPGPLLAIWGMETGFGASRGNVN 142

Query: 151 LLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYA 210
            LS +ATLAYDCRR+ +FT+Q + AL LV +G++S    GA  GE+G  QFLP +++ Y 
Sbjct: 143 TLSAVATLAYDCRRSAYFTDQLYAALTLVDRGILSPSTRGAAHGEVGHTQFLPKSILNYG 202

Query: 211 IDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTI 270
                 G +D V + ++A A+   FL   GW + AGYQPGE NF+ ++ WN++  Y + I
Sbjct: 203 T----GGSLDSVPNALNATAN---FLRAHGWQRGAGYQPGEPNFSAIQGWNSASVYQRAI 255

Query: 271 AYIAAHIDG 279
           A I   IDG
Sbjct: 256 ALIGRRIDG 264


>gi|114765308|ref|ZP_01444425.1| hypothetical protein 1100011001355_R2601_24714 [Pelagibaca
           bermudensis HTCC2601]
 gi|114542288|gb|EAU45317.1| hypothetical protein R2601_24714 [Roseovarius sp. HTCC2601]
          Length = 270

 Score =  177 bits (449), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 95/251 (37%), Positives = 139/251 (55%), Gaps = 15/251 (5%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDY 94
           C + A  F  WK A  A A R G+  +  + L  + +Y  TTI+ DR        +  D+
Sbjct: 27  CGNNASGFNAWKQAFAAEAQRAGVGQRGIQALM-NAQYSTTTISADRNQ-KGVKYALNDF 84

Query: 95  -------LDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMG 147
                  LDG +++     G    + N +    +++ YGVP GIL+A+ G+ET FG TMG
Sbjct: 85  IRIRLGSLDGFAAT-----GRKRIQRNPQFYAAVEQRYGVPAGILVAIHGMETGFGRTMG 139

Query: 148 KTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVV 207
             P++S+++T+AYDCRR+ FFT     AL +V +G++S    GA  GE+G  QFLP N +
Sbjct: 140 NVPVVSSISTVAYDCRRSSFFTPHALAALQMVDRGMLSPTQKGAAHGELGHTQFLPGNAM 199

Query: 208 KYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYN 267
           +Y +D + DG++D   +  DA+AS A FL + GW     YQ G  NF +L  WNA+  Y 
Sbjct: 200 RYGVDGNGDGRVDFY-NEWDALASTANFLRQKGWRPGQPYQQGTANFRVLNEWNAATVYQ 258

Query: 268 KTIAYIAAHID 278
           + IA  A  ID
Sbjct: 259 QAIALAAERID 269


>gi|323138792|ref|ZP_08073856.1| hypothetical protein Met49242DRAFT_3244 [Methylocystis sp. ATCC
           49242]
 gi|322395940|gb|EFX98477.1| hypothetical protein Met49242DRAFT_3244 [Methylocystis sp. ATCC
           49242]
          Length = 271

 Score =  177 bits (448), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 103/277 (37%), Positives = 146/277 (52%), Gaps = 12/277 (4%)

Query: 3   FKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKT 62
            +  L  S   MV+   A   + P  +  Q  C +    F  WK      A   G  P  
Sbjct: 1   MRNLLWRSSAAMVF-TAATLGSAPSASAAQ--CGNGPGGFERWKQDFAEEARASGHGPGA 57

Query: 63  AKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLK 122
              L     Y   TI+ DR    S  +S   ++    +S I+A+G +LK++ + L  +++
Sbjct: 58  IDALMG-THYNTATISADRGQ-KSFRLSLDQFMAKRGASAIVARGRSLKRSQAALFSSIQ 115

Query: 123 KEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKG 182
           + YGVPPG L+A+WG+ET FG  +G    LS +ATLAYDCRR+ +FT+Q   AL L+  G
Sbjct: 116 QRYGVPPGPLLAIWGMETGFGAVLGNQHALSAIATLAYDCRRSDYFTDQLNAALTLIDHG 175

Query: 183 VISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWT 242
            +S +A G+  GEIGQ QFLP N++ Y       G +D   +   A+++ A FL   GW 
Sbjct: 176 TLSPNARGSMHGEIGQTQFLPKNILNYG----GGGNLDNAGA---ALSATANFLRAHGWR 228

Query: 243 KCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHIDG 279
             AGYQPGE NF  ++ WNA+  Y + IA I   IDG
Sbjct: 229 PGAGYQPGEPNFDAIQAWNAASVYQRAIAIIGRQIDG 265


>gi|254486981|ref|ZP_05100186.1| lytic murein transglycosylase [Roseobacter sp. GAI101]
 gi|214043850|gb|EEB84488.1| lytic murein transglycosylase [Roseobacter sp. GAI101]
          Length = 267

 Score =  176 bits (447), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 97/249 (38%), Positives = 136/249 (54%), Gaps = 11/249 (4%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDY 94
           C + A  F  WK+A    A   G+  +    L A+ +Y   TIA DR        SFK  
Sbjct: 26  CGNNAGGFNSWKAAFAQEAAAAGVGKRGLDAL-ANAQYASRTIAADRNQK-----SFKYT 79

Query: 95  LDGL----SSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTP 150
           LD       +  I+AQG   K  N     +L+  +GVP G+++A+ G+ET FG  MG + 
Sbjct: 80  LDKFMQVRGADTIVAQGRKRKARNPAFYQSLEARFGVPAGVIIAIHGMETAFGGFMGDSA 139

Query: 151 LLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYA 210
           ++S + TL YDCRR+ FF      AL LV +G I+    GA  GE+G  QFLP N ++Y 
Sbjct: 140 VVSAITTLTYDCRRSDFFAPHAIGALKLVDQGAINGSTKGAKHGELGHTQFLPGNALRYG 199

Query: 211 IDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTI 270
           +D + DG++D      DA+AS A FL + GW    GYQ G+ NF +++ WNA+  Y K I
Sbjct: 200 VDGNGDGRVDFY-DQTDALASTANFLRQKGWQPGGGYQEGQTNFNVIQQWNAAGVYQKAI 258

Query: 271 AYIAAHIDG 279
           A +A+ IDG
Sbjct: 259 AIMASRIDG 267


>gi|118588715|ref|ZP_01546123.1| hypothetical protein SIAM614_18454 [Stappia aggregata IAM 12614]
 gi|118438701|gb|EAV45334.1| hypothetical protein SIAM614_18454 [Stappia aggregata IAM 12614]
          Length = 268

 Score =  176 bits (446), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 89/245 (36%), Positives = 143/245 (58%), Gaps = 2/245 (0%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDY 94
           C +    F  WK A  A +   G+  +  +    +++Y    ++ DR    S  +SF  +
Sbjct: 24  CGNGPGGFEAWKQAFIANSQSYGLKQRVVESSLKNVKYSKKVVSLDRNQ-KSFKLSFNQF 82

Query: 95  LDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLST 154
                ++ +I +G  L K  +R+   ++K+YGVP  I++++WGLET++G   G  P+L +
Sbjct: 83  YAKRVNNAMIRRGKQLGKTYARIFRGIEKKYGVPAPIILSIWGLETNYGSFSGNMPVLQS 142

Query: 155 LATLAYDCRRAKFFTEQFFYALDLVK-KGVISSHALGATFGEIGQFQFLPVNVVKYAIDA 213
           LATLAYDCRR+ FFT +   AL +V+ + +  +   GA  GE+GQ QFL  + V+YA+D 
Sbjct: 143 LATLAYDCRRSDFFTAELIAALTIVQSRDMQPAEMKGAWAGELGQTQFLATSYVRYAVDY 202

Query: 214 DEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYI 273
           D DG+ DL++S  D +AS A +LA+ GW +  G+ PG  N+ +LK WN +  Y +TI+ +
Sbjct: 203 DRDGRKDLIRSIPDVLASTANYLAQKGWRRGQGWGPGTANYNVLKQWNKASVYVETISVM 262

Query: 274 AAHID 278
           A  I 
Sbjct: 263 AGQIS 267


>gi|170746792|ref|YP_001753052.1| hypothetical protein Mrad2831_0346 [Methylobacterium radiotolerans
           JCM 2831]
 gi|170653314|gb|ACB22369.1| conserved hypothetical protein [Methylobacterium radiotolerans JCM
           2831]
          Length = 264

 Score =  175 bits (444), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 98/246 (39%), Positives = 139/246 (56%), Gaps = 15/246 (6%)

Query: 35  CSDTADRFGEWKS--AARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFK 92
           C +TA  F  WK   A  AR    G +   +     +  Y   TI+ DR    S  +S  
Sbjct: 30  CGNTAAGFDAWKRQFAEEAR----GRASAASLAALQNTTYSTATISADRGQ-HSFKLSLD 84

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
            +L       I+ +G ALK+ N+ L  ++++ YGVPPG L+A+WG+ET FG   G    L
Sbjct: 85  QFLAKRGGPTIVKRGRALKQQNAALFDSIEQRYGVPPGPLLAIWGMETGFGAVRGNVNTL 144

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAID 212
           S +ATLAYDCRR+++FT+Q + AL L+ +G+++ +  GA  GE+G  QFLP NV+ Y   
Sbjct: 145 SAVATLAYDCRRSEYFTDQLYAALTLIDRGLLTPNTRGAAHGEVGHTQFLPKNVLAYGT- 203

Query: 213 ADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAY 272
               G ++ V +   A++S A FL   GW   AGYQPGE NFA ++ WNA+  Y K IA 
Sbjct: 204 ----GDLNNVGA---ALSSTANFLKAHGWRAGAGYQPGEPNFAAIQGWNAAPVYEKAIAL 256

Query: 273 IAAHID 278
           +   ID
Sbjct: 257 LGRQID 262


>gi|255262350|ref|ZP_05341692.1| lytic murein transglycosylase [Thalassiobium sp. R2A62]
 gi|255104685|gb|EET47359.1| lytic murein transglycosylase [Thalassiobium sp. R2A62]
          Length = 262

 Score =  174 bits (442), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 92/245 (37%), Positives = 138/245 (56%), Gaps = 3/245 (1%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDY 94
           C + A  F  WKS     A  +G+  +    L A   Y   TIA DR    S   S + +
Sbjct: 21  CGNDASGFDRWKSQFSQEAAAQGVGQRGLNAL-ASARYATRTIAADRNQ-KSFRYSLEKF 78

Query: 95  LDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLST 154
           ++   ++ I+ QG      N R    ++  YGVP  +++A+ G+ET FG  MG + ++S 
Sbjct: 79  MEIRGATTIVRQGRQRIAQNPRFYRAIEARYGVPAEVIVAIHGMETGFGRFMGDSNVVSA 138

Query: 155 LATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDAD 214
           + TLAYDCRR++FF+     AL LV  G ++++  GA  GE+G  QFLP N ++Y +DA+
Sbjct: 139 ITTLAYDCRRSEFFSGHALGALKLVDGGGLAANTQGAMHGELGHTQFLPGNALRYGVDAN 198

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIA 274
            DG++DL     D++AS A FL + GW    GYQ G+ NF +++ WNA+  Y KTIA +A
Sbjct: 199 GDGRVDLTNL-TDSLASTANFLRQKGWRLGQGYQEGQPNFRVIQEWNAAGVYQKTIAIMA 257

Query: 275 AHIDG 279
             + G
Sbjct: 258 GQMAG 262


>gi|328545779|ref|YP_004305888.1| Lytic murein transglycosylase [polymorphum gilvum SL003B-26A1]
 gi|326415519|gb|ADZ72582.1| Lytic murein transglycosylase [Polymorphum gilvum SL003B-26A1]
          Length = 273

 Score =  173 bits (438), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 102/271 (37%), Positives = 146/271 (53%), Gaps = 13/271 (4%)

Query: 8   LISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLF 67
           L+SL +   P  A A            C D    F  W  A +  A   G+   T +   
Sbjct: 13  LVSLCLFFVPPAAAAR-----------CGDGPAGFPVWLEAFKREAPGHGLKGHTVEAAL 61

Query: 68  ADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGV 127
           A + Y D  + R  +   S  +SF+ +      + +IA+G  L +  + LL  ++K YGV
Sbjct: 62  AGVTY-DPQVVRLDRSQKSFKLSFEQFYARRVDNAMIARGQRLARDYAGLLGRIEKTYGV 120

Query: 128 PPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSH 187
           PP +L+A+WGLET +G   GK  +L +LATLAYDCRR+ FFT +   AL +V++G ++  
Sbjct: 121 PPAVLIAIWGLETGYGANSGKMSVLRSLATLAYDCRRSAFFTNELVAALKIVQRGDMAPA 180

Query: 188 AL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAG 246
            + GA  GEIGQ QFL  + + YA+D D DG+ DL++S  D +AS A +L   GW     
Sbjct: 181 EMRGAWAGEIGQTQFLASSYLNYAVDGDRDGRRDLIRSVPDVLASTANYLKAKGWRAGQP 240

Query: 247 YQPGEKNFAILKHWNASLNYNKTIAYIAAHI 277
           + PG  N A+LK WN +  Y KTIA +A  I
Sbjct: 241 WGPGTANHAVLKEWNRAEVYVKTIAVMAEKI 271


>gi|126739507|ref|ZP_01755200.1| hypothetical protein RSK20926_21360 [Roseobacter sp. SK209-2-6]
 gi|126719607|gb|EBA16316.1| hypothetical protein RSK20926_21360 [Roseobacter sp. SK209-2-6]
          Length = 266

 Score =  171 bits (434), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 99/244 (40%), Positives = 139/244 (56%), Gaps = 3/244 (1%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDY 94
           C +TA  F  WK++    A R G+     + L ++  Y   TIA DR    S   S + +
Sbjct: 25  CGNTAAGFEAWKASFAKTAKRAGVKRPGLQAL-SNARYASRTIAADRNQ-KSFRYSLEKF 82

Query: 95  LDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLST 154
           +    S  IIAQG   +  N      L+K+YGVP G+L+A+ G+ET FG  MG + ++S 
Sbjct: 83  MQVRGSETIIAQGRKRRARNQAFFAALEKKYGVPAGVLIAIHGMETAFGNFMGDSQVVSA 142

Query: 155 LATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDAD 214
           + TL YDCRR+ FF      AL LV +G I+S  LGA  GE+G  QFLP N +++ +D D
Sbjct: 143 IVTLTYDCRRSAFFEPHALGALKLVDQGAITSATLGAKHGELGHTQFLPGNALRFGVDWD 202

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIA 274
            +G++D      DA+AS A FL K GW +  GYQ GE NF +LK WNA+  Y +++A + 
Sbjct: 203 RNGRVDFYNLE-DALASTAFFLKKKGWKRGKGYQQGEPNFRVLKEWNAATVYQQSLAIMG 261

Query: 275 AHID 278
             ID
Sbjct: 262 RRID 265


>gi|296448573|ref|ZP_06890446.1| lytic murein transglycosylase [Methylosinus trichosporium OB3b]
 gi|296253913|gb|EFH01067.1| lytic murein transglycosylase [Methylosinus trichosporium OB3b]
          Length = 276

 Score =  169 bits (428), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 96/246 (39%), Positives = 139/246 (56%), Gaps = 2/246 (0%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDY 94
           C  +A+ F  W  + +  A   G+S    +  FAD+ Y  + I+ DR        SF+ +
Sbjct: 31  CGRSAEGFEPWLDSFKREAAAAGISQHAIQASFADVYYDRSVISHDRGQKVFRQ-SFEQF 89

Query: 95  LDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLST 154
              +++S  I +G  L + ++ L   +++ YGVP  +L+A+WGLET FG   G    +  
Sbjct: 90  SARMANSFRINKGRQLLQRHAGLFRQIEQRYGVPGPVLVAIWGLETDFGSFNGSFATIRA 149

Query: 155 LATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDA 213
           LATLAYDCRRA+ F  +   AL +V +G +S   + GA  GEIGQ QF+P + +K+A+D 
Sbjct: 150 LATLAYDCRRAERFRGELLDALRIVDRGDLSPDKMRGAWAGEIGQTQFMPSSYLKFAVDF 209

Query: 214 DEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYI 273
           + DG  DLV    D +AS A FL   GW   AG+  GE NF +L  WN +  Y+KTIA +
Sbjct: 210 NGDGSRDLVHDTADVLASTANFLHGSGWKAGAGWDEGEPNFPVLLEWNKAKVYSKTIALL 269

Query: 274 AAHIDG 279
           A  IDG
Sbjct: 270 ADRIDG 275


>gi|310815505|ref|YP_003963469.1| lytic murein transglycosylase [Ketogulonicigenium vulgare Y25]
 gi|308754240|gb|ADO42169.1| lytic murein transglycosylase [Ketogulonicigenium vulgare Y25]
          Length = 259

 Score =  166 bits (420), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 91/244 (37%), Positives = 129/244 (52%), Gaps = 3/244 (1%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDY 94
           C DTA  FG WK      A + G+  +    L     Y   TI  DR    S      ++
Sbjct: 18  CGDTAAGFGAWKREFAQYAAQNGVGARGLAAL-DSATYATRTINADRNQ-RSFRYELDEF 75

Query: 95  LDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLST 154
           +       I+AQG    + N    + L+  YGVP  I++A+ G+ET FG  MG + ++S 
Sbjct: 76  MRIRGGDTIVAQGRRQIENNRDFFLQLELTYGVPSSIIVAIHGMETGFGNFMGDSNVVSA 135

Query: 155 LATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDAD 214
           + TLAYDCRR  FFT     AL LV +G IS ++ GA  GE+G  QFLP N++ Y +D +
Sbjct: 136 ITTLAYDCRRPAFFTPHALAALQLVDRGAISPNSTGAMHGELGHTQFLPGNILAYGVDGN 195

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIA 274
            DG +D+  +  D++ S A FL + GW     Y  G  NF +++ WNA+  Y + IA IA
Sbjct: 196 GDGIVDMT-NRADSLYSTANFLRQKGWQTGQSYAEGGPNFRVIQEWNAAGVYQRAIALIA 254

Query: 275 AHID 278
           + ID
Sbjct: 255 SRID 258


>gi|323139375|ref|ZP_08074426.1| lytic murein transglycosylase [Methylocystis sp. ATCC 49242]
 gi|322395368|gb|EFX97918.1| lytic murein transglycosylase [Methylocystis sp. ATCC 49242]
          Length = 271

 Score =  166 bits (420), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 92/239 (38%), Positives = 134/239 (56%), Gaps = 2/239 (0%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           FG W    +  A  EGMS        AD  Y    I+RDR        SF+ +   L + 
Sbjct: 32  FGAWLEDFKQEAASEGMSRHVIDAALADASYDRAVISRDRGQKIFRQ-SFEKFSARLITP 90

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             + +G AL + ++ LL  ++  YGVP  +L+++WGLET +G   G    +  LATLAYD
Sbjct: 91  ARLNRGRALLQRHANLLRQIEARYGVPGPVLVSIWGLETGYGADNGNFKTMQALATLAYD 150

Query: 162 CRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
           CRR+  FT++   AL +V++G +S +   G   GEIGQ QF+P + +K+A+D D DG+ D
Sbjct: 151 CRRSAQFTQELKDALKIVQRGDMSPAQMRGDWAGEIGQTQFMPSSYLKHAVDFDGDGRRD 210

Query: 221 LVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHIDG 279
           L+ S  DA+AS A FL   GW   AG++ GE NF +   WN +  Y +T+A +A  + G
Sbjct: 211 LIHSTADALASTANFLRGSGWRPDAGWEEGEPNFPVFLEWNQARVYARTLALLATKLSG 269


>gi|84502911|ref|ZP_01001024.1| lytic murein transglycosylase, putative [Oceanicola batsensis
           HTCC2597]
 gi|84388894|gb|EAQ01764.1| lytic murein transglycosylase, putative [Oceanicola batsensis
           HTCC2597]
          Length = 263

 Score =  165 bits (418), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 99/245 (40%), Positives = 140/245 (57%), Gaps = 3/245 (1%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDY 94
           C DT+  F  WK+A    A R G+  +  + L A + Y   TIA DR+  T    S +D+
Sbjct: 22  CGDTSRGFETWKAAFAQEAARAGVGQRGLQAL-AGVRYSQGTIAADRRQ-TGVRYSLQDF 79

Query: 95  LDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLST 154
           +       I++ G   K AN     ++++ YGVP GIL+A+ G+E+ FG   GK  +LS+
Sbjct: 80  MRIRGVDAIVSGGRKRKAANPAFYASIERIYGVPAGILLAIHGMESGFGSGFGKYHVLSS 139

Query: 155 LATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDAD 214
            AT+AYDCRR+ FF+     AL LV +G +  +A+GA  GEIG  QFL  NV++Y  D +
Sbjct: 140 NATVAYDCRRSDFFSGHLIAALKLVDRGWLDPNAIGAAHGEIGHTQFLAGNVLEYGRDGN 199

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIA 274
            DG++DL   + DA+ S A FL + GW     Y  G +NF +L  WNA+  Y + IA  A
Sbjct: 200 GDGRVDLYNLS-DAMVSTAHFLRQKGWRPGRPYAEGTRNFRVLNEWNAATVYQQAIAIAA 258

Query: 275 AHIDG 279
           A IDG
Sbjct: 259 ARIDG 263


>gi|182680266|ref|YP_001834412.1| lytic murein transglycosylase [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182636149|gb|ACB96923.1| lytic murein transglycosylase [Beijerinckia indica subsp. indica
           ATCC 9039]
          Length = 283

 Score =  164 bits (415), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 84/228 (36%), Positives = 134/228 (58%), Gaps = 2/228 (0%)

Query: 53  AVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKK 112
           A  +G+S  T      ++ Y  + +++D         SF+ +   + SS  + +G AL K
Sbjct: 55  ASAQGISSSTIASALDNVSYDPSIVSKDHGQHVFR-QSFEQFSGRMVSSYRLHKGAALIK 113

Query: 113 ANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQF 172
             + +   +++++GVP  I++A+WGLET FG   G TP    LATLA+DCRR+  F  + 
Sbjct: 114 QYAGVFNRIEQQFGVPAPIIVAIWGLETDFGAVNGNTPTFRALATLAFDCRRSPMFQSEL 173

Query: 173 FYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIAS 231
             AL +V++G +   A+ GA  GEIGQ QF+P +  K+A+D   +G+ DL+    D +AS
Sbjct: 174 IDALRVVQRGDLPPSAMRGAWAGEIGQTQFMPSSYYKFAVDFSGNGRRDLIHDVPDVLAS 233

Query: 232 AAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHIDG 279
            A FL+  GW + AG+ PG+ NF ++K WN +  Y++TIAY A  ++G
Sbjct: 234 TANFLSSYGWKRGAGWAPGQPNFPVIKEWNKADVYSRTIAYFATRLNG 281


>gi|209884285|ref|YP_002288142.1| lytic murein transglycosylase [Oligotropha carboxidovorans OM5]
 gi|209872481|gb|ACI92277.1| lytic murein transglycosylase [Oligotropha carboxidovorans OM5]
          Length = 271

 Score =  164 bits (414), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 88/235 (37%), Positives = 134/235 (57%), Gaps = 2/235 (0%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F  + S+    A+  G+SP       A + +    ++ DR+   +   SF++Y     S+
Sbjct: 32  FNSFISSFSREAIAAGISPNVVSQALAGVTHDPAVLSFDRRQRGTFKKSFEEYAATRVSA 91

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGE-TMGKTPLLSTLATLAY 160
           + I  G  + + N+ LL  ++K +GVPP I++A+WGLET +G+  MGK  ++ TLATLA+
Sbjct: 92  QRIKSGRLMLQKNASLLSRIEKRFGVPPEIIVAIWGLETDYGKGDMGKRSVIRTLATLAH 151

Query: 161 DCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKI 219
           DCRR + F  +   AL +V++G +     +GA  GEIGQ QFLP + +KY +D D +G +
Sbjct: 152 DCRRTELFQGELLAALKIVQRGDLRLDDMVGAFAGEIGQTQFLPSSYIKYGVDFDGNGHV 211

Query: 220 DLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIA 274
           DL  S  D +AS A  L   G+   A Y  G  NF  ++ WN ++ Y KTIAY A
Sbjct: 212 DLRHSVPDVLASTANLLHVSGFKNGADYHEGSANFEAMREWNRAVIYRKTIAYFA 266


>gi|254474002|ref|ZP_05087395.1| lytic murein transglycosylase [Pseudovibrio sp. JE062]
 gi|211956891|gb|EEA92098.1| lytic murein transglycosylase [Pseudovibrio sp. JE062]
          Length = 288

 Score =  163 bits (412), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 89/244 (36%), Positives = 135/244 (55%), Gaps = 2/244 (0%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDY 94
           C DT   F  W ++ +     +G+S  T     + + Y    I  DR    S  +SF+++
Sbjct: 44  CGDTGAGFDRWLASYKNTLQSQGISKATINKSLSGITYNRKVIGYDRNQ-KSFKLSFEEF 102

Query: 95  LDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLST 154
                ++ +I +G  L K ++ L   ++ E+GVP  I+ A+WGLET +G  +GK   +  
Sbjct: 103 YKLRVNNALINKGRKLMKKHNALFTRIENEFGVPREIITAIWGLETGYGRGIGKMNTIRA 162

Query: 155 LATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDA 213
           LATLAYDCRRA FF  + ++AL +V+KG +  S   GA  GE+GQ QFL  + +K+AID 
Sbjct: 163 LATLAYDCRRADFFRNELYHALLIVQKGDLQPSEMKGAWAGELGQTQFLASSYIKFAIDY 222

Query: 214 DEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYI 273
             DGK DL+ +  D +AS A FL   GW     + PG  N+ +++ WN +  Y KTI  +
Sbjct: 223 SGDGKRDLLYNTADTLASTAHFLMSYGWQPGQPWGPGTPNYEVIRSWNRAGVYVKTIQIM 282

Query: 274 AAHI 277
           A  +
Sbjct: 283 AEKL 286


>gi|254453385|ref|ZP_05066822.1| lytic murein transglycosylase [Octadecabacter antarcticus 238]
 gi|198267791|gb|EDY92061.1| lytic murein transglycosylase [Octadecabacter antarcticus 238]
          Length = 267

 Score =  162 bits (411), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 95/258 (36%), Positives = 139/258 (53%), Gaps = 5/258 (1%)

Query: 22  AVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDR 81
           AV+          C + A  F  WK A    A   G+  ++     A+ +Y  +TI  DR
Sbjct: 12  AVSLAVAPALAAPCGNDASGFSAWKLAFAQEAAAAGVG-QSGLSALANAQYSHSTIRADR 70

Query: 82  KMVTSPPVSFKDYLD-GLSSSEIIAQGIALKKA-NSRLLINLKKEYGVPPGILMALWGLE 139
              T       D++   L S +  A  +  ++  N     +L++ YGVP GIL+A+ G+E
Sbjct: 71  NQ-TGVRYELNDFIRIRLGSLDSFASQMRREQNKNPTFYASLEQAYGVPAGILLAIHGME 129

Query: 140 THFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQF 199
           T FG TMG TP++ +++T+AYDCRR+ FFT     AL LV +G +     GA  GE+G  
Sbjct: 130 TGFGRTMGSTPVVDSISTVAYDCRRSAFFTPHAIAALMLVDQGGLDPTQQGAAHGEMGHT 189

Query: 200 QFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKH 259
           QFLP N ++Y +DAD +G++DL  S  D++AS A FL + GW     +Q G  NF +L  
Sbjct: 190 QFLPGNALRYGVDADGNGRVDLY-SITDSLASTANFLRQKGWQPGQSFQEGSANFRVLND 248

Query: 260 WNASLNYNKTIAYIAAHI 277
           WNA+  Y + IA  AA +
Sbjct: 249 WNAATVYQQAIALSAARL 266


>gi|16263566|ref|NP_436359.1| Transglycosylase [Sinorhizobium meliloti 1021]
 gi|14524270|gb|AAK65771.1| Transglycosylase [Sinorhizobium meliloti 1021]
          Length = 265

 Score =  162 bits (411), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 93/245 (37%), Positives = 130/245 (53%), Gaps = 10/245 (4%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDY 94
           C  +A  F +WK      A   G+  K    L    +Y   TI  DR +  +   S  D+
Sbjct: 30  CGKSAAGFQQWKVEFAETAKAAGVRGKGLAALLG-AKYAVGTIRADRSVNKAFSGSVDDF 88

Query: 95  LDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLST 154
           +     S II++G +LK AN+ L  N++++Y VP G+L+A+WG+ET FG +MG    +S 
Sbjct: 89  MRRRGGSAIISKGRSLKTANAALFGNIERKYDVPAGVLLAIWGMETGFGASMGNQNTVSA 148

Query: 155 LATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDAD 214
           + TLAYDCRR +FF      AL LV  GV+S+ ++GA  GEIGQ  FLP NV+KY + + 
Sbjct: 149 IVTLAYDCRRPQFFAPHAIAALKLVDSGVLSARSVGAMHGEIGQTGFLPGNVLKYGVGSR 208

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIA 274
                  ++    A+ S A FL   GW    GYQ    N   +  WN++  Y K IA I 
Sbjct: 209 N------MRDTSTALMSTANFLKAHGWRAGGGYQG---NMGAIAGWNSASVYQKAIARIG 259

Query: 275 AHIDG 279
             IDG
Sbjct: 260 EAIDG 264


>gi|114705817|ref|ZP_01438720.1| putative membrane-bound lytic murein transglycosylase signal
           peptide protein [Fulvimarina pelagi HTCC2506]
 gi|114538663|gb|EAU41784.1| putative membrane-bound lytic murein transglycosylase signal
           peptide protein [Fulvimarina pelagi HTCC2506]
          Length = 274

 Score =  162 bits (411), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 88/247 (35%), Positives = 135/247 (54%), Gaps = 7/247 (2%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDR---KMVTSPPVSF 91
           C +    F +WK      A + G+  +  + L A   Y   TI  DR   +  ++  +S 
Sbjct: 29  CGNGPGGFEQWKQQFAGVAQQNGVGSRGLQAL-ASARYNQKTIQIDRAAQRGGSAFTMSL 87

Query: 92  KDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPL 151
             +L     + I+A G      N  +  ++++ YGVPPG ++A+WG+ET FG  MG   +
Sbjct: 88  DTFLKKRGGASIVATGKRKLAQNRGMFQDIERRYGVPPGPILAIWGMETGFGGFMGGENV 147

Query: 152 LSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAI 211
           +S+ AT+AYDCRR  FF      AL LV +G +S ++ GA  GE G  QFL  N+++Y +
Sbjct: 148 VSSAATIAYDCRRTDFFKPHLIAALQLVDRGGLSPNSRGAGHGEYGHTQFLAANILRYGV 207

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIA 271
           DAD +G++DL  S  DA+ S A FL   G T+   YQ G+  +  ++ WNA+  Y + IA
Sbjct: 208 DADGNGRVDLASSR-DALYSTANFLRSHGMTQN--YQQGQAGYRGIQGWNAAPVYQQAIA 264

Query: 272 YIAAHID 278
           Y+ + ID
Sbjct: 265 YLGSQID 271


>gi|299131994|ref|ZP_07025189.1| lytic murein transglycosylase [Afipia sp. 1NLS2]
 gi|298592131|gb|EFI52331.1| lytic murein transglycosylase [Afipia sp. 1NLS2]
          Length = 280

 Score =  162 bits (411), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 89/235 (37%), Positives = 132/235 (56%), Gaps = 2/235 (0%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F  + S     AV  G+SP      FA +      +  DR+   +   +F+ Y+     +
Sbjct: 40  FNAFVSTFSREAVAAGISPSVVSQSFAGVTEDPEVLRFDRRQRYTFNKTFEQYVSTRVGA 99

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGE-TMGKTPLLSTLATLAY 160
           + I  G  + + N+ LL  +++ +GVPP I++A+WGLE+ FG+  MGK P++ TLATLA+
Sbjct: 100 QRIKSGRFMMQKNASLLSRIEQRFGVPPQIIVAIWGLESDFGKGDMGKRPVIKTLATLAH 159

Query: 161 DCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKI 219
           DCRR + F  +   AL +V++G +    L GA  GEIGQ QFLP + +KY +D D +G +
Sbjct: 160 DCRRTELFQGELLAALKIVQRGDLRLDDLVGAFAGEIGQTQFLPSSYIKYGVDFDGNGHV 219

Query: 220 DLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIA 274
           DL  S  D +AS A  L   G+   A Y  G  NF  ++ WN ++ Y KTIAY A
Sbjct: 220 DLRHSVPDVLASTANLLHTSGFKAGADYHEGSANFDAMREWNRAVIYRKTIAYFA 274


>gi|298292269|ref|YP_003694208.1| lytic murein transglycosylase [Starkeya novella DSM 506]
 gi|296928780|gb|ADH89589.1| lytic murein transglycosylase [Starkeya novella DSM 506]
          Length = 272

 Score =  162 bits (409), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 91/244 (37%), Positives = 139/244 (56%), Gaps = 5/244 (2%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDY 94
           C DT   F  W    R  A  +G+SP   + L   L Y    I+ DR        SF+ +
Sbjct: 31  CGDTGAGFDAWLRDFRQAAAAQGISPGAVRAL-DGLSYDTRVISLDRNQ-KHFKQSFEQF 88

Query: 95  LDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLST 154
           +     +  I++G A+ + ++ LL  +++ +GVP  IL+A+WG+ET FG   GK P+  +
Sbjct: 89  VANRVGAGRISKGKAMLRQHAGLLARIEQRFGVPGPILVAIWGMETDFGVNQGKMPVFRS 148

Query: 155 LATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDA 213
           LATLAYDCRR+ FFT Q   AL +V++G +S     GA  GE+GQ QF+P + V++A+D 
Sbjct: 149 LATLAYDCRRSGFFTGQLLDALRIVQRGDLSIGEMRGAWAGELGQTQFMPTSYVRFAVDF 208

Query: 214 DEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYI 273
           D +G  DL++S  D +AS A +L   GW+  + ++ G  N   L+ WN +  Y ++IAY 
Sbjct: 209 DGNGHADLIRSVPDVLASTANYLRGYGWSGPS-WENG-ANMGALRGWNKAEVYARSIAYF 266

Query: 274 AAHI 277
           A  +
Sbjct: 267 ATRL 270


>gi|307313744|ref|ZP_07593362.1| transglycosylase [Sinorhizobium meliloti BL225C]
 gi|306899234|gb|EFN29871.1| transglycosylase [Sinorhizobium meliloti BL225C]
          Length = 265

 Score =  161 bits (408), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 92/245 (37%), Positives = 130/245 (53%), Gaps = 10/245 (4%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDY 94
           C  +A  F +WK      A   G+  K    L    +Y   TI  DR +  +   S  D+
Sbjct: 30  CGKSAAGFQQWKVEFAETAKAAGVRGKGLAALLG-AKYAVGTIRADRSVNKAFSGSVDDF 88

Query: 95  LDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLST 154
           +     S II++G +LK AN+ L  N++++Y VP G+L+A+WG+ET FG +MG    +S 
Sbjct: 89  MRRRGGSAIISKGRSLKTANAALFGNIERKYDVPAGVLLAIWGMETGFGASMGNQNTVSA 148

Query: 155 LATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDAD 214
           + TLAYDCRR +FF      AL LV  GV+S+ ++GA  GEIGQ  FLP NV+KY + + 
Sbjct: 149 IVTLAYDCRRPQFFAPHAIAALKLVDSGVLSARSVGAMHGEIGQTGFLPGNVLKYGVGSR 208

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIA 274
                  ++    A+ S A FL   GW    GYQ    N   +  WN++  Y + IA I 
Sbjct: 209 N------MRDTSTALMSTANFLKAHGWRAGGGYQG---NMGAIAGWNSASVYQQAIARIG 259

Query: 275 AHIDG 279
             IDG
Sbjct: 260 EAIDG 264


>gi|148257979|ref|YP_001242564.1| hypothetical protein BBta_6768 [Bradyrhizobium sp. BTAi1]
 gi|146410152|gb|ABQ38658.1| hypothetical protein BBta_6768 [Bradyrhizobium sp. BTAi1]
          Length = 272

 Score =  161 bits (407), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 91/240 (37%), Positives = 135/240 (56%), Gaps = 2/240 (0%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F  + ++  A A   G+S  T     + +      +A DR+   +   SF+ Y+      
Sbjct: 32  FNTFVASFSAEAQSAGVSSATISQALSGVTLDPAVLAFDRRQRYTFNKSFEQYVATRVGP 91

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGE-TMGKTPLLSTLATLAY 160
             I  G A+ + ++ LL  ++++YGVP  IL+A+WGLET FG+  MGK P++ TLATLA+
Sbjct: 92  GRINGGRAMLQRHAALLSRIEQQYGVPRQILIAIWGLETDFGKGDMGKLPVIRTLATLAH 151

Query: 161 DCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKI 219
           DCRR + F  +   AL +V++G ++   L GA  GEIGQ QFLP + +KY +D D DG++
Sbjct: 152 DCRRTELFQTELMAALKIVERGDLTLRDLIGAFAGEIGQTQFLPSSYIKYGVDFDGDGRV 211

Query: 220 DLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHIDG 279
           DL  S  D +AS A  L   G+   A Y  G  NF  ++ WN ++ Y KTI Y A  + G
Sbjct: 212 DLRHSTADVLASTANLLHSNGFKMGAPYDEGSANFDAMREWNRAVIYRKTIGYFADQLVG 271


>gi|27379835|ref|NP_771364.1| hypothetical protein blr4724 [Bradyrhizobium japonicum USDA 110]
 gi|27352988|dbj|BAC49989.1| blr4724 [Bradyrhizobium japonicum USDA 110]
          Length = 274

 Score =  160 bits (406), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 90/243 (37%), Positives = 140/243 (57%), Gaps = 7/243 (2%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDR--KMVTSPPVSFKDYLDGLS 99
           F  W +  +  A  +G+S +      A +    + + RDR  K+ T    +F+++  G  
Sbjct: 36  FDAWLADFKTDAAAKGISQQAIAAGLAGVTLDQSVLNRDRSQKVFTQ---TFEEF-SGRM 91

Query: 100 SSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLA 159
               + +G  + K    +L  +++ YGVP  +L+A+WGLET FG   GK   + +LATLA
Sbjct: 92  VPPRMTRGSNMMKQYGSVLSRIEQTYGVPGEVLVAIWGLETDFGVNTGKFATIRSLATLA 151

Query: 160 YDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGK 218
           YDCRRA+ F  +   AL +V++G ++   + GA  GE+GQ QF+P + +KYA+D D +GK
Sbjct: 152 YDCRRAEQFRGELMDALRIVQRGDLAPADMKGAWAGELGQTQFMPSSWMKYAVDFDGNGK 211

Query: 219 IDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHID 278
            DL+ +  D +AS A +LA  GW +   +QPG  NFA+L+ WN S  Y+KT+AY A  + 
Sbjct: 212 RDLLHNAPDVLASTANYLAGYGWQRGKDWQPGSPNFAVLQQWNKSEVYSKTVAYFATQLA 271

Query: 279 GVP 281
             P
Sbjct: 272 RAP 274


>gi|260467300|ref|ZP_05813474.1| transglycolase [Mesorhizobium opportunistum WSM2075]
 gi|259028904|gb|EEW30206.1| transglycolase [Mesorhizobium opportunistum WSM2075]
          Length = 265

 Score =  160 bits (404), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 91/244 (37%), Positives = 130/244 (53%), Gaps = 10/244 (4%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDY 94
           C  T   F  WK    A A  EG+  +    L A   Y   TI+ DR +  +   S + +
Sbjct: 30  CGKTGAGFEAWKQDFAADAKAEGVGSRGLAAL-AGATYATRTISADRAIHKAFSGSVEAF 88

Query: 95  LDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLST 154
           +     S II++G ALKK+N+ L   +++ YGV PG+L+A+WG+ET FG +MG    +S 
Sbjct: 89  MKRRGGSAIISKGRALKKSNAALFNQIERNYGVSPGVLLAIWGMETGFGASMGNQNTVSA 148

Query: 155 LATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDAD 214
           + TLAYDCRR  +F      AL LV +G +S+ ++GA  GE+G  QFLP NV+KYA+ + 
Sbjct: 149 ILTLAYDCRRPDYFHPHAIAALKLVDRGALSASSVGAMHGEVGHTQFLPGNVLKYAVGSG 208

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIA 274
                  ++    A+AS A FL   GW   A       N   +  WN++  Y + IA IA
Sbjct: 209 N------LRDKATALASTANFLKGHGWRAGA---SANANMGAIAGWNSASVYQQAIAQIA 259

Query: 275 AHID 278
             ID
Sbjct: 260 TAID 263


>gi|146340952|ref|YP_001206000.1| putative transglycolase [Bradyrhizobium sp. ORS278]
 gi|146193758|emb|CAL77775.1| conserved hypothetical protein; putative signal peptide; putative
           transglycolase [Bradyrhizobium sp. ORS278]
          Length = 271

 Score =  159 bits (403), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 94/263 (35%), Positives = 145/263 (55%), Gaps = 11/263 (4%)

Query: 22  AVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARD- 80
           A++ P  AT    C   +  F  W +  +  A  +G+S  T       L    + + RD 
Sbjct: 17  ALSSP--ATAAVPCG--SGNFDSWLAEFKTEAAAKGISQPTINAALNGLTSDPSVLNRDH 72

Query: 81  -RKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLE 139
            +K+ +    +F+++  G      + +G  + K    +L  +++ YGVP  +L+A+WGLE
Sbjct: 73  SQKVFSQ---TFEEF-SGRMVPPRLTRGSNMLKQYGSVLSRIEQAYGVPGEVLVAIWGLE 128

Query: 140 THFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQ 198
           T FG  +GK P + +LATLAYDCRRA+ F  +   AL +V +G +    + GA  GEIGQ
Sbjct: 129 TDFGVNVGKFPTIRSLATLAYDCRRAEQFRGELLDALRIVDRGDLQPAEMRGAWAGEIGQ 188

Query: 199 FQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILK 258
            QF+P + +KYA+D D +GK DL++S  D +AS A +L   GW K   ++PG  NFA+++
Sbjct: 189 TQFMPSSWIKYAVDFDGNGKRDLIRSAPDVLASTANYLKGYGWQKGKDWEPGSPNFAVIQ 248

Query: 259 HWNASLNYNKTIAYIAAHIDGVP 281
            WN S  Y +TIA  A  +   P
Sbjct: 249 QWNKSEVYARTIATFATQLAHAP 271


>gi|146338449|ref|YP_001203497.1| putative transglycolase [Bradyrhizobium sp. ORS278]
 gi|146191255|emb|CAL75260.1| conserved hypothetical protein; putative transglycolase
           [Bradyrhizobium sp. ORS278]
          Length = 271

 Score =  159 bits (402), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 89/240 (37%), Positives = 133/240 (55%), Gaps = 2/240 (0%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F  + +   A A   G+S  T     + +      +A DR+   +   SF+ Y+     +
Sbjct: 31  FNTFIANVSAEAQSAGVSAGTVSQALSGVTLDPAVLAFDRRQRYTFNKSFEQYVSTRVGA 90

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGE-TMGKTPLLSTLATLAY 160
             +  G A+ + ++ LL  ++++YGVP  IL+A+WGLET FG+  MGK P++ TLATLA+
Sbjct: 91  GRVNGGRAMLQRHAALLSKIEQQYGVPRQILVAIWGLETDFGKGDMGKLPVIRTLATLAH 150

Query: 161 DCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKI 219
           DCRR + F  +   AL +V++G +    L GA  GEIGQ QFLP + +KY +D D DG++
Sbjct: 151 DCRRTELFQTELLAALKIVERGDLGLRDLIGAFAGEIGQTQFLPSSYIKYGVDFDGDGRV 210

Query: 220 DLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHIDG 279
           DL  S  D +AS A  L   G+     Y  G  NF  ++ WN ++ Y KTI Y A  + G
Sbjct: 211 DLRHSTADVLASTANLLHSNGFKMGQPYDEGSANFDAMREWNRAVIYRKTIGYYADQLMG 270


>gi|148255756|ref|YP_001240341.1| putative transglycolase [Bradyrhizobium sp. BTAi1]
 gi|146407929|gb|ABQ36435.1| putative exported protein of unknown function with transglycolase
           [Bradyrhizobium sp. BTAi1]
          Length = 271

 Score =  159 bits (402), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 93/276 (33%), Positives = 146/276 (52%), Gaps = 7/276 (2%)

Query: 8   LISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLF 67
           +I  ++    + A  +T    A +   C      F  W +  +  A  +G+S        
Sbjct: 1   MIRRVLSAAALCAAVMTNCASAQSAVPCG--TGNFDAWLAEFKTEAAAKGISQNAINAAL 58

Query: 68  ADLEYLDTTIARDR-KMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYG 126
             +    + + RDR + V S   +F+++  G      + +G  + K    +L  +++ YG
Sbjct: 59  TGVTPDQSVLNRDRGQKVFSQ--TFEEF-SGRMVPPRLTRGSNMMKQYGSVLSRIEQTYG 115

Query: 127 VPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISS 186
           VP  +L+A+WGLET FG  +GK P +  LATLAYDCRRA+ F  +   AL +V +G +  
Sbjct: 116 VPGEVLVAIWGLETDFGVNVGKFPTIRALATLAYDCRRAEQFRGELLDALRIVDRGDLQP 175

Query: 187 HAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCA 245
             + GA  GEIGQ QF+P + +KYA+D D +G+ DL++S  D +AS A +L   GW K  
Sbjct: 176 AEMRGAWAGEIGQTQFMPSSWIKYAVDFDGNGRRDLIRSAPDVLASTANYLKGYGWQKGK 235

Query: 246 GYQPGEKNFAILKHWNASLNYNKTIAYIAAHIDGVP 281
            ++PG  NFA+++ WN S  Y +TIA  A  +   P
Sbjct: 236 DWEPGSPNFAVIQQWNKSDVYARTIATFATQLARAP 271


>gi|39934378|ref|NP_946654.1| lytic murein transglycosylase [Rhodopseudomonas palustris CGA009]
 gi|192289901|ref|YP_001990506.1| lytic murein transglycosylase [Rhodopseudomonas palustris TIE-1]
 gi|39648227|emb|CAE26746.1| putative transglycolase [Rhodopseudomonas palustris CGA009]
 gi|192283650|gb|ACF00031.1| lytic murein transglycosylase [Rhodopseudomonas palustris TIE-1]
          Length = 272

 Score =  159 bits (401), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 85/235 (36%), Positives = 131/235 (55%), Gaps = 2/235 (0%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F  + ++  A A + G+S          +      +A DR+   +   SF+ Y+     +
Sbjct: 32  FNSFIASFSADAAQAGISQGVISQALGGVTEDPGVLAFDRRQRGTFNKSFEQYVSTRVGA 91

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGE-TMGKTPLLSTLATLAY 160
             I  G A+   ++ LL  +++++GVPP I++A+WGLET +G+  MGK P+   LATLA+
Sbjct: 92  GRIKAGRAMLMRHASLLSRIERQFGVPPQIVVAIWGLETDYGKGDMGKLPVFRVLATLAH 151

Query: 161 DCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKI 219
           DCRR + F  +   AL ++++G ++    +GA  GEIGQ QFLP + +KY +D D +G +
Sbjct: 152 DCRRTELFQGELLAALQILQRGDLTLRDMVGAYAGEIGQTQFLPSSYIKYGVDYDGNGHV 211

Query: 220 DLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIA 274
           DL  S  D +AS A  L   GW     Y+ G  NF  ++ WN +L Y KTIAY A
Sbjct: 212 DLRHSVPDVLASTANLLKSAGWKAGGSYEEGSANFEAMREWNRALVYRKTIAYFA 266


>gi|75676622|ref|YP_319043.1| lytic murein transglycosylase [Nitrobacter winogradskyi Nb-255]
 gi|74421492|gb|ABA05691.1| lytic murein transglycosylase [Nitrobacter winogradskyi Nb-255]
          Length = 272

 Score =  159 bits (401), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 90/248 (36%), Positives = 131/248 (52%), Gaps = 7/248 (2%)

Query: 35  CSDTADRF-GEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKD 93
           C    D F  E    A A  V +G+  +    +  D       ++ DR+   +   SF+ 
Sbjct: 28  CGGDFDTFVAEMSREAAANGVSQGVISQALGGVHQD----QAVLSFDRRQRGTFRKSFEQ 83

Query: 94  YLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGE-TMGKTPLL 152
           Y+    +   I  G A+   +  LL  ++K++GVPP I++A+WGLET FG   MGK P+ 
Sbjct: 84  YVATRVTGGRIKGGKAMLTRHGSLLSRIEKQFGVPPEIIVAIWGLETDFGRGDMGKLPVF 143

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAI 211
             LAT+A+DCRR + F  +   AL +V++G +  S  +GA  GEIGQ QFLP + +KY +
Sbjct: 144 RVLATMAHDCRRTELFQRELLAALRIVQRGDLRLSDMVGAYAGEIGQTQFLPSSYIKYGV 203

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIA 271
           D D +G +DL  S  D +AS A  L   GW     Y  G  NF +++ WN S  Y +TI 
Sbjct: 204 DFDGNGHVDLRHSVPDVLASTANLLKVNGWKAGGDYHQGSPNFEVMREWNRSEIYRRTIG 263

Query: 272 YIAAHIDG 279
           Y A  + G
Sbjct: 264 YFADKLAG 271


>gi|86751226|ref|YP_487722.1| lytic murein transglycosylase [Rhodopseudomonas palustris HaA2]
 gi|86574254|gb|ABD08811.1| Lytic murein transglycosylase [Rhodopseudomonas palustris HaA2]
          Length = 272

 Score =  158 bits (400), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 84/240 (35%), Positives = 134/240 (55%), Gaps = 2/240 (0%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F  + ++  A A + G+S          +      +A DR+   +   +F+ Y+     +
Sbjct: 32  FNAFIASMSAEAAQAGVSRDVISEALGGVTPDPAVLAFDRRQRGTFNKTFEQYVATRVGA 91

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGE-TMGKTPLLSTLATLAY 160
             I  G A+ + ++ LL  +++++GVPP IL+A+WGLE+ FG+  +GK P+   LAT+A+
Sbjct: 92  GRIKSGRAMLQRHASLLSRIERQFGVPPQILVAIWGLESDFGKGDIGKLPVFRVLATMAH 151

Query: 161 DCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKI 219
           DCRR + F  +   AL +V++G ++   + GA  GE+GQ QFLP + +KY +D D +G +
Sbjct: 152 DCRRTELFQGELLAALKIVQRGDLTMRDMVGAYAGELGQTQFLPSSYIKYGVDFDGNGHV 211

Query: 220 DLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHIDG 279
           DL  S  D +AS A  L   GW     Y+ G  NF  ++ WN +L Y KTIAY A  + G
Sbjct: 212 DLRHSVPDVLASTANLLKTAGWRAGGSYEEGTPNFEAMREWNRALVYRKTIAYFADQLIG 271


>gi|316935455|ref|YP_004110437.1| lytic murein transglycosylase [Rhodopseudomonas palustris DX-1]
 gi|315603169|gb|ADU45704.1| lytic murein transglycosylase [Rhodopseudomonas palustris DX-1]
          Length = 272

 Score =  157 bits (398), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 84/238 (35%), Positives = 131/238 (55%), Gaps = 2/238 (0%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F  + S+  A A + G+S          +      +A DR+   +   +F+ Y+      
Sbjct: 32  FNTFVSSISAEAAQAGVSQSVISQALGGVTPDPAVLAFDRRQRGTFNKTFEQYVATRVGP 91

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGE-TMGKTPLLSTLATLAY 160
             I  G A+   ++ LL  +++++GVPP I++A+WGLE+ FG+  MGK P+   LAT+A+
Sbjct: 92  GRIKTGRAMLMRHASLLSRVERQFGVPPQIVVAIWGLESDFGKGDMGKLPVFRVLATMAH 151

Query: 161 DCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKI 219
           DCRR + F  +   AL +V++G ++    +GA  GE+GQ QFLP + +KY +D D +G +
Sbjct: 152 DCRRTELFQGELLAALQIVQRGDLTLRDMVGAYAGELGQTQFLPSSYIKYGVDFDGNGHV 211

Query: 220 DLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHI 277
           DL  S  D +AS A  L   GW     Y+ G  NF  ++ WN +L Y KTIAY A  +
Sbjct: 212 DLRHSVPDVLASTANLLKTAGWKAGGSYEEGTANFEAMREWNRALVYRKTIAYFADRL 269


>gi|91978426|ref|YP_571085.1| lytic murein transglycosylase [Rhodopseudomonas palustris BisB5]
 gi|91684882|gb|ABE41184.1| Lytic murein transglycosylase [Rhodopseudomonas palustris BisB5]
          Length = 272

 Score =  157 bits (396), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 84/240 (35%), Positives = 131/240 (54%), Gaps = 2/240 (0%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F  + SA  A A + G+S          +      +A DR+   +   +F+ Y+      
Sbjct: 32  FNTFMSAFSAEAAQAGVSQGVISQALGGVTPDPAVLAFDRRQRGTFNKTFEQYVATRVGP 91

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGE-TMGKTPLLSTLATLAY 160
             I  G A+ + ++ LL  +++++GVPP I++A+WGLE+ FG+  +GK P+   LAT+A+
Sbjct: 92  GRIKTGRAMLQRHASLLSRIERQFGVPPQIVVAIWGLESDFGKGDIGKLPVFRVLATMAH 151

Query: 161 DCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKI 219
           DCRR + F  +   AL +V++G +     +GA  GE+GQ QFLP + +KY +D D +G +
Sbjct: 152 DCRRTELFQGELLAALKIVQRGDLELRDMVGAYAGELGQTQFLPSSYIKYGVDFDGNGHV 211

Query: 220 DLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHIDG 279
           DL  S  D +AS A  L   GW     Y+ G  NF  ++ WN +L Y KTI Y A  + G
Sbjct: 212 DLRHSVPDVLASTANLLKTAGWRAGGSYEEGTPNFEAMREWNRALVYRKTIGYFADQLVG 271


>gi|92118361|ref|YP_578090.1| lytic murein transglycosylase [Nitrobacter hamburgensis X14]
 gi|91801255|gb|ABE63630.1| Lytic murein transglycosylase [Nitrobacter hamburgensis X14]
          Length = 272

 Score =  156 bits (395), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 86/240 (35%), Positives = 127/240 (52%), Gaps = 2/240 (0%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F  + SA    A  +G+S          ++     +  DR+   +   SF+ Y      +
Sbjct: 32  FNGFLSAMSREAAADGISQGVISQALGGVQQDQAVLNFDRRQRGTFRKSFEQYAATRVGA 91

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGE-TMGKTPLLSTLATLAY 160
             I  G A+   ++ LL  ++K++GVPP IL+A+WGLE+ FG   MGK P+   LAT+A+
Sbjct: 92  GRIKGGKAMLMRHASLLSRIEKQFGVPPEILVAIWGLESDFGRGDMGKLPVFRVLATMAH 151

Query: 161 DCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKI 219
           DCRR + F  +   AL +V++G +  +  +GA  GEIGQ QFLP + +KY +D D +G +
Sbjct: 152 DCRRTELFQRELLAALKIVQRGDLRLNDMVGAYAGEIGQTQFLPSSYIKYGVDYDGNGHV 211

Query: 220 DLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHIDG 279
           DL  S  D +AS A  L   GW     Y  G  NF  ++ WN S  Y +TI Y A  + G
Sbjct: 212 DLRHSVPDVLASTANLLRANGWKAGGDYHQGSANFEAMREWNRSEVYRRTIGYFADKLAG 271


>gi|319780686|ref|YP_004140162.1| transglycosylase [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317166574|gb|ADV10112.1| transglycosylase [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 265

 Score =  155 bits (392), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 92/245 (37%), Positives = 128/245 (52%), Gaps = 10/245 (4%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDY 94
           C  T   F  WK    A+A  EG+  K    L A   Y   TI+ DR +  +   S  D+
Sbjct: 30  CGKTGAGFEAWKQDFAAQARSEGVGAKGLAAL-AGANYATKTISVDRGIHKAFSGSVDDF 88

Query: 95  LDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLST 154
           +     + II++G +LKK+N+ L   ++  YGV PG+L+A+WG+ET FG  MG    +S 
Sbjct: 89  MRRRGGAAIISKGRSLKKSNAALFSKIEANYGVSPGVLLAIWGMETGFGSAMGNQNTVSA 148

Query: 155 LATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDAD 214
           + TLAYDCRR  FF      AL LV +G +++ ++GA  GEIG  QFLP NV+KY +   
Sbjct: 149 ILTLAYDCRRPGFFYPHAIAALKLVDRGALTASSVGAAHGEIGHTQFLPGNVLKYGVGGG 208

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIA 274
                  ++    A+AS A FL   GW   A       N   +  WN++  Y + IA IA
Sbjct: 209 N------LRDKGTALASTANFLKGHGWRAGA---SASANMGAIAGWNSASVYQQAIARIA 259

Query: 275 AHIDG 279
             IDG
Sbjct: 260 TAIDG 264


>gi|89069903|ref|ZP_01157237.1| hypothetical protein OG2516_06362 [Oceanicola granulosus HTCC2516]
 gi|89044579|gb|EAR50698.1| hypothetical protein OG2516_06362 [Oceanicola granulosus HTCC2516]
          Length = 265

 Score =  155 bits (391), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 87/252 (34%), Positives = 133/252 (52%), Gaps = 15/252 (5%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDY 94
           C + A  F  WK      A  +G+  +   +  A+  Y  +TI  DR        S  ++
Sbjct: 22  CGNDASGFERWKQEFAQEAAAQGIG-QAGLNALANARYSQSTINADRNQ-RGVRYSLDEF 79

Query: 95  -------LDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMG 147
                  LD  +S+   A     + +N     +L++ YGVP  IL+A+  +ET  G  MG
Sbjct: 80  IRIRLGSLDSFASTLRNA-----RNSNPGFYQSLEQAYGVPASILLAIHYMETGGGRFMG 134

Query: 148 KTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVV 207
            TP++ ++ T+AYDCRR+ FFT     AL +V +G+++ +  GA  GE+G  QFLP N +
Sbjct: 135 DTPVVDSITTVAYDCRRSDFFTPHALAALQMVDRGMLAPNQRGAAHGELGHTQFLPGNAL 194

Query: 208 KYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYN 267
           +Y +D D +G++DL     DA+AS A +L + GW     Y  G +NF +L  WNA+  Y 
Sbjct: 195 RYGVDGDGNGRVDLYGV-ADALASTANYLRQKGWQPGQPYSEGTQNFRVLNEWNAATVYQ 253

Query: 268 KTIAYIAAHIDG 279
           + IA  AA +DG
Sbjct: 254 QAIALAAARLDG 265


>gi|85715945|ref|ZP_01046922.1| lytic murein transglycosylase [Nitrobacter sp. Nb-311A]
 gi|85697143|gb|EAQ35024.1| lytic murein transglycosylase [Nitrobacter sp. Nb-311A]
          Length = 272

 Score =  154 bits (389), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 87/252 (34%), Positives = 127/252 (50%), Gaps = 2/252 (0%)

Query: 30  TTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPV 89
           +T    +     F  + SA    A  +G+S          ++     +  DR+   +   
Sbjct: 20  STDVSAAQCGGDFNGFVSAMSREAAADGISQNVISQALGGVQRDQAVLNFDRRQRGTFRK 79

Query: 90  SFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGE-TMGK 148
           SF+ Y     +   I  G A+   +  LL  ++K++GVPP I++A+WGLET FG   MGK
Sbjct: 80  SFEQYAATRVTGGRIKGGKAMLARHGSLLSRIEKQFGVPPEIVVAIWGLETDFGRGDMGK 139

Query: 149 TPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVV 207
            P+   LAT+A+DCRR + F  +   AL +V++G +     +GA  GEIGQ QFLP + +
Sbjct: 140 LPVFRVLATMAHDCRRTELFQRELLAALKIVQRGDLRLGDMIGAYAGEIGQTQFLPSSYI 199

Query: 208 KYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYN 267
           KY ID D +G +DL  S  D +AS A  L   GW     Y  G  NF  ++ WN S  Y 
Sbjct: 200 KYGIDFDGNGHVDLRHSVPDVLASTANLLRVNGWKAGGDYHQGSANFEAMREWNRSEVYR 259

Query: 268 KTIAYIAAHIDG 279
           +TI   A  + G
Sbjct: 260 RTIGLFADKLAG 271


>gi|13473689|ref|NP_105257.1| transglycolase [Mesorhizobium loti MAFF303099]
 gi|14024440|dbj|BAB51043.1| probable transglycolase [Mesorhizobium loti MAFF303099]
          Length = 285

 Score =  154 bits (388), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 89/245 (36%), Positives = 127/245 (51%), Gaps = 10/245 (4%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDY 94
           C  T   F  WK     +A  EG+  K      A   Y   TI+ DR +  +   S   +
Sbjct: 50  CGSTGAGFDAWKPGFAEQAKAEGVGAKGLA-ALAGATYATKTISVDRGIHKAFSGSVDAF 108

Query: 95  LDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLST 154
           +     + II++G +LKKAN+ +   ++  YGV PG+L+A+WG+ET FG +MG    +S 
Sbjct: 109 MKRRGGAAIISKGRSLKKANAAMFSQIESNYGVSPGVLLAIWGMETGFGSSMGNQNTVSA 168

Query: 155 LATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDAD 214
           + TLAYDCRR +FF      AL LV +G +S+ ++GA  GEIG  QFLP NV+KY + + 
Sbjct: 169 ILTLAYDCRRPEFFHPHAIAALKLVDRGALSASSVGAAHGEIGHTQFLPGNVLKYGVGSG 228

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIA 274
                  ++    A+AS A FL   GW + A       N   +  WN +  Y + I  IA
Sbjct: 229 N------LRDKATALASTANFLKAHGWRRGA---SAADNIGAIAGWNDASVYQQAIVRIA 279

Query: 275 AHIDG 279
             IDG
Sbjct: 280 TAIDG 284


>gi|90422503|ref|YP_530873.1| lytic murein transglycosylase [Rhodopseudomonas palustris BisB18]
 gi|90104517|gb|ABD86554.1| Lytic murein transglycosylase [Rhodopseudomonas palustris BisB18]
          Length = 269

 Score =  154 bits (388), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 81/224 (36%), Positives = 121/224 (54%), Gaps = 2/224 (0%)

Query: 53  AVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKK 112
           A  +G+S          +      ++ DR+   +   SF+ Y+        I  G A+  
Sbjct: 39  AAAQGISQGVIAQALGGVTQDPAVLSFDRRQRGTFNKSFEQYVSTRVGPGRIKTGQAMLI 98

Query: 113 ANSRLLINLKKEYGVPPGILMALWGLETHFGE-TMGKTPLLSTLATLAYDCRRAKFFTEQ 171
            ++ LL  +++++GVPP IL+A+WGLET +G   MGK P+   LAT+A+DCRR + F  +
Sbjct: 99  RHASLLSRIERQFGVPPQILVAIWGLETDYGTGDMGKLPVFRVLATMAHDCRRTELFQGE 158

Query: 172 FFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIA 230
              AL +V++G +     +GA  GEIGQ QFLP + +KY +D D +G +DL  S  D +A
Sbjct: 159 LLAALQIVQRGDLGLRDMVGAYAGEIGQTQFLPSSYIKYGVDFDGNGHVDLRHSVPDVLA 218

Query: 231 SAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIA 274
           S A  L   GW     Y+ G  NF  ++ WN +  Y KTI Y A
Sbjct: 219 STANLLKTAGWRAGGSYEEGSANFEAMREWNRATIYRKTIGYFA 262


>gi|312114594|ref|YP_004012190.1| lytic murein transglycosylase [Rhodomicrobium vannielii ATCC 17100]
 gi|311219723|gb|ADP71091.1| lytic murein transglycosylase [Rhodomicrobium vannielii ATCC 17100]
          Length = 268

 Score =  153 bits (387), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 77/178 (43%), Positives = 108/178 (60%), Gaps = 2/178 (1%)

Query: 104 IAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGE-TMGKTPLLSTLATLAYDC 162
           I +G  + + ++ LL  +++ +GVPP +++A+WGLET FG   MG  P++ TLATLA+DC
Sbjct: 90  IKRGREMLQRHAALLSRIQQRFGVPPQLVVAIWGLETDFGSGDMGNRPVIRTLATLAWDC 149

Query: 163 RRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDL 221
           RR + F  +   AL +V++G +    L GA  GEIGQ QFLP + +KY +D D +G +DL
Sbjct: 150 RRTELFQRELIAALKIVQRGDLPLSDLKGAYAGEIGQTQFLPSSYIKYGVDFDGNGHVDL 209

Query: 222 VKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHIDG 279
             S  D +AS A  L   GW   A Y  G  NF +L+ WN S  Y KTI Y A  + G
Sbjct: 210 RHSVPDVLASTANLLKVNGWRAGASYGEGSANFQVLREWNRSEVYRKTIVYFAGRLAG 267


>gi|115523066|ref|YP_779977.1| lytic murein transglycosylase [Rhodopseudomonas palustris BisA53]
 gi|115517013|gb|ABJ04997.1| lytic murein transglycosylase [Rhodopseudomonas palustris BisA53]
          Length = 269

 Score =  152 bits (385), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 77/200 (38%), Positives = 118/200 (59%), Gaps = 2/200 (1%)

Query: 80  DRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLE 139
           DR+   +   +F+ Y+        I  G A+ + ++ LL  +++++GVPP IL+A+WGLE
Sbjct: 66  DRRQRGTFNKTFEQYIATRVGPGRINTGRAMLQRHASLLSRIERQFGVPPEILVAIWGLE 125

Query: 140 THFGE-TMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIG 197
           + FG+  +GK P++ TLAT+A+DCRR + F  +   AL +V++G +    L GA  GE+G
Sbjct: 126 SDFGKGDIGKMPVIRTLATMAHDCRRTELFQGELLAALKIVQRGDLPLKDLIGAYAGELG 185

Query: 198 QFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAIL 257
           Q QFLP + +KY +D D +G +DL  S  D +AS A  L   GW     Y+ G  NF  +
Sbjct: 186 QTQFLPSSYIKYGVDYDGNGHVDLRHSVPDVLASTANLLKTAGWRAGGSYEEGSANFEAM 245

Query: 258 KHWNASLNYNKTIAYIAAHI 277
           + WN +  Y KTI Y A  +
Sbjct: 246 REWNRATIYRKTIGYFADRL 265


>gi|217979774|ref|YP_002363921.1| lytic murein transglycosylase [Methylocella silvestris BL2]
 gi|217505150|gb|ACK52559.1| lytic murein transglycosylase [Methylocella silvestris BL2]
          Length = 271

 Score =  152 bits (383), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 77/189 (40%), Positives = 116/189 (61%), Gaps = 1/189 (0%)

Query: 90  SFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKT 149
           SF+ +   + S   + +G  L K  +  L  ++  YGVP  +++ALWGLET FG   G  
Sbjct: 79  SFEQFSARMISPNRLRRGSTLLKTYASALSRIEAAYGVPGPVIVALWGLETDFGADSGGE 138

Query: 150 PLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVK 208
             L  LATLA+DCRR + F  +   AL LV++G ++  A+ GA  GE+GQ QF+P + +K
Sbjct: 139 ATLQALATLAFDCRRTEKFQAELLDALRLVERGDLAPAAMRGAWAGELGQTQFMPSSYLK 198

Query: 209 YAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNK 268
           YA+D + +G+ DL+   +DA+AS A +L   GW   AG++PG+ NFA+++ WN S  Y K
Sbjct: 199 YAVDFNGNGRRDLIHDPLDALASTANYLKAHGWQAGAGWEPGQPNFAVIQKWNESEVYAK 258

Query: 269 TIAYIAAHI 277
           T+A  A  +
Sbjct: 259 TVAAFATKL 267


>gi|27382455|ref|NP_773984.1| hypothetical protein bll7344 [Bradyrhizobium japonicum USDA 110]
 gi|27355626|dbj|BAC52609.1| bll7344 [Bradyrhizobium japonicum USDA 110]
          Length = 268

 Score =  149 bits (376), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 85/225 (37%), Positives = 125/225 (55%), Gaps = 2/225 (0%)

Query: 57  GMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSR 116
           G+S       F+ +      +A DR+   +   SF+ Y+        I  G AL + ++ 
Sbjct: 43  GVSASVTSAAFSGITQDGAVLAFDRRQRYTFNKSFEQYVSTRVGPGRINGGKALLQRHAA 102

Query: 117 LLINLKKEYGVPPGILMALWGLETHFGE-TMGKTPLLSTLATLAYDCRRAKFFTEQFFYA 175
           LL  +++++GVP  IL+A+WGLE+ FG+  +GK P++ TLATLA+DCRR   F  +   A
Sbjct: 103 LLSRIEQQFGVPRYILVAIWGLESDFGKGDIGKLPVIRTLATLAHDCRRTDLFQGELLAA 162

Query: 176 LDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAK 234
           L +V++G +    L GA  GEIGQ QFLP + +KY +D D DG +DL  S  D +AS A 
Sbjct: 163 LKIVQRGDLPLRDLIGAYAGEIGQTQFLPSSYIKYGVDFDGDGHVDLRHSVPDVLASTAN 222

Query: 235 FLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHIDG 279
            L   G+     Y  G  NF  ++ WN ++ Y KTI Y A  + G
Sbjct: 223 LLHTSGFKMGQPYGEGTANFEAMREWNRAVIYRKTIGYFADRLAG 267


>gi|294141374|ref|YP_003557352.1| membrane-bound lytic murein transglycolase [Shewanella violacea
           DSS12]
 gi|293327843|dbj|BAJ02574.1| membrane-bound lytic murein transglycolase [Shewanella violacea
           DSS12]
          Length = 393

 Score =  146 bits (369), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 88/218 (40%), Positives = 119/218 (54%), Gaps = 6/218 (2%)

Query: 29  ATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPP 88
           A++ +     AD F       +  A  EG+S  T  +  A ++Y+   I  D K    P 
Sbjct: 13  ASSLWTLPAVADDFASCVVNLKQTAQHEGLSQDTIDNTLAKVKYVARVIELDNK---QPE 69

Query: 89  VS--FKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETM 146
            S  F +Y     ++  I +G  L K N  LL  L+ +YGVPP  LMA WGLET+FG   
Sbjct: 70  FSQTFDNYFSKRVTAWRIQEGRRLLKENKTLLTKLQDKYGVPPQYLMAFWGLETNFGSYK 129

Query: 147 GKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKK-GVISSHALGATFGEIGQFQFLPVN 205
           GK P+L +LATLA D RR+K+FT +   AL L +K    +S  +G+  G +G  QF+P  
Sbjct: 130 GKMPVLDSLATLACDPRRSKYFTGELMKALKLKEKYNFDASMMVGSWAGAMGHTQFMPSA 189

Query: 206 VVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTK 243
              YA+D D DGK DL  S  DA++SAA FL KLGW +
Sbjct: 190 YTHYAVDGDGDGKADLWNSTTDALSSAANFLNKLGWQR 227


>gi|157375810|ref|YP_001474410.1| lytic murein transglycosylase [Shewanella sediminis HAW-EB3]
 gi|157318184|gb|ABV37282.1| lytic murein transglycosylase [Shewanella sediminis HAW-EB3]
          Length = 377

 Score =  144 bits (364), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 85/209 (40%), Positives = 116/209 (55%), Gaps = 6/209 (2%)

Query: 38  TADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVS--FKDYL 95
           +AD F       +  A  +G+S  T  +  A ++Y+   I  D+K    P  S  F +Y 
Sbjct: 4   SADDFASCVIKLKETAQAQGLSRDTIDNTLAKVKYISRVIELDKKQ---PEFSQTFDNYF 60

Query: 96  DGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTL 155
               +   + +G  L K N  LL  L ++YGVPP  LMA WGLET+FG   GK P+L +L
Sbjct: 61  SKRVTDWRVKEGRKLLKENRELLNELSQKYGVPPQYLMAFWGLETNFGSYKGKMPVLDSL 120

Query: 156 ATLAYDCRRAKFFTEQFFYALDLVKK-GVISSHALGATFGEIGQFQFLPVNVVKYAIDAD 214
           ATLA D RR+K+FT +   AL L ++    SS  +G+  G +G  QF+P    KYA+D D
Sbjct: 121 ATLACDPRRSKYFTGELMKALKLKEEYQFESSQMVGSWAGAMGHTQFMPSAYAKYAVDGD 180

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTK 243
            DGK DL  S  DA+ SAA FL +LGW +
Sbjct: 181 GDGKADLWNSTTDALTSAANFLNQLGWQR 209


>gi|319957198|ref|YP_004168461.1| lytic murein transglycosylase [Nitratifractor salsuginis DSM 16511]
 gi|319419602|gb|ADV46712.1| lytic murein transglycosylase [Nitratifractor salsuginis DSM 16511]
          Length = 397

 Score =  144 bits (363), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 80/211 (37%), Positives = 118/211 (55%), Gaps = 8/211 (3%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F +W  A    AV +G+SP T       + Y  + I RDR+        F+ +   + S 
Sbjct: 30  FPQWLKAFERYAVSQGISPDTVHRALDGITYDPSVIRRDRRQHQFS-YDFRTFAKRIISP 88

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             + +G  L    +RL   ++K YGVP  +++A WGLE+ FG  MGK   L +LATLAYD
Sbjct: 89  YRLRKGKQLIHKKARLFKAIEKRYGVPAPVIVAFWGLESDFGAYMGKDNTLRSLATLAYD 148

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
           CRR+  F ++   AL ++ +G ++   + G+  GE+GQ QFLP   +KY +D D DG+ D
Sbjct: 149 CRRSDEFQKELLAALKIIDEGDLTPRQMRGSWAGELGQTQFLPSYYLKYGVDFDGDGRRD 208

Query: 221 LVKSNIDAIASAAKFLAKLGWTKCAGYQPGE 251
           L+ S+ DA+AS A +L  LGW      +PGE
Sbjct: 209 LIHSSADALASTANYLRHLGW------KPGE 233


>gi|163752325|ref|ZP_02159522.1| membrane-bound lytic transglycolase-related protein [Shewanella
           benthica KT99]
 gi|161327772|gb|EDP98957.1| membrane-bound lytic transglycolase-related protein [Shewanella
           benthica KT99]
          Length = 377

 Score =  144 bits (362), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 82/209 (39%), Positives = 119/209 (56%), Gaps = 6/209 (2%)

Query: 38  TADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVS--FKDYL 95
           +AD F       + +A REG+S +T  +  A++ Y+   I  D+K    P  S  F +Y 
Sbjct: 4   SADDFATCVVNLQQKAQREGLSKETIDNALANVNYVSRVIELDKKQ---PEFSQTFDNYF 60

Query: 96  DGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTL 155
               +   ++QG  + + +  LL  L++ YG+PP  LMA WGLET+FG   GK P+L +L
Sbjct: 61  SKRVTDWRVSQGRKMLREHKVLLAKLQETYGIPPQYLMAFWGLETNFGAYKGKMPVLDSL 120

Query: 156 ATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDAD 214
           ATLA D RR+++FT +   AL L +K     S  +G+  G +G  QF+P     YA+D D
Sbjct: 121 ATLACDPRRSQYFTGELMKALKLKEKYDFDVSTMVGSWAGAMGHTQFMPSAYTHYAVDGD 180

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTK 243
            DGK DL  S  DA++SAA FL +LGW +
Sbjct: 181 GDGKADLWNSTADALSSAANFLNQLGWQR 209


>gi|332139886|ref|YP_004425624.1| membrane-bound lytic transglycosylase-related protein [Alteromonas
           macleodii str. 'Deep ecotype']
 gi|327549908|gb|AEA96626.1| membrane-bound lytic transglycosylase-related protein [Alteromonas
           macleodii str. 'Deep ecotype']
          Length = 421

 Score =  143 bits (361), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 94/276 (34%), Positives = 140/276 (50%), Gaps = 29/276 (10%)

Query: 30  TTQFICSDTA-DRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPP 88
           T   I S +A + F    +A   RA +EG+S +    +F  L + D  I  DR   + P 
Sbjct: 30  TGAVISSASANEHFSSCTAALADRAKQEGVSQQIIDEIFPHLVHQDRVIELDR---SQPE 86

Query: 89  V--SFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETM 146
              +F  Y     +     +G A+   + +LL  L  +YGVPP  L+A WGLET+FG   
Sbjct: 87  FVQTFPGYFSKRVTDWRTEKGKAMYAKHEKLLHKLSDKYGVPPHYLLAFWGLETNFGSYK 146

Query: 147 GKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVI-SSHALGATFGEIGQFQFLPVN 205
           GK P+L +LATLA D RR+K+FT++F  A+ L+++  +   + +G+  G +G  QF+P  
Sbjct: 147 GKMPVLDSLATLACDKRRSKYFTQEFLVAVKLMQREKLKKDNMVGSWAGAMGHTQFMPSA 206

Query: 206 VVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGY-------------QPGEK 252
              YAID D DG+++L +S  DA++SAA FLA LGW +   +             + G K
Sbjct: 207 YTHYAIDGDGDGQVNLWESEEDALSSAANFLASLGWERSFRWGREVKLPEGFNYQESGYK 266

Query: 253 NFAILKHWNASLNYNKTIAYIAAHIDGVPIGKGYDT 288
           N   L  W+                DG P+G+G  T
Sbjct: 267 NRKPLSEWHEQ---------GVKKADGSPLGEGETT 293


>gi|46202634|ref|ZP_00052889.2| COG2951: Membrane-bound lytic murein transglycosylase B
           [Magnetospirillum magnetotacticum MS-1]
          Length = 324

 Score =  142 bits (359), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 74/201 (36%), Positives = 123/201 (61%), Gaps = 2/201 (0%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           FG + +  RA A+ +G+ P++     A++ ++D  I  DRK      +SF +YL  + S 
Sbjct: 28  FGTFLAGVRAEALEKGLKPESLDAALANVVHIDRVIELDRKQ-PEFTLSFNEYLGRIVSQ 86

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             + +G      N  LL  +++ YGV P  ++ALWG+ET+FG+  G   ++S+LATLAYD
Sbjct: 87  SRVEEGRRKLAENKALLTEIERRYGVQPRFVVALWGIETNFGKNTGGMSVVSSLATLAYD 146

Query: 162 CRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR+K+F  +   AL ++ +G I+ ++ +G+  G +GQ QF+P   +K+A+D D DGK +
Sbjct: 147 GRRSKYFRTELMNALTILDQGHITPANMIGSWAGAMGQCQFMPSTFLKFAVDWDGDGKRN 206

Query: 221 LVKSNIDAIASAAKFLAKLGW 241
           +  +  DA+ASAA +L+  GW
Sbjct: 207 IWTNRSDALASAANYLSSEGW 227


>gi|126724387|ref|ZP_01740230.1| Lytic murein transglycosylase [Rhodobacterales bacterium HTCC2150]
 gi|126705551|gb|EBA04641.1| Lytic murein transglycosylase [Rhodobacterales bacterium HTCC2150]
          Length = 434

 Score =  142 bits (357), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 80/240 (33%), Positives = 134/240 (55%), Gaps = 5/240 (2%)

Query: 7   LLISLLMMVYPMLAQAVTQP--KKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAK 64
           +L++   +  P++     +P  +  T   + + T  RF    +  + RA++ G+S +TA 
Sbjct: 29  ILLAGSSLAGPIVLDKSLRPMARSETRPTLVAATPSRFKSCVAGLKRRAIKSGISSRTAD 88

Query: 65  HLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKE 124
             F  +++L   IA+DRK  +       +YLD   S+  +  G A  +  SR+L  ++++
Sbjct: 89  RAFRGVQFLPDVIAKDRKQ-SEFTKQIWEYLDTAVSATRVKNGRAALRKQSRVLAQIERK 147

Query: 125 YGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVI 184
           YGV   ++ A+WGLE+ +G   G TPL+ +L TLA D RR+KFFT Q   AL +++ G +
Sbjct: 148 YGVEAEVVTAIWGLESAYGTFRGSTPLMDSLTTLACDSRRSKFFTSQLMAALKIIQAGDV 207

Query: 185 SSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSN-IDAIASAAKFLAKLGWT 242
           +   + G+  G +G  QF+P + + YA+D   DGK D+   N  DA+AS A +L + GWT
Sbjct: 208 APRKMTGSWAGAMGHTQFIPTSYLGYAVDFTGDGKRDIWSDNPTDALASTAAYLKRFGWT 267


>gi|149377682|ref|ZP_01895418.1| Membrane-bound lytic murein transglycosylase B [Marinobacter
           algicola DG893]
 gi|149358035|gb|EDM46521.1| Membrane-bound lytic murein transglycosylase B [Marinobacter
           algicola DG893]
          Length = 398

 Score =  141 bits (356), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 79/202 (39%), Positives = 118/202 (58%), Gaps = 2/202 (0%)

Query: 41  RFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSS 100
           RF +      ++A+  G+S +TA  + A  EYL+  I  DR+       +F DYL+   +
Sbjct: 18  RFPQCIEHLESQAIEAGVSSQTAGEVLAGAEYLERVIELDRRQPEFT-TTFADYLNRRVN 76

Query: 101 SEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAY 160
           S+ +++G  L   +  LL  + ++ GVP   L+A WGLET+FG   GK  + S+LATLA 
Sbjct: 77  SDRVSRGRELLDQHEELLDRVTRKTGVPAPYLVAFWGLETNFGAYFGKMSVPSSLATLAC 136

Query: 161 DCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKI 219
           D RR++FFTEQ   AL ++ +G I +  + G+  G +G  QF+P   +++A+D D DGK 
Sbjct: 137 DERRSQFFTEQLIAALRIIDEGAIPAEQMEGSWAGAMGHVQFMPTVFLRHAVDGDGDGKR 196

Query: 220 DLVKSNIDAIASAAKFLAKLGW 241
           DL  S  DA+ SA  FL  LGW
Sbjct: 197 DLWNSLPDAMMSAGHFLQDLGW 218


>gi|311696248|gb|ADP99121.1| peptidoglycan binding domain protein [marine bacterium HP15]
          Length = 416

 Score =  140 bits (354), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 80/213 (37%), Positives = 121/213 (56%), Gaps = 6/213 (2%)

Query: 34  ICSDTAD----RFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPV 89
           I  D+A+     F E K+  + +A+  G+S KTA  + + +++L   I  DR+       
Sbjct: 32  IAQDSAEVEPAGFAECKARLQEQAIAAGVSSKTASEVMSGVQHLARVIELDRRQPEFT-T 90

Query: 90  SFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKT 149
           +F DYL+   +   +  G  L + +  LL  + +E GVP   L+A WGLET+FG   GK 
Sbjct: 91  TFADYLNRRVNDARVNTGRELLQEHQELLARVTRETGVPAPYLVAFWGLETNFGSYFGKM 150

Query: 150 PLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVK 208
           P+ S+L TLA D RR+ FFTEQ   AL ++ +G I +  + G+  G +G  QF+P   +K
Sbjct: 151 PVPSSLTTLACDPRRSTFFTEQLIAALRIIDEGAIPADQMEGSWAGAMGHVQFMPTVFLK 210

Query: 209 YAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
           +A+DAD DG+ DL  S  DA+ SA +FL  + W
Sbjct: 211 HAVDADGDGRRDLWNSLPDAMMSAGRFLESMNW 243


>gi|290475389|ref|YP_003468277.1| putative lipoprotein [Xenorhabdus bovienii SS-2004]
 gi|289174710|emb|CBJ81506.1| putative lipoprotein precursor [Xenorhabdus bovienii SS-2004]
          Length = 361

 Score =  140 bits (354), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 76/212 (35%), Positives = 118/212 (55%), Gaps = 3/212 (1%)

Query: 34  ICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKD 93
           I S    +F  + +  + +A  +G S KT    FAD+ ++   I  DR       ++  D
Sbjct: 49  IASREPSQFPTYVALLKQQAKEQGFSEKTLDRAFADIHFISRVIQSDRNQ-PEKKITLAD 107

Query: 94  YLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLS 153
           YL+ + S+  I QG+   + N   L  + ++YGVP   ++ALWGLE+ FG+  GK  ++S
Sbjct: 108 YLNRVLSARKIEQGVIQYQNNLPQLEIISRKYGVPKDYIVALWGLESGFGKIQGKEDVIS 167

Query: 154 TLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL--GATFGEIGQFQFLPVNVVKYAI 211
            L+TLA++ RR   F +Q   AL++++K  I  H    G+  G +GQ QF+P + + YA 
Sbjct: 168 ALSTLAFEGRREDLFIKQLMAALEIIEKKYIDEHQTLKGSWAGAMGQSQFMPTSYLNYAA 227

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGWTK 243
           D + DGKID+  S  D  AS A +LAK GW +
Sbjct: 228 DGNGDGKIDIWNSKEDVFASIANYLAKEGWQQ 259


>gi|90422886|ref|YP_531256.1| lytic murein transglycosylase [Rhodopseudomonas palustris BisB18]
 gi|90104900|gb|ABD86937.1| Lytic murein transglycosylase [Rhodopseudomonas palustris BisB18]
          Length = 412

 Score =  140 bits (353), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 73/204 (35%), Positives = 119/204 (58%), Gaps = 3/204 (1%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F ++ ++ + +A  +G+SP+        L Y    + RDR       V F ++   ++++
Sbjct: 33  FEQFLASLKQQAAADGVSPRAIAAASPGLVYDQGIVNRDRGQRVFGQV-FTEFAGRMAAN 91

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             + QG A+ K ++R     +++YGVPP ++ A WGLE+ FG  MGK P L +L +LAYD
Sbjct: 92  YRMQQGQAMIKTHARAFARAEQDYGVPPAVIAAFWGLESDFGANMGKLPTLRSLVSLAYD 151

Query: 162 CRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
           CRRAK F  +   AL ++ +G ++ S  +G+  GE+GQ QFLP +   YA+D D DG+ D
Sbjct: 152 CRRAKMFEAETIAALKIIDRGDLAPSEMIGSWAGELGQTQFLPTHYFNYAVDYDGDGRRD 211

Query: 221 LVKSNIDAIASAAKFLAK-LGWTK 243
           +++S  D I S A ++A  L W +
Sbjct: 212 MLRSPADVIGSTANYIANGLKWRR 235


>gi|297538939|ref|YP_003674708.1| lytic murein transglycosylase [Methylotenera sp. 301]
 gi|297258286|gb|ADI30131.1| lytic murein transglycosylase [Methylotenera sp. 301]
          Length = 448

 Score =  140 bits (353), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 80/207 (38%), Positives = 110/207 (53%), Gaps = 6/207 (2%)

Query: 40  DRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKM--VTSPPVSFKDYLDG 97
           + F  W S  R  AV  G++ KT   +   +E L   I  DR      SP   F DY   
Sbjct: 23  EDFNVWLSELRQEAVSVGITEKTVSAIVNHVEILPNVIELDRAQPEFVSP---FLDYYQR 79

Query: 98  LSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLAT 157
              +  I +G  L   ++ LL  ++ +YGVP  +L+A WG+ET++G   G    LS LAT
Sbjct: 80  RVDTLKITEGRKLLVQHAELLDKIELQYGVPKALLVAFWGMETNYGRNQGNIDTLSALAT 139

Query: 158 LAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADED 216
           LAYD RRA FF  Q   A+ +V  G  +    +G+  G  G  QF+P   + YA+D D D
Sbjct: 140 LAYDGRRASFFRNQLIDAMRMVDAGNANVDQFVGSWAGAFGNMQFMPTTFITYAVDGDGD 199

Query: 217 GKIDLVKSNIDAIASAAKFLAKLGWTK 243
            KID+V S  DA ASAA +L+++GW K
Sbjct: 200 KKIDVVNSQADAFASAANYLSQVGWQK 226


>gi|298292927|ref|YP_003694866.1| lytic murein transglycosylase [Starkeya novella DSM 506]
 gi|296929438|gb|ADH90247.1| lytic murein transglycosylase [Starkeya novella DSM 506]
          Length = 411

 Score =  140 bits (352), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 75/211 (35%), Positives = 119/211 (56%), Gaps = 2/211 (0%)

Query: 32  QFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSF 91
           Q  C +    F ++ +  + +AV +G+SP+T       + Y    +A DR        SF
Sbjct: 30  QQSCGNNGAGFDQFIAGFKQQAVAQGVSPRTVATALNGIAYAPDIVATDRGQKVFGQ-SF 88

Query: 92  KDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPL 151
             + D + ++  I QG    + N  L   +++++GVP  +L++ WGLET FG  MG    
Sbjct: 89  FQFSDRMVANYRIQQGRQQIQRNPALFQRIEQQFGVPGAVLVSFWGLETDFGANMGDKST 148

Query: 152 LSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYA 210
           + ++ATLA+DCRRA  F  Q   AL ++ +G ++   + G   GE+GQFQFLP +   Y 
Sbjct: 149 IRSVATLAWDCRRADVFRTQLLAALKIIDRGDLTPQTMRGPWAGELGQFQFLPDHYFNYG 208

Query: 211 IDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
           +D D DG++DL++S  DA+ASAA ++  LGW
Sbjct: 209 VDFDGDGRVDLIRSAPDALASAANYIRALGW 239


>gi|126664625|ref|ZP_01735609.1| Membrane-bound lytic murein transglycosylase B [Marinobacter sp.
           ELB17]
 gi|126630951|gb|EBA01565.1| Membrane-bound lytic murein transglycosylase B [Marinobacter sp.
           ELB17]
          Length = 418

 Score =  140 bits (352), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 90/239 (37%), Positives = 130/239 (54%), Gaps = 22/239 (9%)

Query: 40  DRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKM--VTSPPVSFKDYLDG 97
           + F   K+  + +AV  G+S +TA+ + A  EYL+  I  DR+    T+P   F DYL+ 
Sbjct: 44  NSFETCKADLQQQAVAAGVSAETARSVLAGAEYLERVIELDRRQPEFTTP---FADYLNR 100

Query: 98  LSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLAT 157
             +   I +G  L   ++ LL  +  E GVP   L++ WGLET++G   GK  + S+LAT
Sbjct: 101 RVNDTRIDKGRQLLIEHADLLQRVTNETGVPAAYLLSFWGLETNYGSYFGKMSVPSSLAT 160

Query: 158 LAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADED 216
           LA D RR  FFT Q   AL +V +G IS   + G+  G +G  QF+P   +K+A+DAD D
Sbjct: 161 LACDERRKTFFTRQLIAALQIVDEGAISPEQMEGSWAGAMGHVQFMPTVFLKHAVDADGD 220

Query: 217 GKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEK-------NFAI-------LKHWN 261
           G+ DL  S  DA+ SA +FL  +GW     Y+ G +       NFA+       L+ WN
Sbjct: 221 GRRDLWHSLPDALMSAGQFLQSMGWD--GDYRWGREVQLPDNFNFALADGRRKSLEQWN 277


>gi|239994683|ref|ZP_04715207.1| membrane-bound lytic transglycolase-related protein [Alteromonas
           macleodii ATCC 27126]
          Length = 428

 Score =  139 bits (351), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 94/278 (33%), Positives = 140/278 (50%), Gaps = 30/278 (10%)

Query: 2   SFKKYLLISLLMMVYPMLAQAVTQPKKATTQFI-CSDTADRFGEWKSAARARAVREGMSP 60
           S+  +L  SL   +  +LA A      A  QF  C+          +A   +A +EG+S 
Sbjct: 21  SYASFLRPSLRTSMALLLAGATMNSALANEQFASCT----------AALADKAKQEGVSQ 70

Query: 61  KTAKHLFADLEYLDTTIARDRKMVTSPPV--SFKDYLDGLSSSEIIAQGIALKKANSRLL 118
           +T   +F  L + D  I  DR   + P    +F  Y     +     +G  +   + +LL
Sbjct: 71  QTIDDVFPRLVHQDRVIELDR---SQPEFVQTFPGYFSKRVTDWRTEKGKEMYAKHDKLL 127

Query: 119 INLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDL 178
             L ++YGVPP  L+A WGLET+FG   GK P+L +LATLA D RR+ +FT++F  A+ L
Sbjct: 128 HKLSEKYGVPPHYLLAFWGLETNFGSYKGKMPVLDSLATLACDKRRSTYFTQEFLVAVKL 187

Query: 179 VKKGVISSH-ALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLA 237
           +++  +     +G+  G +G  QF+P     YAID D DG+I+L  S  DA++SAA FLA
Sbjct: 188 MEREKLQKEDMIGSWAGAMGHTQFMPSAYTHYAIDGDGDGQINLWASEEDALSSAANFLA 247

Query: 238 KLGWTKCAGY-------------QPGEKNFAILKHWNA 262
            LGW +   +             + G KN   L  W+A
Sbjct: 248 NLGWERSFRWGREVQLPENFDYQESGYKNRKSLSEWHA 285


>gi|149915308|ref|ZP_01903835.1| Lytic murein transglycosylase [Roseobacter sp. AzwK-3b]
 gi|149810597|gb|EDM70438.1| Lytic murein transglycosylase [Roseobacter sp. AzwK-3b]
          Length = 414

 Score =  139 bits (351), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 92/280 (32%), Positives = 144/280 (51%), Gaps = 25/280 (8%)

Query: 17  PMLAQAVTQPKKATTQFICSDTAD-RFGEWKSAARARAVREGMSPKTAKHLFADLEYLDT 75
           P+L  A  Q   +  Q +   TA+  F  W +  R RA+ +G+SP+     F  + Y   
Sbjct: 21  PVLRPAELQ---SDAQLVRVSTANASFDRWVAGFRGRALAQGISPRVFDAAFRGVSYNSE 77

Query: 76  TIARDRKMVTSPPVSFK----DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGI 131
            + +DR         FK    DYLD  +S + +  G A  + ++R L  +++ YGV   +
Sbjct: 78  VVHKDRNQA-----EFKRQIWDYLDSAASPDRVRNGQAALRRHARALAAIERAYGVEKEV 132

Query: 132 LMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-G 190
           + A+WGLET +GE  G  PL+ ++ATLAYD RR  FF +Q   AL +++ G +    + G
Sbjct: 133 VTAVWGLETAYGERRGTLPLIESVATLAYDGRRGAFFEKQLIAALQIIQAGDVDPRDMKG 192

Query: 191 ATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSN-IDAIASAAKFLAKLGWTKCAGYQP 249
           +  G +G  QF+P + + YA+D   DGK D+   +  DA+AS A +L + GWTK    QP
Sbjct: 193 SWAGAMGHTQFIPTSYLAYAVDFTGDGKRDIWSDDPTDALASTAAYLKRFGWTKG---QP 249

Query: 250 GEKNFAILKHWNASL---NYNKTIAYIAAH----IDGVPI 282
                 + + +NA+    +  K  +  AA     IDG P+
Sbjct: 250 WGVEVRLPRGFNAATAKRDNRKMPSQWAAQGVVGIDGRPV 289


>gi|119775164|ref|YP_927904.1| membrane-bound lytic transglycolase-like protein [Shewanella
           amazonensis SB2B]
 gi|119767664|gb|ABM00235.1| membrane-bound lytic transglycolase-related protein [Shewanella
           amazonensis SB2B]
          Length = 401

 Score =  139 bits (350), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 98/155 (63%), Gaps = 1/155 (0%)

Query: 90  SFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKT 149
           +F DY +   +   I++G  + K +  LL  L+KEYGVPP  L+A WGLET+FG   GK 
Sbjct: 72  TFADYFNKRVTERRISEGQKMLKTHGALLNKLQKEYGVPPQYLLAFWGLETNFGGYKGKM 131

Query: 150 PLLSTLATLAYDCRRAKFFTEQFFYALDLVKK-GVISSHALGATFGEIGQFQFLPVNVVK 208
           P+L  LATLA D RR+++FT++   AL L  K G+     +G+  G +G  QF+P   + 
Sbjct: 132 PVLDALATLACDARRSQYFTQELLQALRLGDKFGLSFEDMVGSWAGAMGHTQFMPTTYLT 191

Query: 209 YAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTK 243
           YA+D D DGK+DL  S  DA++SAA FL +LGW +
Sbjct: 192 YAVDGDGDGKVDLWNSTEDALSSAANFLMQLGWQR 226


>gi|301062749|ref|ZP_07203361.1| lytic murein transglycosylase [delta proteobacterium NaphS2]
 gi|300443156|gb|EFK07309.1| lytic murein transglycosylase [delta proteobacterium NaphS2]
          Length = 316

 Score =  139 bits (349), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 79/214 (36%), Positives = 121/214 (56%), Gaps = 9/214 (4%)

Query: 39  ADR-FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPP---VSFKDY 94
           +DR F EW    R  A   G+S       F DL+ +   I  DR    S P   ++F+ Y
Sbjct: 19  SDRSFQEWLKGVRREAREAGVSEAVMGRAFRDLKPIPRVIELDR----SQPEFKLTFQQY 74

Query: 95  LDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLST 154
           LD + + + +  G    + +  LL  + ++YGV P  ++ALWG+ET +G+  G  P++  
Sbjct: 75  LDRMVTRKTVWDGRQRYREHKDLLNEIFRQYGVEPQYIVALWGIETRYGKITGGYPVIDV 134

Query: 155 LATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDA 213
           LATLAYD RR+KFF  +   AL ++++G I    + G+  G +GQ QF+P + V YA+D 
Sbjct: 135 LATLAYDGRRSKFFRAELIRALKILEEGHIDVADMDGSWAGAMGQVQFMPSSFVTYAVDQ 194

Query: 214 DEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGY 247
           D DG+ D+  +  DA+ASAA +L+K GW    G+
Sbjct: 195 DGDGRRDIWDNVPDALASAANYLSKSGWKPEQGW 228


>gi|304312079|ref|YP_003811677.1| Putative peptidoglycan-binding protein [gamma proteobacterium HdN1]
 gi|301797812|emb|CBL46034.1| Putative peptidoglycan-binding protein [gamma proteobacterium HdN1]
          Length = 444

 Score =  139 bits (349), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 69/199 (34%), Positives = 115/199 (57%), Gaps = 2/199 (1%)

Query: 50  RARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIA 109
           + RA  EG+   T  +   ++++++  I  DR+       +F +YL+   +   + QG  
Sbjct: 79  QQRARNEGIRDSTILNALGEVQFIERVIELDRRQPEYTE-TFGNYLNSHVTKSRVQQGQK 137

Query: 110 LKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFT 169
           L   + +L  +L+ +YG+P  IL+A WGLET+FG  MG  P++ +L TLA D RR+ FF 
Sbjct: 138 LLDQHQKLFQSLESQYGIPGSILVAFWGLETNFGSYMGSMPIIDSLTTLACDGRRSSFFA 197

Query: 170 EQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDA 228
            +   A+ ++ +G ++   L G+  G +G  QF+P     +A+D D+DG+IDL KS  DA
Sbjct: 198 AELLNAMQMMDQGAVTKDQLKGSWAGAMGNMQFMPSTFRSFAMDGDQDGRIDLWKSVPDA 257

Query: 229 IASAAKFLAKLGWTKCAGY 247
           + SAA +L K+ W + A +
Sbjct: 258 MTSAANYLRKINWQRDARW 276


>gi|83311552|ref|YP_421816.1| membrane-bound lytic murein transglycosylase B [Magnetospirillum
           magneticum AMB-1]
 gi|82946393|dbj|BAE51257.1| Membrane-bound lytic murein transglycosylase B [Magnetospirillum
           magneticum AMB-1]
          Length = 356

 Score =  138 bits (347), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 72/201 (35%), Positives = 120/201 (59%), Gaps = 2/201 (0%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           FG + +  RA  + +G+  +T     A++ ++D  I  DRK      ++F +YL  + S 
Sbjct: 60  FGAFLAGVRAEGLEKGLRSQTLDAALANVTHIDRVIELDRKQ-PEFTLTFNEYLGRIVSQ 118

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             + +G      N  LL  +++ YGV P  ++ALWG+ET+FG+  G   ++S+LATLAYD
Sbjct: 119 ARVEEGRRKLAENKALLTEIERRYGVQPRFVVALWGIETNFGKNTGGMSVVSSLATLAYD 178

Query: 162 CRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR+K+F  +   AL ++ +G I  ++ +G+  G +GQ QF+P   +K+A+D D DGK +
Sbjct: 179 GRRSKYFRTELMNALTILDQGHIQPANMIGSWAGAMGQCQFMPSTFLKFAVDWDGDGKRN 238

Query: 221 LVKSNIDAIASAAKFLAKLGW 241
           +  +  DA+ASAA +L+  GW
Sbjct: 239 IWTNRADALASAANYLSSEGW 259


>gi|212635639|ref|YP_002312164.1| membrane-bound lytic transglycolase-like protein [Shewanella
           piezotolerans WP3]
 gi|212557123|gb|ACJ29577.1| Membrane-bound lytic transglycolase-like protein [Shewanella
           piezotolerans WP3]
          Length = 396

 Score =  138 bits (347), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 76/189 (40%), Positives = 109/189 (57%), Gaps = 2/189 (1%)

Query: 56  EGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANS 115
           +G+S  T  +  A+++++   I  D +       SF++Y     +   + QG  L K + 
Sbjct: 41  QGLSQSTIDNTLANVKFVPRVIELDSQQPEFS-SSFENYFTKRVTDWRVQQGRKLYKEHK 99

Query: 116 RLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYA 175
            LL  L KEYGVPP  L+A WGLET+FG   GK  +L++LATLA D RR+++FT +   A
Sbjct: 100 ELLQRLAKEYGVPPQYLLAFWGLETNFGSYKGKMSVLNSLATLACDPRRSRYFTTELMQA 159

Query: 176 LDLVKK-GVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAK 234
           L L ++ G      +G+  G +G  QF+P    KYA+D D DGK DL  S  DA++SAA 
Sbjct: 160 LKLKEQYGFDEKQMVGSWAGAMGHTQFMPSAYAKYAVDGDGDGKADLWNSTEDALSSAAH 219

Query: 235 FLAKLGWTK 243
           FL  LGW +
Sbjct: 220 FLQNLGWKR 228


>gi|254462615|ref|ZP_05076031.1| lytic murein transglycosylase [Rhodobacterales bacterium HTCC2083]
 gi|206679204|gb|EDZ43691.1| lytic murein transglycosylase [Rhodobacteraceae bacterium HTCC2083]
          Length = 447

 Score =  137 bits (346), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 84/235 (35%), Positives = 132/235 (56%), Gaps = 5/235 (2%)

Query: 11  LLMMVYPMLAQAVTQPKKATT-QFICSDTAD-RFGEWKSAARARAVREGMSPKTAKHLFA 68
           L   + P     VT+ ++A T + I + T++  F  W SA R RA+  G+SP      F 
Sbjct: 46  LTSKIRPNARPNVTKKERAVTPEAILAATSNVGFKRWISAFRGRALSAGISPAAFDQSFR 105

Query: 69  DLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVP 128
           D+ YL   I RDR   +    +  DYLD  +S   IA G A  + +   L  ++ +YGV 
Sbjct: 106 DVVYLPKVIERDRNQ-SEFTKTIWDYLDSAASDRRIANGKAALETHRAKLDAIEAKYGVE 164

Query: 129 PGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHA 188
             +++A+WGLE+ +GE  G TP++S LATL+YD RR +FF  Q   AL +++ G  +   
Sbjct: 165 KEVVVAVWGLESAYGEFRGDTPIVSALATLSYDGRRGRFFESQLIAALKILQSGDTTPKN 224

Query: 189 L-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSN-IDAIASAAKFLAKLGW 241
           + G+  G +G  QF+P + + +A+D   DG+ D+  ++  DA+AS A +L+K GW
Sbjct: 225 MTGSWAGAMGHTQFIPTSYLDHAVDFTGDGRRDIWANDPSDALASTAAYLSKFGW 279


>gi|197285033|ref|YP_002150905.1| lipoprotein [Proteus mirabilis HI4320]
 gi|194682520|emb|CAR42503.1| putative lipoprotein [Proteus mirabilis HI4320]
          Length = 375

 Score =  137 bits (346), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 73/210 (34%), Positives = 115/210 (54%), Gaps = 3/210 (1%)

Query: 36  SDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYL 95
           S T  +F  +  A + +A   G  P+T    F+++ ++D  +  DR       ++   YL
Sbjct: 63  SRTPAQFPAYVDALKQKAAELGYKPETINFAFSEIHFIDRVVKSDRNQ-PEKKITLDVYL 121

Query: 96  DGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTL 155
             + +   IA+G  L +AN + L  +  +YGVP   ++ALWGLE+ FG   GK  ++S L
Sbjct: 122 PRVVTKGRIAEGAKLYQANQQTLAQISNQYGVPANYIVALWGLESGFGRVQGKEDVISAL 181

Query: 156 ATLAYDCRRAKFFTEQFFYALDLVKKG--VISSHALGATFGEIGQFQFLPVNVVKYAIDA 213
           ATLA++ RR   F+ Q   AL++++ G   +     G+  G +GQ QF+P + + YA D 
Sbjct: 182 ATLAFEGRREALFSRQLMAALEIIENGHLPVGQRLKGSWAGAMGQTQFMPSSFLTYAADG 241

Query: 214 DEDGKIDLVKSNIDAIASAAKFLAKLGWTK 243
           + DG ID+  S  DA ASAA +LA  GW +
Sbjct: 242 NGDGNIDIWNSREDAFASAANYLATEGWQR 271


>gi|113970604|ref|YP_734397.1| lytic murein transglycosylase [Shewanella sp. MR-4]
 gi|113885288|gb|ABI39340.1| lytic murein transglycosylase [Shewanella sp. MR-4]
          Length = 424

 Score =  137 bits (346), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 86/229 (37%), Positives = 123/229 (53%), Gaps = 10/229 (4%)

Query: 22  AVTQPKKATTQFICSDT----ADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTI 77
           A+ + + A  +   SDT    A+ F    +  + RA  EG+S  T K   A L+++   I
Sbjct: 30  AIAETQAAVQEMQLSDTIAAHAEAFPTCVANLQERARSEGLSEATIKDTVASLQFVPKVI 89

Query: 78  ARDRKMVTSPPVS--FKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMAL 135
             D+     P  S  F +Y    ++   + +G  L K +  LL  L +EYGVPP  +++ 
Sbjct: 90  ELDQ---AQPEFSQTFNNYFTKRATDWRVNEGRRLLKKHRALLDKLAQEYGVPPQYILSF 146

Query: 136 WGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKK-GVISSHALGATFG 194
           WGLET++G   GK  +L +LATLA + RR+ +FT +   AL L +K G   S  +G+  G
Sbjct: 147 WGLETNYGSYKGKMSVLDSLATLACEPRRSGYFTTELMQALKLKEKYGFDKSTMVGSWAG 206

Query: 195 EIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTK 243
            +G  QF+P    KYAID D DGK DL  S  DA+ SAA FL  LGW +
Sbjct: 207 AMGHTQFMPSAYAKYAIDGDGDGKADLWNSTEDALTSAANFLQHLGWQR 255


>gi|127513069|ref|YP_001094266.1| lytic murein transglycosylase [Shewanella loihica PV-4]
 gi|126638364|gb|ABO24007.1| lytic murein transglycosylase [Shewanella loihica PV-4]
          Length = 395

 Score =  137 bits (346), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 81/211 (38%), Positives = 117/211 (55%), Gaps = 6/211 (2%)

Query: 36  SDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVS--FKD 93
           S  A  F    SA + +A+  G+S KT +     ++Y+   I  D+K    P  S  F +
Sbjct: 20  SALAQDFDTCVSALKQKALAAGVSSKTVEEGLGQVKYVARVIELDKKQ---PEFSQTFDN 76

Query: 94  YLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLS 153
           Y     +   + +G  L K + +LL  L++EYG+PP  L+A WGLET+FG   GK P++ 
Sbjct: 77  YFSKRVTDWRVQEGRRLLKQHGQLLHKLQQEYGIPPQYLVAFWGLETNFGSYKGKMPVID 136

Query: 154 TLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAID 212
           +L TLA D RR+ +FT +   AL L +     +  + G+  G +G  QF+P    KYA+D
Sbjct: 137 SLTTLACDPRRSDYFTGELIQALKLKEAYQFDNAQMQGSWAGAMGHTQFMPSAYAKYAVD 196

Query: 213 ADEDGKIDLVKSNIDAIASAAKFLAKLGWTK 243
           AD DGK DL  S  DA++SAA FL  LGW +
Sbjct: 197 ADGDGKADLFNSTQDALSSAANFLNNLGWMR 227


>gi|157961727|ref|YP_001501761.1| lytic murein transglycosylase [Shewanella pealeana ATCC 700345]
 gi|157846727|gb|ABV87226.1| lytic murein transglycosylase [Shewanella pealeana ATCC 700345]
          Length = 396

 Score =  137 bits (345), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 81/209 (38%), Positives = 114/209 (54%), Gaps = 5/209 (2%)

Query: 39  ADRFGEWKSAA---RARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYL 95
           AD    W S     +  A  EG+S +T +   A+++Y+   I  D+K       SF++Y 
Sbjct: 21  ADEQPNWASCVAELQQTAKAEGLSQQTIETTLANVKYVPRVIELDQKQPEF-STSFENYF 79

Query: 96  DGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTL 155
               +   + QG  L   +  LL  L KEYGVPP  L+A WGLET+FG   GK  +L +L
Sbjct: 80  SKRVTDWRVEQGRKLYSEHKVLLQKLAKEYGVPPQYLLAFWGLETNFGSYKGKMSVLDSL 139

Query: 156 ATLAYDCRRAKFFTEQFFYALDLVKK-GVISSHALGATFGEIGQFQFLPVNVVKYAIDAD 214
           ATLA D RR+++FT +   AL L ++     +  +G+  G +G  QF+P    KYA+D +
Sbjct: 140 ATLACDPRRSRYFTTELMQALKLKERYNFDEADMVGSWAGAMGHTQFMPSAYAKYAVDGN 199

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTK 243
            DGK DL  S  DA+ SAA FL  LGW +
Sbjct: 200 GDGKADLWNSTEDALTSAANFLQNLGWKR 228


>gi|144899828|emb|CAM76692.1| Membrane-bound lytic murein transglycosylase B [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 330

 Score =  137 bits (345), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 71/201 (35%), Positives = 121/201 (60%), Gaps = 2/201 (0%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F  +    +A A  +GM P+T +   A++E++D  I  DR+      +++K Y+D + S 
Sbjct: 34  FATFLQGVKAEAAGKGMRPETLETALANVEHIDKVIELDRRQ-PEFTMTYKTYMDRVVSP 92

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             + +G  +   N  +L ++++EYGV P  ++ALWG+ET +G   G   ++S LATLAYD
Sbjct: 93  TKVEKGRLMLAENHAVLAHIEREYGVQPKYVVALWGIETDYGRVTGGYSVVSALATLAYD 152

Query: 162 CRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR+ +F  +   AL ++ +G I+ +  LG+  G +GQ QF+P + +++A D D DG+ D
Sbjct: 153 GRRSTYFRGELMNALQILDEGHIAPASMLGSWAGAMGQCQFMPSSFLRFAADWDGDGRRD 212

Query: 221 LVKSNIDAIASAAKFLAKLGW 241
           +  +  D +ASAA +L+K GW
Sbjct: 213 IWTTRADVLASAANYLSKSGW 233


>gi|260432642|ref|ZP_05786613.1| membrane-bound lytic murein transglycosylase B [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260416470|gb|EEX09729.1| membrane-bound lytic murein transglycosylase B [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 374

 Score =  137 bits (344), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 83/265 (31%), Positives = 135/265 (50%), Gaps = 29/265 (10%)

Query: 45  WKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEII 104
           W +  +ARA  +G+S  T    F    YL   I RDR  V     S +DYL   +S E I
Sbjct: 39  WVAGFKARAAGQGISRSTIDRAFQGAGYLPGVIERDRNQVEFK-RSLEDYLAIAASDERI 97

Query: 105 AQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRR 164
            +G  + + ++  L  ++  YGV   I++A+WGLE+ +GE  G  P++S L+TLAYD RR
Sbjct: 98  NKGRQMLQRHNGTLTQIESRYGVDKEIVVAIWGLESRYGERRGDVPVISALSTLAYDGRR 157

Query: 165 AKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVK 223
             FF +Q   AL +++ G  +   + G+  G +G  QF+P + + YA+D   DG+ D+  
Sbjct: 158 GAFFEKQLIAALKILQNGDTTPENMTGSWAGAMGHTQFIPTSYLAYAVDFTGDGRRDIWS 217

Query: 224 SN-IDAIASAAKFLAKLGWTKCAGY---------------------QPGE-----KNFAI 256
            +  D++AS A +L++ GW +   +                     +PG      +NF +
Sbjct: 218 DDPTDSLASTAAYLSRAGWVRGQPWGGEVGSPAASSGTPVAILQPQKPGPRIAVFRNFQV 277

Query: 257 LKHWNASLNYNKTIAYIAAHIDGVP 281
           +K +N S +Y   + ++A  I G P
Sbjct: 278 IKRYNNSDSYAIGVGHLADRIAGGP 302


>gi|83943814|ref|ZP_00956272.1| peptidoglycan-binding protein, putative [Sulfitobacter sp. EE-36]
 gi|83845494|gb|EAP83373.1| peptidoglycan-binding protein, putative [Sulfitobacter sp. EE-36]
          Length = 375

 Score =  137 bits (344), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 86/263 (32%), Positives = 134/263 (50%), Gaps = 29/263 (11%)

Query: 45  WKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEII 104
           W SA ++RA  +G+S  T +  FA   YL   + RDR   T    S +DYL   +S E +
Sbjct: 41  WVSAFKSRAAAQGISDSTLRRGFAGAGYLPGVVKRDRNQ-TEFSRSLEDYLAIAASDERV 99

Query: 105 AQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRR 164
           ++G A    +  +L  ++  YGVP  ++ A+WGLE+ +GE  G  P++S  +TLAYD RR
Sbjct: 100 SKGRAAFARHQGVLRQIEARYGVPAEVVTAVWGLESFYGERRGNVPVVSATSTLAYDGRR 159

Query: 165 AKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVK 223
             FF +Q   AL ++++G +S+  L G+  G +G  QF+P +   +A+D   DGK D+  
Sbjct: 160 GAFFEKQLIAALHILERGDVSAAGLTGSWAGAMGHTQFIPTSYQSFAVDFTGDGKRDIWS 219

Query: 224 SN-IDAIASAAKFLAKLGWTKCAGY------------------QPGE--------KNFAI 256
            +  D++AS A +LAK GW     +                  QP           NF  
Sbjct: 220 DDPSDSLASTAAYLAKSGWKSGQKWGAEMGTAAASSATPVQILQPDAGGPRFAIFNNFKA 279

Query: 257 LKHWNASLNYNKTIAYIAAHIDG 279
           +K +N S NY   + +++  I G
Sbjct: 280 IKRYNNSDNYAIGVGHLSDRIAG 302


>gi|332994727|gb|AEF04782.1| membrane-bound lytic transglycosylase-related protein [Alteromonas
           sp. SN2]
          Length = 408

 Score =  136 bits (343), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 80/216 (37%), Positives = 118/216 (54%), Gaps = 9/216 (4%)

Query: 34  ICSDTA---DRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPV- 89
           +CS TA   + F    S    +A+ +G+S +T   +F  L Y    I  DR   + P   
Sbjct: 24  LCSTTAMADEAFSICTSQLANKALEQGVSQETVDTIFPSLVYQARVIELDR---SQPEFV 80

Query: 90  -SFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGK 148
            +F  Y     +     +G  + + +  LL  L  +YGVPP  L+A WGLET+FG   GK
Sbjct: 81  QTFPGYFSKRVTDWRTNKGQEMYEKHKDLLHKLSDKYGVPPHYLLAFWGLETNFGNYKGK 140

Query: 149 TPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVV 207
            P+L +LATLA D RR+K+FT++   A+ L ++  ++   + G+  G +G  QF+P    
Sbjct: 141 MPVLDSLATLACDPRRSKYFTQELLVAVKLFERESLTREEMVGSWAGAMGHTQFMPSAYT 200

Query: 208 KYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTK 243
            YA+D D DG+I+L  S  DA+ SAA FLA LGW +
Sbjct: 201 HYAVDGDNDGQINLWNSEEDALTSAANFLASLGWQR 236


>gi|83955291|ref|ZP_00963946.1| peptidoglycan-binding protein, putative [Sulfitobacter sp.
           NAS-14.1]
 gi|83840284|gb|EAP79458.1| peptidoglycan-binding protein, putative [Sulfitobacter sp.
           NAS-14.1]
          Length = 372

 Score =  136 bits (343), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 86/263 (32%), Positives = 133/263 (50%), Gaps = 29/263 (11%)

Query: 45  WKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEII 104
           W SA ++RA  +G+S  T +  FA   YL   + RDR   T    S +DYL   +S E +
Sbjct: 38  WVSAFKSRAAAQGISDSTLRRGFAGAGYLPGVVKRDRNQ-TEFSRSLEDYLAIAASDERV 96

Query: 105 AQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRR 164
            +G A    +  +L  ++  YGVP  ++ A+WGLE+ +GE  G  P++S  +TLAYD RR
Sbjct: 97  TKGRAAFARHQGVLRQIEARYGVPAEVVTAVWGLESFYGERRGNVPVVSATSTLAYDGRR 156

Query: 165 AKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVK 223
             FF +Q   AL ++++G +S+  L G+  G +G  QF+P +   +A+D   DGK D+  
Sbjct: 157 GAFFEKQLIAALRILERGDVSAAGLTGSWAGAMGHTQFIPTSYQSFAVDFTGDGKRDIWS 216

Query: 224 SN-IDAIASAAKFLAKLGWTKCAGY------------------QPGE--------KNFAI 256
            +  D++AS A +LAK GW     +                  QP           NF  
Sbjct: 217 DDPSDSLASTAAYLAKSGWKSGQKWGAEMGTAAASSATPVQILQPDAGGPRFAIFNNFKA 276

Query: 257 LKHWNASLNYNKTIAYIAAHIDG 279
           +K +N S NY   + +++  I G
Sbjct: 277 IKRYNNSDNYAIGVGHLSDRIAG 299


>gi|153001147|ref|YP_001366828.1| lytic murein transglycosylase [Shewanella baltica OS185]
 gi|151365765|gb|ABS08765.1| lytic murein transglycosylase [Shewanella baltica OS185]
          Length = 438

 Score =  136 bits (343), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 79/210 (37%), Positives = 117/210 (55%), Gaps = 6/210 (2%)

Query: 37  DTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVS--FKDY 94
           + A+ F    +  +ARA  EG+S  T     A+L+++   I  D++    P  S  F +Y
Sbjct: 63  ENAEAFPSCVTGLQARARTEGLSEATINSTIANLKFVPRVIELDQQQ---PEFSQTFDNY 119

Query: 95  LDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLST 154
               ++   + +G  L + +S LL  L KEYGVPP  +++ WGLET++G   GK  +L++
Sbjct: 120 FSKRATEWRVNEGRRLLQKHSVLLNQLAKEYGVPPQYILSFWGLETNYGSYKGKMSVLNS 179

Query: 155 LATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDA 213
           LATLA + RR+ +FT +   AL L +K       + G+  G +G  QF+P    KYA+D 
Sbjct: 180 LATLACEPRRSNYFTIELMQALKLKEKYQFDDDTMVGSWAGAMGHTQFMPSAYAKYAVDG 239

Query: 214 DEDGKIDLVKSNIDAIASAAKFLAKLGWTK 243
           D DGK DL  S  DA+ SAA FL  LGW +
Sbjct: 240 DGDGKADLWNSTTDALTSAANFLQHLGWQR 269


>gi|304409229|ref|ZP_07390850.1| lytic murein transglycosylase [Shewanella baltica OS183]
 gi|307303232|ref|ZP_07582987.1| lytic murein transglycosylase [Shewanella baltica BA175]
 gi|304353050|gb|EFM17447.1| lytic murein transglycosylase [Shewanella baltica OS183]
 gi|306913592|gb|EFN44014.1| lytic murein transglycosylase [Shewanella baltica BA175]
          Length = 438

 Score =  136 bits (343), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 80/209 (38%), Positives = 116/209 (55%), Gaps = 6/209 (2%)

Query: 38  TADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVS--FKDYL 95
            A+ F    +  +ARA  EG+S  T     A+L+++   I  D++    P  S  F +Y 
Sbjct: 64  NAEAFPSCVTGLQARARTEGLSEATINSTIANLKFVPRVIELDQQQ---PEFSQTFDNYF 120

Query: 96  DGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTL 155
              ++   + +G  L K +S LL  L KEYGVPP  +++ WGLET++G   GK  +L++L
Sbjct: 121 SKRATEWRVNEGRRLLKKHSVLLNQLAKEYGVPPQYILSFWGLETNYGSYKGKMSVLNSL 180

Query: 156 ATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDAD 214
           ATLA + RR+ +FT +   AL L +K       + G+  G +G  QF+P    KYA+D D
Sbjct: 181 ATLACEPRRSNYFTIELMQALKLKEKYQFDDDTMVGSWAGAMGHTQFMPSAYAKYAVDGD 240

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTK 243
            DGK DL  S  DA+ SAA FL  LGW +
Sbjct: 241 GDGKADLWNSTTDALTSAANFLQHLGWQR 269


>gi|217972932|ref|YP_002357683.1| lytic murein transglycosylase [Shewanella baltica OS223]
 gi|217498067|gb|ACK46260.1| lytic murein transglycosylase [Shewanella baltica OS223]
          Length = 436

 Score =  136 bits (342), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 80/209 (38%), Positives = 116/209 (55%), Gaps = 6/209 (2%)

Query: 38  TADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVS--FKDYL 95
            A+ F    +  +ARA  EG+S  T     A+L+++   I  D++    P  S  F +Y 
Sbjct: 62  NAEAFPSCVTGLQARARTEGLSEATINSTIANLKFVPRVIELDQQQ---PEFSQTFDNYF 118

Query: 96  DGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTL 155
              ++   + +G  L K +S LL  L KEYGVPP  +++ WGLET++G   GK  +L++L
Sbjct: 119 SKRATEWRVNEGRRLLKKHSVLLNQLAKEYGVPPQYILSFWGLETNYGSYKGKMSVLNSL 178

Query: 156 ATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDAD 214
           ATLA + RR+ +FT +   AL L +K       + G+  G +G  QF+P    KYA+D D
Sbjct: 179 ATLACEPRRSNYFTIELMQALKLKEKYQFDDDTMVGSWAGAMGHTQFMPSAYAKYAVDGD 238

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTK 243
            DGK DL  S  DA+ SAA FL  LGW +
Sbjct: 239 GDGKADLWNSTTDALTSAANFLQHLGWQR 267


>gi|85860658|ref|YP_462860.1| membrane-bound lytic murein transglycosylase B [Syntrophus
           aciditrophicus SB]
 gi|85723749|gb|ABC78692.1| membrane-bound lytic murein transglycosylase B [Syntrophus
           aciditrophicus SB]
          Length = 432

 Score =  136 bits (342), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 75/195 (38%), Positives = 112/195 (57%), Gaps = 8/195 (4%)

Query: 53  AVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPP---VSFKDYLDGLSSSEIIAQGIA 109
           A+  G+S +T K     +++L+  I  DR    S P   ++F  YL+   +   + +G  
Sbjct: 67  AIESGVSSQTVKSALESIQWLEDVIRADR----SQPEFHLTFWHYLESRVTDARVERGRE 122

Query: 110 LKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFT 169
           +  A+  LL  +   YGVPP  L+ALWG+ET++G   G  PL+S LATLA   RR+  FT
Sbjct: 123 MYHAHYNLLHKIYLRYGVPPHYLVALWGMETNYGSNFGSVPLMSALATLACGRRRSNMFT 182

Query: 170 EQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDA 228
            +F  AL + + G +  + + G+  G IG  QFLP   +K+A+D+D+DG+IDL  S  DA
Sbjct: 183 REFISALLIQENGAMDLARSKGSWAGAIGHMQFLPSTCLKHAVDSDKDGRIDLFGSLPDA 242

Query: 229 IASAAKFLAKLGWTK 243
            ASAA +  + GW K
Sbjct: 243 FASAANYFHRSGWKK 257


>gi|270262198|ref|ZP_06190470.1| putative transglycosylase [Serratia odorifera 4Rx13]
 gi|270044074|gb|EFA17166.1| putative transglycosylase [Serratia odorifera 4Rx13]
          Length = 357

 Score =  136 bits (342), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 72/199 (36%), Positives = 112/199 (56%), Gaps = 2/199 (1%)

Query: 50  RARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIA 109
           + +A+ +G+S  T  + FA+  ++D  I  DR       ++  DYL  +     I QG  
Sbjct: 68  KRQALAQGISQATIDNAFANAHFVDRVIKADRNQ-PEKKITLDDYLKRVLPPAKIEQGRT 126

Query: 110 LKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFT 169
           L +     L  +   YGVP   ++ALWG+E+ FG+  G+  ++S LATLA++ RR  FFT
Sbjct: 127 LSRQYRSQLTRVTARYGVPGRYIVALWGMESAFGKIQGREDVISALATLAFEGRREAFFT 186

Query: 170 EQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDA 228
           +Q   AL +V++G + S  L G+  G +GQ QF+P + + YA D D DG+ID+  +  D 
Sbjct: 187 QQVMAALQIVEQGRVGSTQLKGSWAGAMGQCQFMPTSFLSYAADGDGDGRIDIWNNPDDV 246

Query: 229 IASAAKFLAKLGWTKCAGY 247
            AS A +LA  GW +  G+
Sbjct: 247 FASTANYLASEGWQRGIGW 265


>gi|308049439|ref|YP_003913005.1| lytic murein transglycosylase [Ferrimonas balearica DSM 9799]
 gi|307631629|gb|ADN75931.1| lytic murein transglycosylase [Ferrimonas balearica DSM 9799]
          Length = 324

 Score =  135 bits (341), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 80/208 (38%), Positives = 116/208 (55%), Gaps = 10/208 (4%)

Query: 39  ADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGL 98
           AD F ++ S  +  A  +G +P T    FAD++     I+ DR         FK  LD  
Sbjct: 22  ADGFSQYVSQLKQEAGEKGYAPATIDAAFADIKLFKRAISADRNQP-----EFKKTLDTY 76

Query: 99  SSSEI----IAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLST 154
               +    + +   L K +  LL  + K YGV P  ++ALWG+ET+FG   G  P+LST
Sbjct: 77  LPQAVPQWKVDKARKLYKEHRELLEEIGKAYGVQPRFIVALWGIETNFGGYTGNYPVLST 136

Query: 155 LATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDA 213
            A+LAY+ RR  FF EQFF A+ ++ +G IS+ A+ G+  G +GQ QF+P + + YA D 
Sbjct: 137 TASLAYEGRREDFFKEQFFAAMTILDQGHISADAMRGSWAGAMGQTQFMPTSFLSYAEDY 196

Query: 214 DEDGKIDLVKSNIDAIASAAKFLAKLGW 241
           D DG+ D+  S  D  ASAA +L+ +GW
Sbjct: 197 DGDGRKDIWGSLPDVFASAANYLSNVGW 224


>gi|262277222|ref|ZP_06055015.1| membrane-bound lytic murein transglycosylase B [alpha
           proteobacterium HIMB114]
 gi|262224325|gb|EEY74784.1| membrane-bound lytic murein transglycosylase B [alpha
           proteobacterium HIMB114]
          Length = 318

 Score =  135 bits (341), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 77/214 (35%), Positives = 119/214 (55%), Gaps = 10/214 (4%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDY 94
            S + ++F  W    +  A+ +G+S KT    F + + L   I  DR    + P  F + 
Sbjct: 12  ISKSDEKFSTWLENYKKYAINQGVSKKTVNEAFKNTKLLKRIITYDR----NQP-EFIEK 66

Query: 95  LDGLSSSEIIAQGIALKKA----NSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTP 150
            D   +  +  Q +   K     N +LL  ++K+Y +P   L+ALWG+ET FG+  GK  
Sbjct: 67  TDVYVAKRVNKQKVIYAKKLINNNKKLLDKVEKKYKIPKNYLVALWGVETVFGKHKGKVD 126

Query: 151 LLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKY 209
           ++S LATL++D RR+K+F+ +    L L+ + V++   L G+  G  G FQF+P ++  Y
Sbjct: 127 IISALATLSFDKRRSKYFSNELIILLKLIDRQVVNISDLKGSWAGAHGNFQFMPSSIKNY 186

Query: 210 AIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTK 243
           AID + DGKIDL  S  D+ ASAA +L K+GW K
Sbjct: 187 AIDYNRDGKIDLYTSLEDSFASAANYLKKIGWDK 220


>gi|319426715|gb|ADV54789.1| lytic murein transglycosylase [Shewanella putrefaciens 200]
          Length = 442

 Score =  135 bits (341), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 78/209 (37%), Positives = 116/209 (55%), Gaps = 6/209 (2%)

Query: 38  TADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVS--FKDYL 95
            AD F    +  +ARA  EG+S +T  +  A L+++   I  D++    P  S  F +Y 
Sbjct: 68  NADAFASCLTTLQARARSEGLSEETINNTVAHLQFVPRVIELDQQ---QPEFSQTFANYF 124

Query: 96  DGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTL 155
              ++   + +G  L + +  LL  L  +YGVPP  +++ WGLET++G   GK  +L +L
Sbjct: 125 TKRATDWRVNEGRRLLQKHRALLDKLSLQYGVPPQYILSFWGLETNYGSYKGKMAVLDSL 184

Query: 156 ATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDAD 214
           ATLA + RR+ +FT +   AL L +K     + + G+  G +G  QF+P    KYAID D
Sbjct: 185 ATLACEPRRSSYFTTELMQALKLKEKYQFDKNTMVGSWAGAMGHTQFMPSAYAKYAIDGD 244

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTK 243
            DGK+DL  S  DA+ SAA FL  LGW +
Sbjct: 245 GDGKVDLWNSTADALTSAANFLQNLGWQR 273


>gi|160875817|ref|YP_001555133.1| lytic murein transglycosylase [Shewanella baltica OS195]
 gi|160861339|gb|ABX49873.1| lytic murein transglycosylase [Shewanella baltica OS195]
 gi|315268008|gb|ADT94861.1| lytic murein transglycosylase [Shewanella baltica OS678]
          Length = 438

 Score =  135 bits (340), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 79/209 (37%), Positives = 116/209 (55%), Gaps = 6/209 (2%)

Query: 38  TADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVS--FKDYL 95
            A+ F    +  +ARA  EG+S  T     A+L+++   I  D++    P  S  F +Y 
Sbjct: 64  NAEAFPSCVTGLQARARTEGLSEATINSTIANLKFVPRVIELDQQQ---PEFSQTFDNYF 120

Query: 96  DGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTL 155
              ++   + +G  L + +S LL  L KEYGVPP  +++ WGLET++G   GK  +L++L
Sbjct: 121 SKRATEWRVNEGRRLLQKHSVLLNQLAKEYGVPPQYILSFWGLETNYGSYKGKMSVLNSL 180

Query: 156 ATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDAD 214
           ATLA + RR+ +FT +   AL L +K       + G+  G +G  QF+P    KYA+D D
Sbjct: 181 ATLACEPRRSNYFTIELMQALKLKEKYQFDDDTMVGSWAGAMGHTQFMPSAYAKYAVDGD 240

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTK 243
            DGK DL  S  DA+ SAA FL  LGW +
Sbjct: 241 GDGKADLWNSTTDALTSAANFLQHLGWQR 269


>gi|260432274|ref|ZP_05786245.1| peptidoglycan binding domain protein [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260416102|gb|EEX09361.1| peptidoglycan binding domain protein [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 432

 Score =  135 bits (340), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 79/221 (35%), Positives = 122/221 (55%), Gaps = 5/221 (2%)

Query: 26  PKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVT 85
           P+ A      +    RF  W  A + RAV +G+S  T     + +      I RDR    
Sbjct: 48  PRPAHGAHRVAAVNPRFEVWLGAFQRRAVSQGISQTTLDRALSGVTQDPDIIRRDRNQAE 107

Query: 86  -SPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGE 144
            S P+   +YLD   S + IA G    + + R+L  ++  YGV   +++A+WGLET FG 
Sbjct: 108 FSKPI--WEYLDSAVSDQRIADGRKALERHRRVLDRIEARYGVEKEVVVAVWGLETSFGS 165

Query: 145 TMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLP 203
             G +P + +LATLA+D RRA+FF  Q   AL +++ G +   A+ G+  G +G  QF+P
Sbjct: 166 FRGSSPTIRSLATLAFDGRRAEFFETQLLAALQILQAGDVRPEAMTGSWAGAMGHTQFMP 225

Query: 204 VNVVKYAIDADEDGKIDLVKSN-IDAIASAAKFLAKLGWTK 243
            + +++A+D D DG+ D+   +  DA+AS A +LA+ GWTK
Sbjct: 226 TSYLEHAVDFDGDGRRDIWSDDPTDALASTAAYLARFGWTK 266


>gi|167624318|ref|YP_001674612.1| lytic murein transglycosylase [Shewanella halifaxensis HAW-EB4]
 gi|167354340|gb|ABZ76953.1| lytic murein transglycosylase [Shewanella halifaxensis HAW-EB4]
          Length = 396

 Score =  135 bits (340), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 75/189 (39%), Positives = 108/189 (57%), Gaps = 2/189 (1%)

Query: 56  EGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANS 115
           +G+S +T     A+++++   I  D+K       SF++Y     +   +AQG  L + + 
Sbjct: 41  QGLSQQTIDTTLANVKFVPRVIELDKKQPEFSQ-SFENYFTKRVTDWRVAQGRKLYQEHK 99

Query: 116 RLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYA 175
            LL  L KEYG+PP  L+A WGLET+FG   GK  +L +LATLA D RR+ +FT +   A
Sbjct: 100 VLLHKLAKEYGIPPQYLLAFWGLETNFGSYKGKMSVLDSLATLACDPRRSSYFTTELMQA 159

Query: 176 LDLVKK-GVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAK 234
           L L ++     +  +G+  G +G  QF+P    KYA+D D DGK DL  S  DA+ SAA 
Sbjct: 160 LKLKERYNFAETDMVGSWAGAMGHTQFMPSAYAKYAVDGDGDGKADLWNSTEDALTSAAN 219

Query: 235 FLAKLGWTK 243
           FL  LGW +
Sbjct: 220 FLQNLGWKR 228


>gi|120598509|ref|YP_963083.1| lytic murein transglycosylase [Shewanella sp. W3-18-1]
 gi|120558602|gb|ABM24529.1| lytic murein transglycosylase [Shewanella sp. W3-18-1]
          Length = 439

 Score =  135 bits (340), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 78/209 (37%), Positives = 116/209 (55%), Gaps = 6/209 (2%)

Query: 38  TADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVS--FKDYL 95
            AD F    +  +ARA  EG+S +T  +  A L+++   I  D++    P  S  F +Y 
Sbjct: 65  NADAFASCLTTLQARARSEGLSEETINNTVAHLQFVPRVIELDQQQ---PEFSQTFANYF 121

Query: 96  DGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTL 155
              ++   + +G  L + +  LL  L  +YGVPP  +++ WGLET++G   GK  +L +L
Sbjct: 122 TKRATDWRVNEGRRLLQKHRALLDKLSLQYGVPPQYILSFWGLETNYGSYKGKMAVLDSL 181

Query: 156 ATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDAD 214
           ATLA + RR+ +FT +   AL L +K     + + G+  G +G  QF+P    KYAID D
Sbjct: 182 ATLACEPRRSSYFTTELMQALKLKEKYQFDKNTMVGSWAGAMGHTQFMPSAYAKYAIDGD 241

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTK 243
            DGK+DL  S  DA+ SAA FL  LGW +
Sbjct: 242 GDGKVDLWNSTADALTSAANFLQSLGWQR 270


>gi|114047835|ref|YP_738385.1| lytic murein transglycosylase [Shewanella sp. MR-7]
 gi|113889277|gb|ABI43328.1| lytic murein transglycosylase [Shewanella sp. MR-7]
          Length = 424

 Score =  135 bits (340), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 85/229 (37%), Positives = 122/229 (53%), Gaps = 10/229 (4%)

Query: 22  AVTQPKKATTQFICSDT----ADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTI 77
           A+ + + A  +   SDT    A+ F    +  + RA  EG+S  T K   A L+++   I
Sbjct: 30  AIAETQAAVQEMQLSDTIAAHAEAFPTCVANLQERARSEGLSEATIKDTVASLQFVPKVI 89

Query: 78  ARDRKMVTSPPVS--FKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMAL 135
             D+     P  S  F +Y    ++   + +G  L K +  LL  L +EYGVPP  +++ 
Sbjct: 90  ELDQ---AQPEFSQTFNNYFTKRATDWRVNEGRRLLKKHRALLDKLAQEYGVPPQYILSF 146

Query: 136 WGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKK-GVISSHALGATFG 194
           WGLET++G   GK  +L +LATLA + RR+ +FT +   AL L +K G      +G+  G
Sbjct: 147 WGLETNYGSYKGKMSVLDSLATLACEPRRSGYFTTELMQALKLKEKYGFDKRTMVGSWAG 206

Query: 195 EIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTK 243
            +G  QF+P    KYAID D DGK DL  S  DA+ SAA FL  LGW +
Sbjct: 207 AMGHTQFMPSAYAKYAIDGDGDGKADLWNSTEDALTSAANFLQHLGWQR 255


>gi|254477979|ref|ZP_05091364.1| peptidoglycan binding domain protein [Ruegeria sp. R11]
 gi|214028564|gb|EEB69400.1| peptidoglycan binding domain protein [Ruegeria sp. R11]
          Length = 351

 Score =  135 bits (340), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 85/247 (34%), Positives = 126/247 (51%), Gaps = 20/247 (8%)

Query: 45  WKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEII 104
           W  A + RA+  G+S  T    F    YL   I RDR   T    S +DYL   +S E +
Sbjct: 21  WVDAFKPRALAAGISQNTLNAAFRGTGYLHGVIKRDRNQ-TEFKRSLEDYLSIAASDERV 79

Query: 105 AQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRR 164
            +G A    +   L  L++ YGV   I+ A+WGLE+ FGE  G  P++S  +TLA+D RR
Sbjct: 80  GKGRAAFARHRSTLAALEQAYGVDAEIIAAIWGLESFFGERKGDVPVISATSTLAFDGRR 139

Query: 165 AKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVK 223
             FF +Q   AL ++++G I+ +   G+  G +G  QF+P +   +A+D   DGK D+  
Sbjct: 140 GAFFEKQLIAALRILQRGDITPARMTGSWAGAMGHTQFIPTSYQAFAVDFTGDGKRDIWS 199

Query: 224 SN-IDAIASAAKFLAKLGWTKCAGY-----------------QPGEKNFAILKHWNASLN 265
            +  DA+AS A +LA+ GWT+   +                 QPG   FA+  ++ A   
Sbjct: 200 EDPSDALASTAAYLARNGWTRGQAWGREITGDTSATGTVIQPQPGGPRFAVTGNFRAIKR 259

Query: 266 YNKTIAY 272
           YN + AY
Sbjct: 260 YNNSDAY 266


>gi|126174804|ref|YP_001050953.1| lytic murein transglycosylase [Shewanella baltica OS155]
 gi|125998009|gb|ABN62084.1| lytic murein transglycosylase [Shewanella baltica OS155]
          Length = 411

 Score =  135 bits (340), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 79/209 (37%), Positives = 116/209 (55%), Gaps = 6/209 (2%)

Query: 38  TADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVS--FKDYL 95
            A+ F    +  +ARA  EG+S  T     A+L+++   I  D++    P  S  F +Y 
Sbjct: 37  NAEAFPSCVTGLQARARTEGLSEATINSTIANLKFVPRVIELDQQQ---PEFSQTFDNYF 93

Query: 96  DGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTL 155
              ++   + +G  L + +S LL  L KEYGVPP  +++ WGLET++G   GK  +L++L
Sbjct: 94  SKRATEWRVNEGRRLLQKHSVLLNQLAKEYGVPPQYILSFWGLETNYGSYKGKMSVLNSL 153

Query: 156 ATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDAD 214
           ATLA + RR+ +FT +   AL L +K       + G+  G +G  QF+P    KYA+D D
Sbjct: 154 ATLACEPRRSNYFTIELMQALKLKEKYQFDDDTMVGSWAGAMGHTQFMPSAYAKYAVDGD 213

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTK 243
            DGK DL  S  DA+ SAA FL  LGW +
Sbjct: 214 GDGKADLWNSTTDALTSAANFLQHLGWQR 242


>gi|170726300|ref|YP_001760326.1| lytic murein transglycosylase [Shewanella woodyi ATCC 51908]
 gi|169811647|gb|ACA86231.1| lytic murein transglycosylase [Shewanella woodyi ATCC 51908]
          Length = 395

 Score =  135 bits (339), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 78/194 (40%), Positives = 108/194 (55%), Gaps = 6/194 (3%)

Query: 53  AVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVS--FKDYLDGLSSSEIIAQGIAL 110
           A  +G+S  T ++    ++Y+   I  D+K    P  S  F +Y     +   + +G  L
Sbjct: 37  AKSQGLSADTIENTLGKVKYVARVIELDKKQ---PEFSQTFDNYFSKRVTDWRVKEGRRL 93

Query: 111 KKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTE 170
              N  LL  LK +YGVPP  LMA WGLET+FG   GK P+L +LATLA D RR+ +FT 
Sbjct: 94  LAENRELLNQLKDKYGVPPQYLMAFWGLETNFGSYKGKMPVLDSLATLACDPRRSGYFTG 153

Query: 171 QFFYALDLVKK-GVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAI 229
           +   AL L ++    +S  +G+  G +G  QF+P     YA+D D DGK DL  S  DA+
Sbjct: 154 ELMKALKLKEEYQFEASEMVGSWAGAMGHTQFMPSAYTAYAVDGDGDGKADLWNSRADAL 213

Query: 230 ASAAKFLAKLGWTK 243
            SAA FL +LGW +
Sbjct: 214 TSAANFLQQLGWQR 227


>gi|330505009|ref|YP_004381878.1| lytic murein transglycosylase [Pseudomonas mendocina NK-01]
 gi|328919295|gb|AEB60126.1| lytic murein transglycosylase [Pseudomonas mendocina NK-01]
          Length = 418

 Score =  135 bits (339), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 81/225 (36%), Positives = 122/225 (54%), Gaps = 8/225 (3%)

Query: 22  AVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDR 81
           A T P  A  Q    +    F +W+ A R+ A+  G+       +FA +      +  D 
Sbjct: 31  AATSP--AAVQTSTEEPLTSFADWRQALRSEAIAAGIDAALFDRVFAGVTPDPAVLKADS 88

Query: 82  KM--VTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLE 139
                T P     +YLDG  SS  I +G  L   +S +L  ++++YGV   IL+A+WGLE
Sbjct: 89  SQPEFTRP---VWEYLDGAVSSSRIGRGRVLLAQHSLVLERIEQQYGVEAPILVAIWGLE 145

Query: 140 THFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQ 198
           ++FG  +G   ++ +LATLAYD RR  F+  Q   AL +++ G +SS  + G+  G +GQ
Sbjct: 146 SNFGNNIGSHSVIRSLATLAYDGRRQGFWRVQLLAALQILQNGDVSSERMIGSWAGAMGQ 205

Query: 199 FQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTK 243
            QF+P    ++A+D D DGK DL  S+ DA+ASAA +L   GW +
Sbjct: 206 TQFMPTTYNQHAVDFDGDGKRDLWGSSTDALASAAHYLQASGWQR 250


>gi|118602106|ref|YP_903321.1| lytic murein transglycosylase [Candidatus Ruthia magnifica str. Cm
           (Calyptogena magnifica)]
 gi|118567045|gb|ABL01850.1| lytic murein transglycosylase [Candidatus Ruthia magnifica str. Cm
           (Calyptogena magnifica)]
          Length = 394

 Score =  135 bits (339), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 82/236 (34%), Positives = 126/236 (53%), Gaps = 14/236 (5%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F ++ S  R +A + G+S  T  + F DL      +  DR       ++F  YL+   + 
Sbjct: 28  FEQFLSNIRFQATKLGISQTTLNNAFNDLTPNPKVLEYDRNQAEFN-LNFWRYLNLRVNQ 86

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             + +G+   +   + L    K+YGVP  I++A WGLET++G+ +GK  L+ +LATL++D
Sbjct: 87  NRLDKGMEKLQQYQKYLQENYKKYGVPSQIVVAFWGLETNYGKNVGKMHLIRSLATLSFD 146

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDL 221
            RR +FFT +    L L+ +  +  +A G+  G +G  QF+P NV  YAIDA+ DGKIDL
Sbjct: 147 KRRREFFTHELLTLLKLIDEKKLPLNAQGSWAGAMGNMQFIPTNVAAYAIDANTDGKIDL 206

Query: 222 VKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHI 277
             +  D +ASAA FL K GW +      GE+       W   +N  K   Y  A++
Sbjct: 207 WHTQADILASAAHFLKKNGWHQ------GER-------WGREVNIPKAFNYHLANL 249


>gi|146293412|ref|YP_001183836.1| lytic murein transglycosylase [Shewanella putrefaciens CN-32]
 gi|145565102|gb|ABP76037.1| lytic murein transglycosylase [Shewanella putrefaciens CN-32]
          Length = 439

 Score =  134 bits (338), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 78/209 (37%), Positives = 116/209 (55%), Gaps = 6/209 (2%)

Query: 38  TADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVS--FKDYL 95
            AD F    +  +ARA  EG+S +T  +  A L+++   I  D++    P  S  F +Y 
Sbjct: 65  NADAFASCLTTLQARARSEGLSEETINNTVAYLQFVPRVIELDQQ---QPEFSQTFANYF 121

Query: 96  DGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTL 155
              ++   + +G  L + +  LL  L  +YGVPP  +++ WGLET++G   GK  +L +L
Sbjct: 122 TKRATDWRVNEGRRLLQKHRALLDKLSLQYGVPPQYILSFWGLETNYGSYKGKMAVLDSL 181

Query: 156 ATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDAD 214
           ATLA + RR+ +FT +   AL L +K     + + G+  G +G  QF+P    KYAID D
Sbjct: 182 ATLACEPRRSSYFTTELMQALKLKEKYQFDKNTMVGSWAGAMGHTQFMPSAYAKYAIDGD 241

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTK 243
            DGK+DL  S  DA+ SAA FL  LGW +
Sbjct: 242 GDGKVDLWNSTADALTSAANFLQNLGWQR 270


>gi|227355435|ref|ZP_03839831.1| membrane-bound lytic murein transglycosylase B [Proteus mirabilis
           ATCC 29906]
 gi|227164422|gb|EEI49306.1| membrane-bound lytic murein transglycosylase B [Proteus mirabilis
           ATCC 29906]
          Length = 375

 Score =  134 bits (338), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 72/210 (34%), Positives = 114/210 (54%), Gaps = 3/210 (1%)

Query: 36  SDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYL 95
           S T  +F  +  A + +A   G  P+T    F+++ ++D  +  DR       ++   YL
Sbjct: 63  SRTPAQFPAYVDALKQKAAELGYKPETINFAFSEIHFIDRVVKSDRNQ-PEKKITLDVYL 121

Query: 96  DGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTL 155
             + +   IA+G  L +AN + L  +  +Y VP   ++ALWGLE+ FG   GK  ++S L
Sbjct: 122 PRVVTKGRIAEGAKLYQANQQTLAQISNQYDVPANYIVALWGLESGFGRVQGKEDVISAL 181

Query: 156 ATLAYDCRRAKFFTEQFFYALDLVKKG--VISSHALGATFGEIGQFQFLPVNVVKYAIDA 213
           ATLA++ RR   F+ Q   AL++++ G   +     G+  G +GQ QF+P + + YA D 
Sbjct: 182 ATLAFEGRREALFSRQLMAALEIIENGHLPVGQRLKGSWAGAMGQTQFMPSSFLTYAADG 241

Query: 214 DEDGKIDLVKSNIDAIASAAKFLAKLGWTK 243
           + DG ID+  S  DA ASAA +LA  GW +
Sbjct: 242 NGDGNIDIWNSREDAFASAANYLATEGWQR 271


>gi|120556504|ref|YP_960855.1| lytic murein transglycosylase [Marinobacter aquaeolei VT8]
 gi|120326353|gb|ABM20668.1| lytic murein transglycosylase [Marinobacter aquaeolei VT8]
          Length = 410

 Score =  134 bits (338), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 77/201 (38%), Positives = 113/201 (56%), Gaps = 2/201 (0%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F + K A   +AV  G+   T + + A + +LD  I  DR+       +F DYL+   + 
Sbjct: 38  FEQCKQALGEKAVAAGVRESTVQSVMAGVVHLDRVIELDRRQPEFT-TTFADYLNRRVND 96

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             + +G  L   + +LL  +  E GVP   L A WGLET++G   GK  + S LATLA D
Sbjct: 97  ARVGKGRELLAEHRKLLDRVTAETGVPAPYLAAFWGLETNYGSYFGKMQVPSALATLACD 156

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR+ FFTEQ+  AL ++ +G I +  + G+  G +G  QF+P   +K+A+DAD DG+ D
Sbjct: 157 ARRSSFFTEQWIAALRIIDEGAIPADQMEGSWAGAMGHVQFMPTVFLKHAVDADGDGRRD 216

Query: 221 LVKSNIDAIASAAKFLAKLGW 241
           L  S  DA+ SA +FL  +GW
Sbjct: 217 LWNSLPDAMMSAGRFLESMGW 237


>gi|332305300|ref|YP_004433151.1| lytic murein transglycosylase [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332172629|gb|AEE21883.1| lytic murein transglycosylase [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 416

 Score =  134 bits (338), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 93/295 (31%), Positives = 155/295 (52%), Gaps = 27/295 (9%)

Query: 3   FKKYLLIS----LLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGM 58
             K+L+I+    L  +  P+LAQA       T +       ++F +     + +A   G+
Sbjct: 5   LSKFLVIARWSLLGCLSTPVLAQANADTNAPTPR-------EQFAQCVVDLQQQAKSVGV 57

Query: 59  SPKTAKHLFADLEYLDTTIARDRKMVTSPPV--SFKDYLDGLSSSEIIAQGIALKKANSR 116
           S +   ++    ++ +  I+ DR     P    +F DY +   ++  I +G  +   +  
Sbjct: 58  SQRVTDNVLGKAQFKEKIISLDR---NQPEFVQTFTDYFEKRVNTWRIDKGRQMLAKHRA 114

Query: 117 LLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYAL 176
            L  L KEYGVP   L+A WGLET+FG   GK+P++ +L TLA D RR+++F+ +   AL
Sbjct: 115 FLNELNKEYGVPAQYLLAFWGLETNFGSYKGKSPVIDSLVTLACDNRRSRYFSSELMQAL 174

Query: 177 DLV-KKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKF 235
            L+ ++ +     +G+  G +G  QF+P   +KYA+D D+DG+I+L  S  DA+ASAA F
Sbjct: 175 LLIDREKLDDKQMVGSWAGAMGHTQFMPSAYMKYAVDGDKDGQINLWNSEKDALASAANF 234

Query: 236 LAKLGWTKCAGYQPGEKNFAILKHWNASL---NYNKTIAYI----AAHIDGVPIG 283
           L  LGW   AGY+ G +  ++ + ++ +L   N  KT++          DG P+G
Sbjct: 235 LKNLGWQ--AGYKWG-REVSLPESFDYTLVGKNSPKTLSVWNDAGVTRTDGKPVG 286


>gi|117920902|ref|YP_870094.1| lytic murein transglycosylase [Shewanella sp. ANA-3]
 gi|117613234|gb|ABK48688.1| lytic murein transglycosylase [Shewanella sp. ANA-3]
          Length = 430

 Score =  134 bits (337), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 85/229 (37%), Positives = 122/229 (53%), Gaps = 10/229 (4%)

Query: 22  AVTQPKKATTQFICSDT----ADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTI 77
           A+ + + A  +   SDT    A  F    +  + RA  EG+S  T +   A L+++   I
Sbjct: 36  AIAETQAAVQEMPLSDTIAAHAAAFPTCVANLQERARTEGLSEATIQDTVASLQFVPKVI 95

Query: 78  ARDRKMVTSPPVS--FKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMAL 135
             D+     P  S  F +Y    ++   + +G  L K +  LL  L +EYGVPP  +++ 
Sbjct: 96  ELDQ---AQPEFSQTFNNYFTKRATDWRVNEGRRLLKKHRALLDKLAQEYGVPPQYILSF 152

Query: 136 WGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKK-GVISSHALGATFG 194
           WGLET++G   GK  +L +LATLA + RR+ +FT +   AL L +K G   S  +G+  G
Sbjct: 153 WGLETNYGSYKGKMSVLDSLATLACEPRRSGYFTTELMQALKLKEKYGFDKSTMVGSWAG 212

Query: 195 EIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTK 243
            +G  QF+P    KYAID D DGK DL  S  DA+ SAA FL  LGW +
Sbjct: 213 AMGHTQFMPSAYAKYAIDGDGDGKADLWNSTEDALTSAANFLQHLGWQR 261


>gi|24373558|ref|NP_717601.1| membrane-bound lytic transglycolase-related protein [Shewanella
           oneidensis MR-1]
 gi|24347876|gb|AAN55045.1|AE015642_5 membrane-bound lytic transglycolase-related protein [Shewanella
           oneidensis MR-1]
          Length = 433

 Score =  134 bits (337), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 77/195 (39%), Positives = 111/195 (56%), Gaps = 6/195 (3%)

Query: 52  RAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVS--FKDYLDGLSSSEIIAQGIA 109
           RA REG+S +T  +  A L+++   I  D+   + P  S  F +Y    ++   + +G  
Sbjct: 73  RARREGLSEETINNTVASLQFVPKVIEFDQ---SQPEFSQTFTNYFTKRATDWRVNEGRR 129

Query: 110 LKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFT 169
           L K +  LL  L ++YGVPP  +++ WGLET++G   GK  +L +LATLA + RR+ +FT
Sbjct: 130 LLKKHRVLLEQLAQQYGVPPQYILSFWGLETNYGSYKGKMSVLDSLATLACEPRRSDYFT 189

Query: 170 EQFFYALDLVKK-GVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDA 228
            +   AL L +K G      +G+  G +G  QF+P    KYAID D DGK DL  S  DA
Sbjct: 190 TELMQALKLKEKYGFDKRTMVGSWAGAMGHTQFMPSAYAKYAIDGDGDGKADLWNSTEDA 249

Query: 229 IASAAKFLAKLGWTK 243
           + SAA FL  LGW +
Sbjct: 250 LTSAANFLQHLGWQR 264


>gi|56698438|ref|YP_168812.1| peptidoglycan-binding protein, putative [Ruegeria pomeroyi DSS-3]
 gi|56680175|gb|AAV96841.1| peptidoglycan-binding protein, putative [Ruegeria pomeroyi DSS-3]
          Length = 385

 Score =  134 bits (336), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 84/263 (31%), Positives = 132/263 (50%), Gaps = 29/263 (11%)

Query: 45  WKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEII 104
           W +  R+RA  +G++  T    F    ++   I RDR   T    S +DYL   +S E I
Sbjct: 49  WVAGFRSRASAQGINATTLDRAFRGAGFIPKVIERDRNQ-TEFKRSLEDYLAIAASDERI 107

Query: 105 AQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRR 164
           A G  + + +  LL  ++  YGV   I+ A+WGLE+ +G   G  P++S L+TLAYD RR
Sbjct: 108 ATGRQMLQQHGALLTRIEAHYGVDKEIVTAIWGLESRYGARRGDVPIVSALSTLAYDGRR 167

Query: 165 AKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVK 223
             FF +Q   AL +++ G  S   + G+  G +G  QF+P + + YA+D   DG+ D+  
Sbjct: 168 GAFFEKQLIAALKILQNGDTSPQNMTGSWAGAMGHTQFIPTSYLAYAVDFTGDGRRDIWS 227

Query: 224 SN-IDAIASAAKFLAKLGWTK------------------CAGYQPGE--------KNFAI 256
            +  DA+AS A +LA  GW +                   A  QP E        KNF++
Sbjct: 228 EDPTDALASTAAYLANAGWVRGQPWGGEVGSAAANSGSPSAVLQPQEPGPKIAVFKNFSV 287

Query: 257 LKHWNASLNYNKTIAYIAAHIDG 279
           +K +N S +Y   + +++  + G
Sbjct: 288 IKRYNNSDSYAIGVGHLSDRLKG 310


>gi|254511690|ref|ZP_05123757.1| peptidoglycan binding domain protein [Rhodobacteraceae bacterium
           KLH11]
 gi|221535401|gb|EEE38389.1| peptidoglycan binding domain protein [Rhodobacteraceae bacterium
           KLH11]
          Length = 344

 Score =  134 bits (336), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 82/262 (31%), Positives = 133/262 (50%), Gaps = 26/262 (9%)

Query: 45  WKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEII 104
           W +  + RA  +G+S  T    F    YL   I RDR  V     S +DYL   +S E I
Sbjct: 12  WVAGFKTRAAAQGISQTTLNRAFQGAGYLPEVIERDRNQVEFK-RSLEDYLAIAASDERI 70

Query: 105 AQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRR 164
           + G  +   ++  L  ++ +YGV   I++A+WGLE+ +G   G  P++S  +TLAYD RR
Sbjct: 71  STGKQMLARHAATLSQIEAKYGVDKEIVVAVWGLESRYGARRGDVPVISATSTLAYDGRR 130

Query: 165 AKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVK 223
             FF +Q   AL ++++G  S ++  G+  G +G  QF+P + + YA+D   DG+ D+  
Sbjct: 131 GAFFEKQLLAALQIIQEGDTSPANMTGSWAGAMGHTQFIPTSYLAYAVDFTGDGRRDIWS 190

Query: 224 SN-IDAIASAAKFLAKLGWTKCAGY------------------QPGE-----KNFAILKH 259
            +  D++AS A +LA+ GW +   +                   PG      +NF ++K 
Sbjct: 191 EDPADSLASTAAYLARAGWVRGQPWGGEVGTVSGTPVAVLQPQMPGPRIAVFRNFQVIKR 250

Query: 260 WNASLNYNKTIAYIAAHIDGVP 281
           +N S +Y   + ++A  I G P
Sbjct: 251 YNNSDSYAIGVGHLADRIAGGP 272


>gi|77464706|ref|YP_354210.1| membrane bound lytic murein transglycosylase B [Rhodobacter
           sphaeroides 2.4.1]
 gi|77389124|gb|ABA80309.1| Membrane bound lytic murein transglycosylase B [Rhodobacter
           sphaeroides 2.4.1]
          Length = 417

 Score =  134 bits (336), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 77/196 (39%), Positives = 109/196 (55%), Gaps = 3/196 (1%)

Query: 50  RARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIA 109
           R RA+  G+ P T    F DL Y    +ARDR        +  DYLD   S   IA G A
Sbjct: 55  RPRALAAGIRPATFAAAFRDLRYDADAVARDRNQAEFN-RTLWDYLDSAVSETRIAGGRA 113

Query: 110 LKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFT 169
               +  LL  ++  YGVP  I++A+WG+ET +G   G  PL+  LATLA+D RRA+FF 
Sbjct: 114 ALVQHGALLGRIEARYGVPKEIVVAVWGMETSYGTRRGDHPLVGALATLAHDGRRARFFE 173

Query: 170 EQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSN-ID 227
           EQ   AL ++  G +   A+ G+  G +G  QF+P + + +A+D   DG+ D+   +  D
Sbjct: 174 EQLIAALKILDNGDVRPEAMTGSWAGAMGHTQFMPTSYLDFAVDFTGDGRRDIWSDDPSD 233

Query: 228 AIASAAKFLAKLGWTK 243
           A+AS A +LAK GW +
Sbjct: 234 ALASTAAYLAKSGWRR 249


>gi|88703918|ref|ZP_01101633.1| membrane-bound lytic murein transglycosylase [Congregibacter
           litoralis KT71]
 gi|88701745|gb|EAQ98849.1| membrane-bound lytic murein transglycosylase [Congregibacter
           litoralis KT71]
          Length = 422

 Score =  133 bits (335), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 75/194 (38%), Positives = 111/194 (57%), Gaps = 6/194 (3%)

Query: 52  RAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPV--SFKDYLDGLSSSEIIAQGIA 109
           RA + G+       +  ++  L+  I  DRK    P    +F  Y+D   +   + +G A
Sbjct: 60  RARQAGVETSLVAAVLPEIAPLERVIELDRK---QPEFVQTFGAYVDTRVTESRVERGRA 116

Query: 110 LKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFT 169
           L   +   L  L + YGVPP  L+A WGLET+FG  +G  P L+ LATLA D RR+ FF 
Sbjct: 117 LLAKHQPFLQTLLERYGVPPRYLIAFWGLETNFGSYLGNIPTLNALATLACDPRRSDFFA 176

Query: 170 EQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDA 228
            +F  AL+L+++  +    L G+  G +G  QF+P + ++YA+D D+DG+I+L +S  DA
Sbjct: 177 GEFVNALELMEREALPLDTLRGSWAGALGHTQFMPSSYLRYAVDGDDDGRINLWESERDA 236

Query: 229 IASAAKFLAKLGWT 242
           +AS A FL  LGWT
Sbjct: 237 LASGANFLRSLGWT 250


>gi|126463546|ref|YP_001044660.1| lytic murein transglycosylase [Rhodobacter sphaeroides ATCC 17029]
 gi|126105210|gb|ABN77888.1| lytic murein transglycosylase [Rhodobacter sphaeroides ATCC 17029]
          Length = 419

 Score =  133 bits (335), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 77/196 (39%), Positives = 109/196 (55%), Gaps = 3/196 (1%)

Query: 50  RARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIA 109
           R RA+  G+ P T    F DL Y    +ARDR        +  DYLD   S   IA G A
Sbjct: 57  RPRALAAGIRPTTFAAAFRDLRYDADAVARDRNQAEFN-RTLWDYLDSAVSETRIAGGRA 115

Query: 110 LKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFT 169
               +  LL  ++  YGVP  I++A+WG+ET +G   G  PL+  LATLA+D RRA+FF 
Sbjct: 116 ALVQHGALLGRIEARYGVPKEIVVAVWGMETSYGTRRGDHPLVGALATLAHDGRRARFFE 175

Query: 170 EQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSN-ID 227
           EQ   AL ++  G +   A+ G+  G +G  QF+P + + +A+D   DG+ D+   +  D
Sbjct: 176 EQLIAALKILDNGDVRPEAMTGSWAGAMGHTQFMPTSYLDFAVDFTGDGRRDIWSDDPSD 235

Query: 228 AIASAAKFLAKLGWTK 243
           A+AS A +LAK GW +
Sbjct: 236 ALASTAAYLAKSGWRR 251


>gi|254486853|ref|ZP_05100058.1| peptidoglycan binding domain protein [Roseobacter sp. GAI101]
 gi|214043722|gb|EEB84360.1| peptidoglycan binding domain protein [Roseobacter sp. GAI101]
          Length = 386

 Score =  133 bits (335), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 85/263 (32%), Positives = 135/263 (51%), Gaps = 29/263 (11%)

Query: 45  WKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEII 104
           W +A + RA  +G+S  T +  FA   YL   + RDR   T    + +DYL   +S E +
Sbjct: 52  WVAAFKPRARAQGISDSTLRRGFAGAGYLPGVVKRDRNQ-TEFSRTLEDYLAIAASEERV 110

Query: 105 AQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRR 164
           ++G A    +   L  ++  YGV   ++ A+WGLE+ +GE  G  P++S  +TLA+D RR
Sbjct: 111 SKGRAAFARHRDTLRQIEARYGVAAEVVTAVWGLESFYGERRGNVPVISATSTLAFDGRR 170

Query: 165 AKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVK 223
             FF +Q   AL ++++G +S+  L G+  G +G  QF+P +   +A+D + DG+ D+  
Sbjct: 171 GAFFEKQLIAALKILERGDVSASGLTGSWAGAMGHTQFIPTSYQAFAVDFNGDGRRDIWS 230

Query: 224 SN-IDAIASAAKFLAKLGW-----------TKCAG-------YQPGE--------KNFAI 256
            N  D++AS A +LAK GW           T  AG        QP          +NF  
Sbjct: 231 ENPADSLASTAAYLAKSGWQSGQKWGGEMGTPAAGSATPVSVLQPDAGGPRFAVFRNFQA 290

Query: 257 LKHWNASLNYNKTIAYIAAHIDG 279
           +K +N S NY   + +++  I G
Sbjct: 291 IKRYNNSDNYAIGVGHLSDRIAG 313


>gi|254466552|ref|ZP_05079963.1| putative transglycolase [Rhodobacterales bacterium Y4I]
 gi|206687460|gb|EDZ47942.1| putative transglycolase [Rhodobacterales bacterium Y4I]
          Length = 410

 Score =  133 bits (335), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 88/250 (35%), Positives = 129/250 (51%), Gaps = 20/250 (8%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           +  W +A R+RA   G+S  T +  F    YL   I RDR   T    S +DYL    S 
Sbjct: 76  YDRWVAAFRSRAEARGISQFTLRAAFRGAGYLPGVIKRDRNQ-TEFKRSLEDYLSIAVSD 134

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
           E +A+G A    +   L  L++ YGV   I+ A+WGLE+ FGE  G  P++S  +TLAYD
Sbjct: 135 ERLAKGRAAFARHGATLQALERAYGVDAEIICAIWGLESFFGERRGDVPVISATSTLAYD 194

Query: 162 CRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR  FF +Q   AL++++ G I+ +   G+  G +G  QF+P +   +A+D   DG+ D
Sbjct: 195 GRRGAFFEKQLLAALNILQSGDITPARMTGSWAGAMGHTQFIPTSYQAFAVDFTGDGRRD 254

Query: 221 LVKSN-IDAIASAAKFLAKLGWTKC-------------AGY----QPGEKNFAILKHWNA 262
           +   +  DA+AS A +L + GWT+              AG     Q G   FA+  ++NA
Sbjct: 255 IWSEDPSDALASTAAYLQRNGWTRGLKWGGEAGAPGTPAGRILQPQAGGPKFAVTSNFNA 314

Query: 263 SLNYNKTIAY 272
              YN + AY
Sbjct: 315 IKRYNNSDAY 324


>gi|86138137|ref|ZP_01056712.1| peptidoglycan-binding protein, putative [Roseobacter sp. MED193]
 gi|85825164|gb|EAQ45364.1| peptidoglycan-binding protein, putative [Roseobacter sp. MED193]
          Length = 394

 Score =  133 bits (335), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 85/267 (31%), Positives = 139/267 (52%), Gaps = 24/267 (8%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           + +W      RA  +G++  T +  F +  YL   + RDR   T    + +DYL    S 
Sbjct: 62  YDKWVEGFYTRAQAKGITEATLRTGFRNAGYLPGVVKRDRNQ-TEFKRTLEDYLSIAVSD 120

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
           E +++G A  + + + L+ L+ +YGV   I+ A+WGLE+ +GE  G  P++S  +TLAYD
Sbjct: 121 ERVSKGRAAYQKHRKTLLALEAKYGVDASIIAAIWGLESFYGERRGDLPVVSATSTLAYD 180

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR  FF +Q   AL +++ G IS++ + G+  G +G  QF+P +   +A+D   DG+ D
Sbjct: 181 GRRGAFFEKQLIAALKILQNGDISANKMTGSWAGAMGHTQFIPTSYQAFAVDFTGDGRRD 240

Query: 221 LVKSN-IDAIASAAKFLAKLGWTKCAGY---------------QPGEKNFAILKHWNASL 264
           +   +  DA+AS A +LA+ GWT+   +               Q G  +FA+  ++ A  
Sbjct: 241 IWSEDPTDALASTAAYLARNGWTRGQSWGREVTGAAAAGALQPQAGGPSFAVTGNFKAIK 300

Query: 265 NYNKTIAY------IAAHIDGVPIGKG 285
            YN + AY      +A  I G P  +G
Sbjct: 301 RYNNSDAYAIGVGHLADRIAGGPPLRG 327


>gi|88857332|ref|ZP_01131975.1| putative periplasmic lytic murein transglycosylase
           [Pseudoalteromonas tunicata D2]
 gi|88820529|gb|EAR30341.1| putative periplasmic lytic murein transglycosylase
           [Pseudoalteromonas tunicata D2]
          Length = 341

 Score =  133 bits (334), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 75/216 (34%), Positives = 121/216 (56%), Gaps = 6/216 (2%)

Query: 30  TTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPV 89
           T+    ++  D+F  + +A +  A  +G S    +  FA +++ +  I+ D+     P V
Sbjct: 17  TSAVHATEQHDKFNHYVAALKQEAALKGYSNDLIEQAFATVQFKEKVISADK---NQPEV 73

Query: 90  --SFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMG 147
             + + YL        I +   L + N  LL ++ KEYGV    ++ALWGLE++FG+  G
Sbjct: 74  KETLETYLPKRVPQWKIDKARRLYQENKPLLDDIAKEYGVQARFIVALWGLESNFGKIQG 133

Query: 148 KTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNV 206
             P++S+L TLA+D RR + +  Q + ALD++K G I   H  G+  G +GQ QF+P + 
Sbjct: 134 SFPVVSSLVTLAFDGRREEMYKNQLWAALDILKDGHIDIDHFKGSWAGAMGQTQFMPTSF 193

Query: 207 VKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWT 242
           V YA+D D+DGK D+ ++  DA AS A +L + GW 
Sbjct: 194 VAYAVDYDKDGKKDIWQNQKDAFASIANYLKQAGWN 229


>gi|192361979|ref|YP_001980771.1| peptidoglycan lytic transglycosylase [Cellvibrio japonicus Ueda107]
 gi|190688144|gb|ACE85822.1| peptidoglycan lytic transglycosylase, putative, plt103B [Cellvibrio
           japonicus Ueda107]
          Length = 434

 Score =  133 bits (334), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 78/187 (41%), Positives = 110/187 (58%), Gaps = 7/187 (3%)

Query: 89  VSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGK 148
            +F DY +   +++ +AQG AL  A+  LL  +++ YGVP   L+A WGLET+FG   G 
Sbjct: 108 TTFADYFNRRVTAQRVAQGRALWAAHRPLLDRIEQAYGVPAPYLLAFWGLETNFGSYFGN 167

Query: 149 TPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVV 207
            P++ +LATLA D RR+ FFT +   AL +V++G I+   + G+  G +G FQF+P   +
Sbjct: 168 IPVMDSLATLACDTRRSGFFTIELMNALRIVEQGDIAPKKMVGSWAGAMGNFQFMPSAYL 227

Query: 208 KYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEK---NFAILKHWNASL 264
           K A+D D D K DL  S  DA+ASAA FL  LGW     +    K   NF  L+   A L
Sbjct: 228 KNAVDFDGDNKRDLWHSKPDAMASAAHFLRNLGWVSAERWGREVKLPRNFPFLE---AGL 284

Query: 265 NYNKTIA 271
             +K+IA
Sbjct: 285 KNHKSIA 291


>gi|91775566|ref|YP_545322.1| lytic murein transglycosylase [Methylobacillus flagellatus KT]
 gi|91709553|gb|ABE49481.1| Lytic murein transglycosylase [Methylobacillus flagellatus KT]
          Length = 417

 Score =  133 bits (334), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 76/206 (36%), Positives = 118/206 (57%), Gaps = 8/206 (3%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPP---VSFKDYLDGL 98
           F EW       A+ +G+S  T +   AD E     IAR  ++  + P    +F +YL+  
Sbjct: 29  FDEWMQDFNRDALSQGISETTLQAALADAE----PIARVVELDQAQPEFVQTFLNYLNRR 84

Query: 99  SSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATL 158
            + + IA+G AL +    LL +++++YGVP  IL+A WGLET++G+T+G       LATL
Sbjct: 85  VTPKQIARGQALLQEQEHLLRSVEQQYGVPAAILLAFWGLETNYGQTLGGFSTPQALATL 144

Query: 159 AYDCRRAKFFTEQFFYALDLVKKGVISS-HALGATFGEIGQFQFLPVNVVKYAIDADEDG 217
           AY+ RR  FF  Q   AL ++  G I + + +G+  G IG  QF+P   + YA D D DG
Sbjct: 145 AYEGRRHAFFRSQLLDALRIIDAGHIEAGNMVGSWAGAIGHMQFMPSTFLAYAEDGDGDG 204

Query: 218 KIDLVKSNIDAIASAAKFLAKLGWTK 243
           +I++ +S  DA+ SA ++L  +GW +
Sbjct: 205 RINVWQSIPDAMVSAGRYLHSIGWRR 230


>gi|332559599|ref|ZP_08413921.1| membrane bound lytic murein transglycosylase B [Rhodobacter
           sphaeroides WS8N]
 gi|332277311|gb|EGJ22626.1| membrane bound lytic murein transglycosylase B [Rhodobacter
           sphaeroides WS8N]
          Length = 417

 Score =  132 bits (333), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 77/194 (39%), Positives = 108/194 (55%), Gaps = 3/194 (1%)

Query: 50  RARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIA 109
           R RA+  G+ P T    F DL Y    +ARDR        +  DYLD   S   IA G A
Sbjct: 55  RPRALAAGIRPTTFAAAFRDLRYDADAVARDRNQAEFN-RTLWDYLDSAVSETRIAGGRA 113

Query: 110 LKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFT 169
               +  LL  ++  YGVP  I++A+WG+ET +G   G  PL+  LATLA+D RRA+FF 
Sbjct: 114 ALVQHGALLGRIEARYGVPKEIVVAVWGMETSYGTRRGDHPLVGALATLAHDGRRARFFE 173

Query: 170 EQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSN-ID 227
           EQ   AL ++  G +   A+ G+  G +G  QF+P + + +A+D   DG+ D+   +  D
Sbjct: 174 EQLIAALKILDNGDVRPEAMTGSWAGAMGHTQFMPTSYLDFAVDFTGDGRRDIWSDDPSD 233

Query: 228 AIASAAKFLAKLGW 241
           A+AS A +LAK GW
Sbjct: 234 ALASTAAYLAKSGW 247


>gi|221640620|ref|YP_002526882.1| Lytic murein transglycosylase [Rhodobacter sphaeroides KD131]
 gi|221161401|gb|ACM02381.1| Lytic murein transglycosylase precursor [Rhodobacter sphaeroides
           KD131]
          Length = 417

 Score =  132 bits (333), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 77/194 (39%), Positives = 108/194 (55%), Gaps = 3/194 (1%)

Query: 50  RARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIA 109
           R RA+  G+ P T    F DL Y    +ARDR        +  DYLD   S   IA G A
Sbjct: 55  RPRALAAGIRPATFAAAFRDLRYDADAVARDRNQAEFN-RTLWDYLDSAVSETRIAGGRA 113

Query: 110 LKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFT 169
               +  LL  ++  YGVP  I++A+WG+ET +G   G  PL+  LATLA+D RRA+FF 
Sbjct: 114 ALVQHGALLGRIEGRYGVPKEIVVAVWGMETSYGTRRGDHPLVGALATLAHDGRRARFFE 173

Query: 170 EQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSN-ID 227
           EQ   AL ++  G +   A+ G+  G +G  QF+P + + +A+D   DG+ D+   +  D
Sbjct: 174 EQLIAALKILDNGDVRPEAMTGSWAGAMGHTQFMPTSYLDFAVDFTGDGRRDIWSDDPSD 233

Query: 228 AIASAAKFLAKLGW 241
           A+AS A +LAK GW
Sbjct: 234 ALASTAAYLAKSGW 247


>gi|253996956|ref|YP_003049020.1| lytic murein transglycosylase [Methylotenera mobilis JLW8]
 gi|253983635|gb|ACT48493.1| lytic murein transglycosylase [Methylotenera mobilis JLW8]
          Length = 443

 Score =  132 bits (333), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 78/205 (38%), Positives = 107/205 (52%), Gaps = 6/205 (2%)

Query: 40  DRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKM--VTSPPVSFKDYLDG 97
           + F  W    R  A   GM+  T     +   YL   I  DR      SP   F DY   
Sbjct: 30  EDFATWLENIRFEAKALGMADDTTLGFVSRTAYLPNVIKLDRAQPEFISP---FLDYFAQ 86

Query: 98  LSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLAT 157
              ++ + +G AL   +  LL  ++ +YGVP  IL+A WG+ET +G   G   +LS LAT
Sbjct: 87  RVDNKKVQKGRALLLKHQALLTEIEAQYGVPRQILIAFWGMETQYGRVQGNLDVLSALAT 146

Query: 158 LAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADED 216
           LAY+ RRA FF  Q   AL +V  G + + +  G+  G  G  QF+P   + YA+D D D
Sbjct: 147 LAYEGRRADFFKAQLLDALLMVDLGYVDAESFKGSWAGAFGNMQFMPTTFMLYAVDGDAD 206

Query: 217 GKIDLVKSNIDAIASAAKFLAKLGW 241
           G ID++ S  DA ASAA +LA++GW
Sbjct: 207 GAIDVINSLPDAFASAAHYLAEIGW 231


>gi|285018691|ref|YP_003376402.1| lytic murein transglycosylase precursor transmembrane protein
           [Xanthomonas albilineans GPE PC73]
 gi|283473909|emb|CBA16410.1| probable lytic murein transglycosylase precursor transmembrane
           protein [Xanthomonas albilineans]
          Length = 425

 Score =  132 bits (331), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 84/248 (33%), Positives = 131/248 (52%), Gaps = 4/248 (1%)

Query: 26  PKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVT 85
           P  AT Q     TA  F +W +  R RA+  G+   T    FA +    +  A D++   
Sbjct: 37  PTTATAQQKPLPTAS-FEQWLADFRQRALAAGIEATTLDKAFAGVTPDPSVQALDQQQPE 95

Query: 86  SPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGET 145
              ++  DYLDG  +  II +G  L K+N  L   L+++YGV PGIL A+W +E+ +G+ 
Sbjct: 96  FT-LALWDYLDGRITPSIIQKGQQLLKSNHALFQKLRQQYGVDPGILTAIWSMESEYGKN 154

Query: 146 MGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVK--KGVISSHALGATFGEIGQFQFLP 203
           +G   ++ +LATLA++ RR  +   Q   AL +++  KG+  S  +G+  G +GQ QF+P
Sbjct: 155 IGDLYVIRSLATLAHEGRRTTYGNTQLLAALQILQTEKGIDRSRLIGSWAGAMGQTQFIP 214

Query: 204 VNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNAS 263
               +YA+D D D K D+  S+ DA+ SAA +L +  WT+   +       A   +  A 
Sbjct: 215 TTYREYAVDEDGDHKRDVWNSDADALGSAANYLKQSNWTRDIPWGQEVHLPAGFDYAQAD 274

Query: 264 LNYNKTIA 271
           L   KT+A
Sbjct: 275 LTIKKTVA 282


>gi|157370994|ref|YP_001478983.1| lytic murein transglycosylase [Serratia proteamaculans 568]
 gi|157322758|gb|ABV41855.1| lytic murein transglycosylase [Serratia proteamaculans 568]
          Length = 346

 Score =  132 bits (331), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 71/197 (36%), Positives = 114/197 (57%), Gaps = 4/197 (2%)

Query: 52  RAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALK 111
           +A+ +G+SP      FA++ ++D  I  DR       ++  DYL  +     IAQG AL 
Sbjct: 61  QALAQGISPAIVASAFANVHFVDRVIKADRNQ-PEKKITLDDYLKRVLPPAKIAQGRALY 119

Query: 112 KANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQ 171
           +     L  +   YGVP   ++ALWG+E+ FG+  G+  ++S LATLA++ RR  FF++Q
Sbjct: 120 RQYQPQLSRVTAHYGVPGRYVVALWGMESAFGKIQGREDVISALATLAFEGRREAFFSQQ 179

Query: 172 FFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIA 230
              AL ++++G +S   L G+  G +GQ QF+P + + YA  AD DG+ID+  +  D  A
Sbjct: 180 LMAALRILEQGHVSREQLKGSWAGAMGQCQFMPTSFLNYA--ADGDGRIDIWNNVDDVFA 237

Query: 231 SAAKFLAKLGWTKCAGY 247
           S A++L++ GW    G+
Sbjct: 238 STARYLSREGWQPGVGW 254


>gi|226329917|ref|ZP_03805435.1| hypothetical protein PROPEN_03830 [Proteus penneri ATCC 35198]
 gi|225200712|gb|EEG83066.1| hypothetical protein PROPEN_03830 [Proteus penneri ATCC 35198]
          Length = 376

 Score =  132 bits (331), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 72/206 (34%), Positives = 117/206 (56%), Gaps = 3/206 (1%)

Query: 38  TADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDG 97
           T+ +F  +  A + +A + G  P+T    F++  +++  I  DR       ++   YL  
Sbjct: 65  TSAQFPAYVDALKLKAAQLGYKPETIDFAFSEAHFIERVIKSDRNQ-PEKRITLDVYLPR 123

Query: 98  LSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLAT 157
           + ++  ++QG  L + +   L  + K+YGVP   ++ALWGLE+ FG+  GK  ++S LAT
Sbjct: 124 IVTNGRLSQGAKLYQEHQDTLEQISKKYGVPANYIVALWGLESGFGKVQGKEDVVSALAT 183

Query: 158 LAYDCRRAKFFTEQFFYALDLVKKGVI--SSHALGATFGEIGQFQFLPVNVVKYAIDADE 215
           LA++ RR   FT Q   AL+++++G I       G+  G +GQ QF+P + + YA D + 
Sbjct: 184 LAFEGRREALFTRQLMAALEIIEEGHIPQGQRLKGSWAGAMGQTQFMPSSFLTYAADGNG 243

Query: 216 DGKIDLVKSNIDAIASAAKFLAKLGW 241
           DGKID+  +  DA ASAA +LA  GW
Sbjct: 244 DGKIDIWNTQEDAFASAANYLATEGW 269


>gi|109899737|ref|YP_662992.1| lytic murein transglycosylase [Pseudoalteromonas atlantica T6c]
 gi|109702018|gb|ABG41938.1| lytic murein transglycosylase [Pseudoalteromonas atlantica T6c]
          Length = 428

 Score =  132 bits (331), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 82/236 (34%), Positives = 125/236 (52%), Gaps = 20/236 (8%)

Query: 20  AQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIAR 79
           AQ V  P+    Q +     D  G+ K+A        G+S +    +     Y +  I+ 
Sbjct: 43  AQEVASPQALFAQCVV----DLQGQAKTA--------GVSKRVTDEVLGGARYKEKIISL 90

Query: 80  DRKMVTSPPV--SFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWG 137
           DR     P    +F DY +   ++  I +G  +   +   L  L KEYGVP   L+A WG
Sbjct: 91  DR---NQPEFVQTFTDYFEKRVNTWRIEKGQQMMAKHRAFLGELNKEYGVPAQYLLAFWG 147

Query: 138 LETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEI 196
           LET+FG   GK+P++ +L TLA D RR+++F+ +   AL L+ +  +    + G+  G +
Sbjct: 148 LETNFGSYKGKSPVIDSLVTLACDNRRSRYFSSELMQALLLIDREKLDDKKMVGSWAGAM 207

Query: 197 GQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEK 252
           G  QF+P   +KYA+D D+DG+I+L  S  DA+ASAA FL  LGW   +GY+ G +
Sbjct: 208 GHTQFMPSAYMKYAVDGDKDGQINLWDSEQDALASAANFLKNLGWQ--SGYKWGRE 261


>gi|317050819|ref|YP_004111935.1| lytic murein transglycosylase [Desulfurispirillum indicum S5]
 gi|316945903|gb|ADU65379.1| lytic murein transglycosylase [Desulfurispirillum indicum S5]
          Length = 415

 Score =  132 bits (331), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 78/220 (35%), Positives = 117/220 (53%), Gaps = 9/220 (4%)

Query: 23  VTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRK 82
           V QP +A+T       A  F    S  R +A+  G +  T   + + + +    +  DR 
Sbjct: 18  VHQPVQAST-------AQDFDACLSHLRTKALDAGHAHDTLNQVLSSVTFNQRIVELDRS 70

Query: 83  MVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHF 142
                  +F  YLD   S + + +G  L + +  LL  +  EYGV P  ++A WG+ET+F
Sbjct: 71  QAEFTE-TFLQYLDRRVSVDRVEKGRQLLREHRVLLQRIADEYGVRPEYIIAFWGMETNF 129

Query: 143 GETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQF 201
           G   GKTP+   + TLA D RR +FFT QFF AL ++++G I    + G+  G +G  QF
Sbjct: 130 GTYFGKTPVFDAVVTLACDGRRGEFFTNQFFSALRILEEGHIDMEQMKGSWAGAMGHTQF 189

Query: 202 LPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
           +P   + YA+D D +G+ DL  S  DA ASAA +L+ +GW
Sbjct: 190 MPSTFLSYAVDYDGNGRKDLWNSLPDAFASAANYLSAMGW 229


>gi|322832725|ref|YP_004212752.1| lytic murein transglycosylase [Rahnella sp. Y9602]
 gi|321167926|gb|ADW73625.1| lytic murein transglycosylase [Rahnella sp. Y9602]
          Length = 391

 Score =  131 bits (330), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 71/199 (35%), Positives = 111/199 (55%), Gaps = 2/199 (1%)

Query: 50  RARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIA 109
           +A+A+ +G+  +T    FA++ ++D  I  DR  +    ++  DYL  +     I QG  
Sbjct: 70  KAQALSQGIRQQTIDSTFANIHFVDRVINSDRNQLEKK-ITLDDYLTRVLPEWKIKQGQE 128

Query: 110 LKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFT 169
             ++N   L    + YGV P  ++ALW +E+ FG+  GK  + S LATLA++ RR  FFT
Sbjct: 129 QLQSNLPALTKASERYGVQPQYIVALWAMESSFGKIQGKEDVFSALATLAFEGRREAFFT 188

Query: 170 EQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDA 228
           ++F  AL +V  G  +S  + G+  G +GQ QF+P + + Y  D + DGKID+  +  D 
Sbjct: 189 KEFMSALKIVDSGKATSDMMKGSWAGAMGQSQFMPSSYLTYGADGNGDGKIDIWANTDDV 248

Query: 229 IASAAKFLAKLGWTKCAGY 247
            AS A +LAK GW    G+
Sbjct: 249 FASTANYLAKEGWKGDQGW 267


>gi|167424561|ref|ZP_02316314.1| transglycosylase [Yersinia pestis biovar Mediaevalis str. K1973002]
 gi|270490813|ref|ZP_06207887.1| lytic murein transglycosylase [Yersinia pestis KIM D27]
 gi|294503856|ref|YP_003567918.1| putative lipoprotein [Yersinia pestis Z176003]
 gi|167056443|gb|EDR66212.1| transglycosylase [Yersinia pestis biovar Mediaevalis str. K1973002]
 gi|262362025|gb|ACY58746.1| putative lipoprotein [Yersinia pestis D106004]
 gi|270339317|gb|EFA50094.1| lytic murein transglycosylase [Yersinia pestis KIM D27]
 gi|294354315|gb|ADE64656.1| putative lipoprotein [Yersinia pestis Z176003]
 gi|320015239|gb|ADV98810.1| putative lipoprotein [Yersinia pestis biovar Medievalis str. Harbin
           35]
          Length = 309

 Score =  131 bits (329), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 69/199 (34%), Positives = 113/199 (56%), Gaps = 2/199 (1%)

Query: 50  RARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIA 109
           +A+A  +G + +T    FA++ ++D  I  DR  +    ++  DYL  +   + I QG A
Sbjct: 20  KAQARAKGYTTETLDTAFANIHFVDRVIKSDRNQL-EKKITLDDYLTRVLPRKRIEQGRA 78

Query: 110 LKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFT 169
           L +     L  +  +YGVP   ++ALWG+E+ FG+  GK  ++S L+TLA++ RR  FFT
Sbjct: 79  LYQRYQPQLSQVNAQYGVPGRYIVALWGMESAFGQIQGKEDVISALSTLAFEGRREAFFT 138

Query: 170 EQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDA 228
           ++   AL+++ +G +    L G+  G +GQ QF+P + + Y  D D DGKID+  +  D 
Sbjct: 139 KELMAALEIIHQGKVDDPQLRGSWAGAMGQSQFMPSSFLTYGADGDSDGKIDIWNNIDDV 198

Query: 229 IASAAKFLAKLGWTKCAGY 247
            AS A +L+  GW    G+
Sbjct: 199 FASTANYLSTQGWKSEQGW 217


>gi|85704443|ref|ZP_01035545.1| peptidoglycan binding domain protein [Roseovarius sp. 217]
 gi|85670851|gb|EAQ25710.1| peptidoglycan binding domain protein [Roseovarius sp. 217]
          Length = 405

 Score =  131 bits (329), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 76/226 (33%), Positives = 119/226 (52%), Gaps = 12/226 (5%)

Query: 25  QPKKATTQFICSDTADR-FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKM 83
           +P+      I   +A+  F  W +  R RAV +G++ +     F  + +    +A+DR  
Sbjct: 19  RPETQGNAVIVQASANPGFDNWIAGFRGRAVAQGVNGQVFDRAFRGVTFNPEIVAKDRNQ 78

Query: 84  VTSPPVSFK----DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLE 139
                  FK    DYLD   S   +  G    + N R L  ++  YGV   ++ A+WG+E
Sbjct: 79  S-----EFKREIWDYLDSAVSPVRVKNGEEAVRRNRRALDRIEAHYGVEKEVVAAVWGME 133

Query: 140 THFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQ 198
           + +GE +G  PL+ +LATLAYD RR  FF +Q   AL +++ G ++   + G+  G +G 
Sbjct: 134 STYGERLGDLPLIQSLATLAYDGRRGAFFEKQLIAALQILQSGDVTPENMKGSWAGAMGH 193

Query: 199 FQFLPVNVVKYAIDADEDGKIDLVKSN-IDAIASAAKFLAKLGWTK 243
            QF+P + + YA+D   DGK D+   N  DA+AS A +L + GWTK
Sbjct: 194 TQFIPTSYLAYAVDFTGDGKRDIWSDNPTDALASTAAYLKRFGWTK 239


>gi|126740201|ref|ZP_01755890.1| peptidoglycan-binding protein, putative [Roseobacter sp. SK209-2-6]
 gi|126718656|gb|EBA15369.1| peptidoglycan-binding protein, putative [Roseobacter sp. SK209-2-6]
          Length = 382

 Score =  131 bits (329), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 84/246 (34%), Positives = 125/246 (50%), Gaps = 19/246 (7%)

Query: 45  WKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEII 104
           W ++ + RA   G+S  T +  F    YL   I RDR   T    + +DYL    S E +
Sbjct: 52  WVASFQGRAQAAGISDATFRAAFRGAGYLPGVIKRDRNQ-TEFKRTLEDYLSIAVSDERL 110

Query: 105 AQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRR 164
            +G A  + +   L  L+ EYGV   I+ A+WGLE+ +GE  G  P++S  +TLAYD RR
Sbjct: 111 TKGRAAYQRHGGTLRRLEAEYGVAAEIITAIWGLESFYGERRGDVPVISATSTLAYDGRR 170

Query: 165 AKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVK 223
             FF +Q   AL +++ G IS +   G+  G +G  QF+P +   YA+D   DG+ D+  
Sbjct: 171 GSFFEKQLIAALKILQNGDISPARMTGSWAGAMGHTQFIPTSYQAYAVDFTGDGRRDIWS 230

Query: 224 SN-IDAIASAAKFLAKLGWTKCAGY----------------QPGEKNFAILKHWNASLNY 266
            +  DA+AS A +LA+ GWT+   +                Q G   FA+  ++ A   Y
Sbjct: 231 EDPSDALASTAAYLARNGWTRGLRWGGEAGAGAPSGTVIQPQEGGPKFAVTSNFRAIKRY 290

Query: 267 NKTIAY 272
           N + AY
Sbjct: 291 NNSDAY 296


>gi|153947335|ref|YP_001400981.1| lytic murein transglycosylase [Yersinia pseudotuberculosis IP
           31758]
 gi|152958830|gb|ABS46291.1| lytic murein transglycosylase [Yersinia pseudotuberculosis IP
           31758]
          Length = 362

 Score =  131 bits (329), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 69/199 (34%), Positives = 113/199 (56%), Gaps = 2/199 (1%)

Query: 50  RARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIA 109
           +A+A  +G + +T    FA++ ++D  I  DR  +    ++  DYL  +   + I QG A
Sbjct: 73  KAQARAKGYTTETLDTAFANIHFVDRVIKSDRNQL-EKKITLDDYLTRVLPRKRIEQGRA 131

Query: 110 LKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFT 169
           L +     L  +  +YGVP   ++ALWG+E+ FG+  GK  ++S L+TLA++ RR  FFT
Sbjct: 132 LYQRYQPQLSQVNAQYGVPGRYIVALWGMESAFGQIQGKEDVISALSTLAFEGRREAFFT 191

Query: 170 EQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDA 228
           ++   AL+++ +G +    L G+  G +GQ QF+P + + Y  D D DGKID+  +  D 
Sbjct: 192 KELMAALEIIHQGKVDDPQLRGSWAGAMGQSQFMPSSFLTYGADGDSDGKIDIWNNIDDV 251

Query: 229 IASAAKFLAKLGWTKCAGY 247
            AS A +L+  GW    G+
Sbjct: 252 FASTANYLSTQGWKSEQGW 270


>gi|51596389|ref|YP_070580.1| lipoprotein [Yersinia pseudotuberculosis IP 32953]
 gi|186895432|ref|YP_001872544.1| lytic murein transglycosylase [Yersinia pseudotuberculosis PB1/+]
 gi|51589671|emb|CAH21301.1| putative lipoprotein [Yersinia pseudotuberculosis IP 32953]
 gi|186698458|gb|ACC89087.1| lytic murein transglycosylase [Yersinia pseudotuberculosis PB1/+]
          Length = 361

 Score =  131 bits (329), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 69/199 (34%), Positives = 113/199 (56%), Gaps = 2/199 (1%)

Query: 50  RARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIA 109
           +A+A  +G + +T    FA++ ++D  I  DR  +    ++  DYL  +   + I QG A
Sbjct: 72  KAQARAKGYTTETLDTAFANIHFVDRVIKSDRNQL-EKKITLDDYLTRVLPRKRIEQGRA 130

Query: 110 LKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFT 169
           L +     L  +  +YGVP   ++ALWG+E+ FG+  GK  ++S L+TLA++ RR  FFT
Sbjct: 131 LYQRYQPQLSQVNAQYGVPGRYIVALWGMESAFGQIQGKEDVISALSTLAFEGRREAFFT 190

Query: 170 EQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDA 228
           ++   AL+++ +G +    L G+  G +GQ QF+P + + Y  D D DGKID+  +  D 
Sbjct: 191 KELMAALEIIHQGKVDDPQLRGSWAGAMGQSQFMPSSFLTYGADGDSDGKIDIWNNIDDV 250

Query: 229 IASAAKFLAKLGWTKCAGY 247
            AS A +L+  GW    G+
Sbjct: 251 FASTANYLSTQGWKSEQGW 269


>gi|163732767|ref|ZP_02140212.1| peptidoglycan binding domain protein [Roseobacter litoralis Och
           149]
 gi|161394127|gb|EDQ18451.1| peptidoglycan binding domain protein [Roseobacter litoralis Och
           149]
          Length = 376

 Score =  130 bits (328), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 83/258 (32%), Positives = 130/258 (50%), Gaps = 24/258 (9%)

Query: 45  WKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEII 104
           W +  + RA   G+S  T +  F    YL   + RDR   T    S +DYL    S E +
Sbjct: 48  WVANFQQRARTAGISDDTLRRAFQGTGYLPGVVRRDRNQ-TEFKRSLEDYLSIAVSDERV 106

Query: 105 AQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRR 164
           AQG   ++  + +L  L+  YGV   I+ A+WGLE+ +G   G  P++S  +TLA+D RR
Sbjct: 107 AQGRDARRQYASVLETLEARYGVDANIITAIWGLESFYGARRGNVPVVSATSTLAFDGRR 166

Query: 165 AKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVK 223
             FF +Q   AL +V+ G I++  L G+  G +G  QF+P +   +A+D   DG+ D+  
Sbjct: 167 GAFFEKQLIEALRIVQSGDITADRLVGSWAGAMGHTQFIPTSYQAFAVDFTGDGRRDIWS 226

Query: 224 SN-IDAIASAAKFLAKLGWTKCAGY-------------QPGE--------KNFAILKHWN 261
            +  DA+ASAA +L + GW +   +             QP E        +NF ++K +N
Sbjct: 227 DDPSDALASAAAYLERNGWVRGQRWGNEVTGASSGTIIQPQENGPRFAVNQNFRVIKRYN 286

Query: 262 ASLNYNKTIAYIAAHIDG 279
            S  Y   + +++  I G
Sbjct: 287 NSDAYAIGVGHLSDRIAG 304


>gi|22126116|ref|NP_669539.1| transglycosylase [Yersinia pestis KIM 10]
 gi|162420009|ref|YP_001606819.1| lytic murein transglycosylase [Yersinia pestis Angola]
 gi|165928356|ref|ZP_02224188.1| lytic murein transglycosylase [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|165939357|ref|ZP_02227905.1| lytic murein transglycosylase [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|166009157|ref|ZP_02230055.1| lytic murein transglycosylase [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|167401500|ref|ZP_02306997.1| lytic murein transglycosylase [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167420281|ref|ZP_02312034.1| lytic murein transglycosylase [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|21959075|gb|AAM85790.1|AE013826_2 putative transglycosylase [Yersinia pestis KIM 10]
 gi|162352824|gb|ABX86772.1| lytic murein transglycosylase [Yersinia pestis Angola]
 gi|165912698|gb|EDR31327.1| lytic murein transglycosylase [Yersinia pestis biovar Orientalis
           str. IP275]
 gi|165919639|gb|EDR36972.1| lytic murein transglycosylase [Yersinia pestis biovar Orientalis
           str. F1991016]
 gi|165991712|gb|EDR44013.1| lytic murein transglycosylase [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166961976|gb|EDR57997.1| lytic murein transglycosylase [Yersinia pestis biovar Orientalis
           str. MG05-1020]
 gi|167049196|gb|EDR60604.1| lytic murein transglycosylase [Yersinia pestis biovar Antiqua str.
           UG05-0454]
          Length = 362

 Score =  130 bits (328), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 69/199 (34%), Positives = 113/199 (56%), Gaps = 2/199 (1%)

Query: 50  RARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIA 109
           +A+A  +G + +T    FA++ ++D  I  DR  +    ++  DYL  +   + I QG A
Sbjct: 73  KAQARAKGYTTETLDTAFANIHFVDRVIKSDRNQL-EKKITLDDYLTRVLPRKRIEQGRA 131

Query: 110 LKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFT 169
           L +     L  +  +YGVP   ++ALWG+E+ FG+  GK  ++S L+TLA++ RR  FFT
Sbjct: 132 LYQRYQPQLSQVNAQYGVPGRYIVALWGMESAFGQIQGKEDVISALSTLAFEGRREAFFT 191

Query: 170 EQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDA 228
           ++   AL+++ +G +    L G+  G +GQ QF+P + + Y  D D DGKID+  +  D 
Sbjct: 192 KELMAALEIIHQGKVDDPQLRGSWAGAMGQSQFMPSSFLTYGADGDSDGKIDIWNNIDDV 251

Query: 229 IASAAKFLAKLGWTKCAGY 247
            AS A +L+  GW    G+
Sbjct: 252 FASTANYLSTQGWKSEQGW 270


>gi|45441726|ref|NP_993265.1| putative lipoprotein [Yersinia pestis biovar Microtus str. 91001]
 gi|108807459|ref|YP_651375.1| putative lipoprotein [Yersinia pestis Antiqua]
 gi|108811720|ref|YP_647487.1| lipoprotein [Yersinia pestis Nepal516]
 gi|145598338|ref|YP_001162414.1| lipoprotein [Yersinia pestis Pestoides F]
 gi|149365990|ref|ZP_01888025.1| putative lipoprotein [Yersinia pestis CA88-4125]
 gi|166211197|ref|ZP_02237232.1| lytic murein transglycosylase [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167468173|ref|ZP_02332877.1| lytic murein transglycosylase [Yersinia pestis FV-1]
 gi|218929188|ref|YP_002347063.1| putative lipoprotein [Yersinia pestis CO92]
 gi|229894797|ref|ZP_04509977.1| putative lipoprotein [Yersinia pestis Pestoides A]
 gi|229897502|ref|ZP_04512658.1| putative lipoprotein [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229898146|ref|ZP_04513295.1| putative lipoprotein [Yersinia pestis biovar Orientalis str. India
           195]
 gi|229902008|ref|ZP_04517129.1| putative lipoprotein [Yersinia pestis Nepal516]
 gi|45436588|gb|AAS62142.1| putative lipoprotein [Yersinia pestis biovar Microtus str. 91001]
 gi|108775368|gb|ABG17887.1| lipoprotein [Yersinia pestis Nepal516]
 gi|108779372|gb|ABG13430.1| putative lipoprotein [Yersinia pestis Antiqua]
 gi|115347799|emb|CAL20716.1| putative lipoprotein [Yersinia pestis CO92]
 gi|145210034|gb|ABP39441.1| lipoprotein [Yersinia pestis Pestoides F]
 gi|149292403|gb|EDM42477.1| putative lipoprotein [Yersinia pestis CA88-4125]
 gi|166208377|gb|EDR52857.1| lytic murein transglycosylase [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|229680904|gb|EEO76999.1| putative lipoprotein [Yersinia pestis Nepal516]
 gi|229688862|gb|EEO80929.1| putative lipoprotein [Yersinia pestis biovar Orientalis str. India
           195]
 gi|229693839|gb|EEO83888.1| putative lipoprotein [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229702270|gb|EEO90289.1| putative lipoprotein [Yersinia pestis Pestoides A]
 gi|262365838|gb|ACY62395.1| putative lipoprotein [Yersinia pestis D182038]
          Length = 361

 Score =  130 bits (328), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 69/199 (34%), Positives = 113/199 (56%), Gaps = 2/199 (1%)

Query: 50  RARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIA 109
           +A+A  +G + +T    FA++ ++D  I  DR  +    ++  DYL  +   + I QG A
Sbjct: 72  KAQARAKGYTTETLDTAFANIHFVDRVIKSDRNQL-EKKITLDDYLTRVLPRKRIEQGRA 130

Query: 110 LKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFT 169
           L +     L  +  +YGVP   ++ALWG+E+ FG+  GK  ++S L+TLA++ RR  FFT
Sbjct: 131 LYQRYQPQLSQVNAQYGVPGRYIVALWGMESAFGQIQGKEDVISALSTLAFEGRREAFFT 190

Query: 170 EQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDA 228
           ++   AL+++ +G +    L G+  G +GQ QF+P + + Y  D D DGKID+  +  D 
Sbjct: 191 KELMAALEIIHQGKVDDPQLRGSWAGAMGQSQFMPSSFLTYGADGDSDGKIDIWNNIDDV 250

Query: 229 IASAAKFLAKLGWTKCAGY 247
            AS A +L+  GW    G+
Sbjct: 251 FASTANYLSTQGWKSEQGW 269


>gi|110678455|ref|YP_681462.1| peptidoglycan binding domain-containing protein [Roseobacter
           denitrificans OCh 114]
 gi|109454571|gb|ABG30776.1| peptidoglycan binding domain protein [Roseobacter denitrificans OCh
           114]
          Length = 377

 Score =  130 bits (328), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 82/261 (31%), Positives = 132/261 (50%), Gaps = 24/261 (9%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           +  W ++ + RA   G++  T +  F    YL   + RDR   T    S +DYL    S 
Sbjct: 45  YDAWVASFQQRARAAGITDDTLRRAFQGTGYLPGVVRRDRNQ-TEFKRSLEDYLSIAVSD 103

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
           E +AQG   ++  + +L  L+  YGV   I+ A+WGLE+ +G   G  P++S  +TLA+D
Sbjct: 104 ERVAQGRDARRQYASVLETLEARYGVDANIITAIWGLESFYGARRGNVPVVSATSTLAFD 163

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR  FF +Q   AL +V+ G I++  L G+  G +G  QF+P +   +A+D   DG+ D
Sbjct: 164 GRRGAFFEKQLIEALRIVQSGDITADRLVGSWAGAMGHTQFIPTSYQAFAVDFTGDGRRD 223

Query: 221 LVKSN-IDAIASAAKFLAKLGWTKCAGY-------------QPGE--------KNFAILK 258
           +   +  DA+ASAA +L + GW +   +             QP E        +NF ++K
Sbjct: 224 IWSDDPSDALASAAAYLERNGWVRGQRWGNEVTGAASGTIIQPQENGPRFAVNQNFRVIK 283

Query: 259 HWNASLNYNKTIAYIAAHIDG 279
            +N S  Y   + +++  I G
Sbjct: 284 RYNNSDAYAIGVGHLSDRIAG 304


>gi|121997021|ref|YP_001001808.1| lytic murein transglycosylase [Halorhodospira halophila SL1]
 gi|121588426|gb|ABM61006.1| lytic murein transglycosylase [Halorhodospira halophila SL1]
          Length = 395

 Score =  130 bits (327), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 73/213 (34%), Positives = 115/213 (53%), Gaps = 8/213 (3%)

Query: 39  ADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGL 98
           AD F +  S+ R     +G      +  FA +E L+  +  DR+       +F+DYLD  
Sbjct: 21  ADDFEQCVSSLRDDLKEQGRDAAVVEETFAGVEQLERILELDREQPEFV-QTFRDYLDAR 79

Query: 99  SSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATL 158
            + E + +G  +   +  LL  +  ++GVPP  L+ALWG+ETH+G   G+ P++  + TL
Sbjct: 80  LTEERVDRGREMMAEHRELLWQIHDDFGVPPRYLVALWGMETHYGSYFGEVPIIDAMTTL 139

Query: 159 AYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDG 217
           A + RRA+FF  Q    + L++ G +    L G+  G +G  QF+P  + ++A+D D  G
Sbjct: 140 ACEGRRARFFFHQLDATVALLEDGKLERDGLRGSWAGALGHTQFMPATLREHAVDYDGSG 199

Query: 218 KIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPG 250
           +IDL  S  DA+AS A +L  +GW      QPG
Sbjct: 200 RIDLRDSVADALASGANYLRAMGW------QPG 226


>gi|254455751|ref|ZP_05069180.1| membrane-bound lytic transglycolase-related protein [Candidatus
           Pelagibacter sp. HTCC7211]
 gi|207082753|gb|EDZ60179.1| membrane-bound lytic transglycolase-related protein [Candidatus
           Pelagibacter sp. HTCC7211]
          Length = 333

 Score =  130 bits (327), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 78/210 (37%), Positives = 127/210 (60%), Gaps = 9/210 (4%)

Query: 36  SDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKD-- 93
           SD    F +WK   +  A++  +S KT   + ++ ++L   I  DR      P  ++D  
Sbjct: 20  SDENLEFQKWKKNFKKIALQNNISEKTFDTVMSNTKFLPNVIKYDRYQ----PEFYEDTK 75

Query: 94  -YLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
            Y+   +S + +++G+ L K N  L+ +++KE+ +   +L++L G+ET+FG  +GK  +L
Sbjct: 76  TYISKRTSDKKVSKGLILYKKNIDLINSIEKEFNIEKELLLSLMGIETNFGTYVGKMDIL 135

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAI 211
           S+LATL+YD RR++FFT +    L+L++K  I    L G+  G  G FQF+P  +  YAI
Sbjct: 136 SSLATLSYDKRRSEFFTNELLILLNLIEKKQIDYKTLYGSWAGAFGFFQFMPSTMKNYAI 195

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
           D D++  IDL K+N+DA ASAA +L K+GW
Sbjct: 196 DYDDNNYIDL-KNNVDAYASAANYLKKIGW 224


>gi|170024353|ref|YP_001720858.1| lytic murein transglycosylase [Yersinia pseudotuberculosis YPIII]
 gi|169750887|gb|ACA68405.1| lytic murein transglycosylase [Yersinia pseudotuberculosis YPIII]
          Length = 361

 Score =  130 bits (327), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 68/199 (34%), Positives = 113/199 (56%), Gaps = 2/199 (1%)

Query: 50  RARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIA 109
           +A+A  +G + +T    FA++ ++D  I  DR  +    ++  DYL  +   + I QG A
Sbjct: 72  KAQARAKGYTTETLDTAFANIHFVDRVIKSDRNQL-EKKITLDDYLTRVLPRKRIEQGRA 130

Query: 110 LKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFT 169
           L +     L  +  +YGVP   ++ALWG+E+ FG+  GK  ++S L+TLA++ RR  FFT
Sbjct: 131 LYQRYQPQLSQVNAQYGVPGRYIVALWGMESAFGQIQGKEDVISALSTLAFEGRREAFFT 190

Query: 170 EQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDA 228
           ++   AL+++ +G +    L G+  G +GQ QF+P + + Y  D D DGK+D+  +  D 
Sbjct: 191 KELMAALEIIHQGKVDDPQLRGSWAGAMGQSQFMPSSFLTYGADGDSDGKVDIWNNIDDV 250

Query: 229 IASAAKFLAKLGWTKCAGY 247
            AS A +L+  GW    G+
Sbjct: 251 FASTANYLSTQGWKSEQGW 269


>gi|114563484|ref|YP_750997.1| lytic murein transglycosylase [Shewanella frigidimarina NCIMB 400]
 gi|114334777|gb|ABI72159.1| lytic murein transglycosylase [Shewanella frigidimarina NCIMB 400]
          Length = 415

 Score =  130 bits (327), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 74/193 (38%), Positives = 105/193 (54%), Gaps = 2/193 (1%)

Query: 50  RARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIA 109
           + +A   G+S +      A+L+++   I  D +       SF DY +   +   + QG  
Sbjct: 53  QQKAKTAGISQQIIDTTVANLKFVPRVIELDNQQPEFT-TSFGDYFNKRVTPWRVEQGTK 111

Query: 110 LKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFT 169
           +   +  LL  L KEYGVP   ++A WGLET+FG   G  P+L +LATLA D RR+ +FT
Sbjct: 112 MMAKHGPLLAKLTKEYGVPGQYIVAFWGLETNFGSYKGSMPVLDSLATLACDPRRSDYFT 171

Query: 170 EQFFYALDLVKK-GVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDA 228
            +   AL L ++     S  +G+  G +G  QF+P N  KYA+D D DG  DL  S +DA
Sbjct: 172 GELLQALKLKQQYNFADSKMVGSWAGAMGHTQFMPTNYRKYAVDGDGDGIADLWNSEVDA 231

Query: 229 IASAAKFLAKLGW 241
           + SAA FL  LGW
Sbjct: 232 LTSAANFLQHLGW 244


>gi|149201097|ref|ZP_01878072.1| Lytic murein transglycosylase [Roseovarius sp. TM1035]
 gi|149145430|gb|EDM33456.1| Lytic murein transglycosylase [Roseovarius sp. TM1035]
          Length = 427

 Score =  130 bits (327), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 73/221 (33%), Positives = 117/221 (52%), Gaps = 11/221 (4%)

Query: 29  ATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPP 88
           + T  +  +   RF  W +  R RA+ +G+S +     F  + +    +++DR       
Sbjct: 46  SETAIVPVNANPRFDTWVAGFRGRALSQGISGQVFDRAFRGVTFNPEIVSKDRNQS---- 101

Query: 89  VSFK----DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGE 144
             FK    DYLD   S   +  G    + + R L  ++  YGV   ++ A+WG+E+ +GE
Sbjct: 102 -EFKREIWDYLDSAVSPIRVNNGQEALRKHRRALERIEAHYGVEKEVVAAVWGMESTYGE 160

Query: 145 TMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLP 203
            +G  PL+ +LATLAYD RR  FF +Q   AL +++ G ++   + G+  G +G  QF+P
Sbjct: 161 RLGDLPLIQSLATLAYDGRRGAFFEKQLIAALQILQSGDVTPENMKGSWAGAMGHTQFMP 220

Query: 204 VNVVKYAIDADEDGKIDLVKSN-IDAIASAAKFLAKLGWTK 243
            + + YA+D   DGK D+   N  DA+AS A +L + GWTK
Sbjct: 221 TSYLAYAVDFTGDGKRDIWSDNPTDALASTAAYLKRFGWTK 261


>gi|78484843|ref|YP_390768.1| lytic murein transglycosylase [Thiomicrospira crunogena XCL-2]
 gi|78363129|gb|ABB41094.1| Lytic murein transglycosylase [Thiomicrospira crunogena XCL-2]
          Length = 409

 Score =  130 bits (326), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 82/252 (32%), Positives = 125/252 (49%), Gaps = 15/252 (5%)

Query: 1   MSFKKYLLISLLMMVYPML----AQAVTQPKKATTQFICSDTADRFGEWKSAARARAVRE 56
           M+ K Y    +L   + +L    A A T P ++ + F           W    +  A  +
Sbjct: 1   MTPKFYRHFFMLFTAFSILIGPKAYAYTPPPQSESDFQT---------WLVEFKKSAYEQ 51

Query: 57  GMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSR 116
           G+S  T K  F D+      +  DR+       +F  Y +   +   I  G  L +    
Sbjct: 52  GISKTTLKKAFKDVHLNQRVLELDRRQPEFT-RTFWQYFNRAVTDWRIQTGQELYEKYRP 110

Query: 117 LLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYAL 176
            L  + ++YGVP   L+A WG+ET+FG   G TP++ +LATL+YD RR++FF ++   AL
Sbjct: 111 QLREVTRKYGVPGRFLIAFWGMETNFGGYTGNTPIIESLATLSYDPRRSEFFQKELMAAL 170

Query: 177 DLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKF 235
            ++++G I    + G+  G +GQ QF+P N +KYA+DAD+ GK DL  S  D   S   F
Sbjct: 171 KIIQEGNIKPEQMKGSWAGAMGQCQFMPSNYLKYAVDADDSGKRDLWNSLDDVFHSMGNF 230

Query: 236 LAKLGWTKCAGY 247
           L  LGW K   +
Sbjct: 231 LNTLGWQKQENW 242


>gi|254460521|ref|ZP_05073937.1| lytic murein transglycosylase [Rhodobacterales bacterium HTCC2083]
 gi|206677110|gb|EDZ41597.1| lytic murein transglycosylase [Rhodobacteraceae bacterium HTCC2083]
          Length = 375

 Score =  130 bits (326), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 83/255 (32%), Positives = 131/255 (51%), Gaps = 20/255 (7%)

Query: 45  WKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEII 104
           W ++ + RA   G+S  T    F    YL   + RDR   T    S +DYL   +S E +
Sbjct: 51  WVASFKNRASGYGLSSATIAAGFRGTGYLPGVVKRDRNQ-TEFKRSLEDYLSIAASDERV 109

Query: 105 AQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRR 164
           ++G A    +   L  L+ +YGV   I+ A+WGLE+ FGE  G  P++S+ +TLA+D RR
Sbjct: 110 SKGRAAFARHRSTLNALETKYGVDATIICAIWGLESQFGERKGNIPVISSTSTLAFDGRR 169

Query: 165 AKFFTEQFFYALDLVKKGVISS-HALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVK 223
             FF +Q   AL +++ G I++   LG+  G +G  QF+P +   +A+D   DG+ D+  
Sbjct: 170 GAFFEKQLVAALKIIQNGDITADRLLGSWAGAMGHTQFMPTSYAGFAVDFTGDGRRDIWS 229

Query: 224 SN-IDAIASAAKFLAKLGWTKCAGY-----------QPG------EKNFAILKHWNASLN 265
           ++  DA+AS A +L + GW++   +           QPG        NF  +K +N S  
Sbjct: 230 ADPSDALASTAAYLQRNGWSRGVRWGAESSSGTLQPQPGGPKFSTTGNFRTIKRYNNSDA 289

Query: 266 YNKTIAYIAAHIDGV 280
           Y   I +++  I G 
Sbjct: 290 YAIGIGHLSDRIGGA 304


>gi|119713534|gb|ABL97587.1| lytic murein transglycosylase [uncultured marine bacterium
           EB0_35D03]
          Length = 348

 Score =  130 bits (326), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 67/154 (43%), Positives = 95/154 (61%)

Query: 90  SFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKT 149
           +F  Y++   S+  ++ G    K N+ LL    ++YGVP  +L+A  GLE+++G  MG  
Sbjct: 29  NFWHYVNKRVSNVRLSNGRESLKQNASLLNKTSEKYGVPAYVLVAFLGLESNYGNYMGNE 88

Query: 150 PLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKY 209
            L+ +LATLAYD RR+ FFT++   AL L+ K  I  +A G+  G +G  QF+P NV+ Y
Sbjct: 89  SLVRSLATLAYDPRRSGFFTKELIAALKLMDKNTIPINAKGSWAGAMGAVQFMPTNVIAY 148

Query: 210 AIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTK 243
            +DA+ DGK+DL     D  ASAA FL KLGW K
Sbjct: 149 GVDANNDGKVDLWNDKADIYASAANFLKKLGWKK 182


>gi|27377558|ref|NP_769087.1| lytic murein transglycosylase [Bradyrhizobium japonicum USDA 110]
 gi|27350702|dbj|BAC47712.1| lytic murein transglycosylase [Bradyrhizobium japonicum USDA 110]
          Length = 433

 Score =  130 bits (326), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 74/211 (35%), Positives = 116/211 (54%), Gaps = 4/211 (1%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDY 94
           C + A  F  + +  + +AV  G+S +T       L Y    + RDR       + F ++
Sbjct: 46  CHNGAS-FDRFLADVKQQAVAAGVSQRTISEASPYLVYDQGIVNRDRGQRVFGQL-FTEF 103

Query: 95  LDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLST 154
              +++   +  G    KA++      +KEYGVPP ++ A WGLE+ FG  MG  P L +
Sbjct: 104 AGRMAAPYRMQNGQQHIKAHAAAFARAEKEYGVPPAVIAAFWGLESDFGANMGNLPTLKS 163

Query: 155 LATLAYDCRRAKFFTEQFFYALDLVKKG-VISSHALGATFGEIGQFQFLPVNVVKYAIDA 213
           L +LAYDCRR++ F  +   AL ++ +G + +   +G+  GE+GQ QFLPV+ V YA+D 
Sbjct: 164 LVSLAYDCRRSEMFVNETIAALKIIDRGDLTADEMIGSWAGELGQTQFLPVHYVNYAVDY 223

Query: 214 DEDGKIDLVKSNIDAIASAAKFLAK-LGWTK 243
           D DG+ DL++S  D I S A ++A  L W +
Sbjct: 224 DGDGRRDLLRSEPDVIGSTANYIANGLKWRR 254


>gi|159044413|ref|YP_001533207.1| putative membrane-bound lytic murein transglycosylase
           [Dinoroseobacter shibae DFL 12]
 gi|157912173|gb|ABV93606.1| putative membrane-bound lytic murein transglycosylase
           [Dinoroseobacter shibae DFL 12]
          Length = 370

 Score =  129 bits (325), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 78/222 (35%), Positives = 116/222 (52%), Gaps = 14/222 (6%)

Query: 64  KHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKK 123
           +  FA   YL   +ARDR  V     + +DYL    S E +A+G A        L  ++ 
Sbjct: 64  RRAFAGTGYLPGVVARDRNQVEFR-RTLEDYLAIAVSDERVARGRAAVAQYRPTLAAIED 122

Query: 124 EYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGV 183
            YGVPP ++ A+WGLE+ +G+  G  P++S  +TLAYD RR  FF  Q   AL +++ G 
Sbjct: 123 RYGVPPELVTAIWGLESFYGDRKGDIPVVSATSTLAYDGRRGAFFEGQLTAALRILRAGD 182

Query: 184 ISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSN-IDAIASAAKFLAKLGW 241
           I +  L G+  G +G  QF+P +   +A+D   DG+ D+   +  DA+ASAA +L + GW
Sbjct: 183 IPADRLVGSWAGAMGHTQFIPTSFEAFAVDFTGDGRRDIWSDDPTDALASAAAYLDRNGW 242

Query: 242 TKCAGY-----------QPGEKNFAILKHWNASLNYNKTIAY 272
           T+   +           QPG   FA   ++N    YN + AY
Sbjct: 243 TRGLRWGAEDPEGSLQPQPGGPRFATTSNFNVIKRYNNSDAY 284


>gi|123442610|ref|YP_001006587.1| putative lipoprotein [Yersinia enterocolitica subsp. enterocolitica
           8081]
 gi|122089571|emb|CAL12420.1| putative lipoprotein [Yersinia enterocolitica subsp. enterocolitica
           8081]
          Length = 307

 Score =  129 bits (325), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 69/199 (34%), Positives = 113/199 (56%), Gaps = 2/199 (1%)

Query: 50  RARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIA 109
           +A+A  +G+S  T +  FA++ ++D  I  DR  +    V+  DYL  + +   IAQG  
Sbjct: 20  KAQARAQGISEATLEIAFANIHFVDRVIQSDRNQLEKK-VTLDDYLAKVLTPSKIAQGKE 78

Query: 110 LKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFT 169
           + +     L  +   YGVP   ++ALWG+E+ FG+  GK  ++S L+TLA++ RR  FFT
Sbjct: 79  IYQRYQPQLSQVTARYGVPERYIVALWGMESGFGKIQGKEDVISALSTLAFEGRREAFFT 138

Query: 170 EQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDA 228
           ++   AL ++++G +    L G+  G +GQ QF+P + + Y  D D DGK+D+  +  D 
Sbjct: 139 KELIAALKIIQQGRVEDPQLKGSWAGAMGQSQFMPSSFLTYGADGDGDGKVDIWNNIDDV 198

Query: 229 IASAAKFLAKLGWTKCAGY 247
            AS A +L+  GW    G+
Sbjct: 199 FASTANYLSTEGWKPGIGW 217


>gi|293395844|ref|ZP_06640126.1| type III effector HopAJ2 [Serratia odorifera DSM 4582]
 gi|291421781|gb|EFE95028.1| type III effector HopAJ2 [Serratia odorifera DSM 4582]
          Length = 320

 Score =  129 bits (325), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 74/225 (32%), Positives = 119/225 (52%), Gaps = 3/225 (1%)

Query: 24  TQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKM 83
           T P   T      D A+ F  +  A + +AV +G+  +T    FA++ ++D  I  DR  
Sbjct: 6   TAPADTTLAQTGRDPAE-FPAYVEALKRQAVAQGIDRQTVDSAFANVHFVDRVIKADRNQ 64

Query: 84  VTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFG 143
           +    ++   YL  + S   I QG  L +     L      YGVP   ++ALW +E+H+G
Sbjct: 65  LEKK-ITLDVYLQRVLSPTKIQQGRQLLRQYQPQLARATARYGVPERYIVALWAMESHYG 123

Query: 144 ETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFL 202
           +  GK  ++S L+TLA++ RR  FF++Q   AL ++++G + +  L G+  G +GQ QF+
Sbjct: 124 KIQGKEDVVSALSTLAFEGRREAFFSKQLMAALQIIQQGHVPAEQLTGSWAGAMGQCQFM 183

Query: 203 PVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGY 247
           P + + Y  D D DG+ID+  +  D  AS A +LA  GW    G+
Sbjct: 184 PSSFLSYGADGDGDGRIDIWHNLDDVFASTANYLATEGWKPGIGW 228


>gi|238794482|ref|ZP_04638091.1| Lytic murein transglycosylase [Yersinia intermedia ATCC 29909]
 gi|238726165|gb|EEQ17710.1| Lytic murein transglycosylase [Yersinia intermedia ATCC 29909]
          Length = 360

 Score =  129 bits (325), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 68/194 (35%), Positives = 112/194 (57%), Gaps = 2/194 (1%)

Query: 50  RARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIA 109
           +A+A  +G+S  T    FA++ ++D  I  DR  +    V+  DYL+ + +   +AQG  
Sbjct: 71  KAQARAKGISDATLDKAFANIHFVDRVIQSDRNQLEKK-VTLDDYLNKVLTDAKVAQGKE 129

Query: 110 LKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFT 169
           + +     L  +   YGVP   ++ALWG+E+ FG+  GK  ++S L+T+A++ RR  FFT
Sbjct: 130 IYQRYQPQLSQVTARYGVPERYIVALWGMESGFGKFQGKEDVISALSTMAFEGRREAFFT 189

Query: 170 EQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDA 228
           ++   AL ++++G +    L G+  G +GQ QF+P + + Y  D D DGKID+  +  D 
Sbjct: 190 KELIAALQIIQQGKVDDPELKGSWAGAMGQSQFMPSSFLTYGADGDGDGKIDIWNNIDDV 249

Query: 229 IASAAKFLAKLGWT 242
            AS A +L+  GWT
Sbjct: 250 FASTANYLSTEGWT 263


>gi|254505148|ref|ZP_05117299.1| hypothetical protein SADFL11_5188 [Labrenzia alexandrii DFL-11]
 gi|222441219|gb|EEE47898.1| hypothetical protein SADFL11_5188 [Labrenzia alexandrii DFL-11]
          Length = 279

 Score =  129 bits (325), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 93/277 (33%), Positives = 133/277 (48%), Gaps = 21/277 (7%)

Query: 8   LISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSA----ARARAVRE-GMSPKT 62
           +++  MM  P LA +            C  +  +FG +K      A A  VR+ G+    
Sbjct: 17  IVAGTMMATPALAAS------------CITSKGQFGAYKQQLAQQASASGVRQRGLQALQ 64

Query: 63  AKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALK-KANSRLLINL 121
              L       ++  A    M    P  F       SS      G   K K N+RL  ++
Sbjct: 65  QAKLSGITWRFESNPASQSSMRYRSPEQF--LKSRFSSVNTFVSGAKRKLKQNARLFQSI 122

Query: 122 KKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKK 181
           +K YGVP  IL+A+WG ET++G   G T ++S   TLA  CRR   F +    AL LV +
Sbjct: 123 EKRYGVPGSILVAIWGYETNWGGYTGNTRIVSGAVTLASYCRRHPRFEDDAIAALQLVDR 182

Query: 182 GVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
           G+I+ ++ G   GE+G  QFL  N V++A+D + DG+ D   +  DA+A+AA  L + GW
Sbjct: 183 GLITGNSRGGPSGELGHMQFLAGNWVRFAVDGNRDGRADPNNA-ADALATAANMLRRNGW 241

Query: 242 TKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHID 278
                +  G  NF +L  WN S NY + IAY A  ID
Sbjct: 242 RAGRSFADGSANFRVLSTWNDSGNYQRAIAYAAGLID 278


>gi|99078546|ref|YP_611804.1| lytic murein transglycosylase [Ruegeria sp. TM1040]
 gi|99035684|gb|ABF62542.1| putative peptidoglycan-binding protein [Ruegeria sp. TM1040]
          Length = 381

 Score =  129 bits (325), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 82/262 (31%), Positives = 130/262 (49%), Gaps = 25/262 (9%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           + +W +A R RA R+G S       F    YL   + RDR   T    + +DYL    S 
Sbjct: 48  YAKWVAAFRERAERQGFSQDLLSRAFRGTGYLPGVVKRDRNQ-TEFSRTLEDYLSIAVSD 106

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
           E + +G A    +   L  +++ YGV   ++ A+WGLE+++GE  G  P++S  +TLAYD
Sbjct: 107 ERVRKGRAAYARHRGTLDAIERRYGVEAHVIAAVWGLESYYGERRGNVPVISATSTLAYD 166

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR   F +Q   AL +++ G I+   + G+  G +G  QF+P + + +A+D   DG+ D
Sbjct: 167 GRRGALFEKQLIAALKILRNGDIAPRNMTGSWAGAMGHTQFIPTSYLSFAVDFTGDGRRD 226

Query: 221 LVKSN-IDAIASAAKFLAKLGWTKCAGY----------------QPG------EKNFAIL 257
           +   +  DA+AS A +LA+ GW K   +                QPG        NF  L
Sbjct: 227 IWSDDPSDALASTAAYLARNGWQKGLKWGGETGPGAPSGSVIQPQPGGPEFVTTGNFRAL 286

Query: 258 KHWNASLNYNKTIAYIAAHIDG 279
           K +N S +Y   + +++  I G
Sbjct: 287 KRYNNSDSYAIGVGHLSDRIAG 308


>gi|259415629|ref|ZP_05739550.1| lytic murein transglycosylase [Silicibacter sp. TrichCH4B]
 gi|259348859|gb|EEW60621.1| lytic murein transglycosylase [Silicibacter sp. TrichCH4B]
          Length = 380

 Score =  129 bits (324), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 80/262 (30%), Positives = 131/262 (50%), Gaps = 25/262 (9%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           + +W +  R RA R+G S       F    YL   + RDR   T    + +DYL    S 
Sbjct: 47  YDKWVADFRERAARQGFSQDLLSRAFRGTGYLPGVVKRDRNQ-TEFSRTLEDYLSIAVSD 105

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
           E +++G A    +   L  +++ YGV   ++ A+WGLE+++GE  G  P++S+ +TLAYD
Sbjct: 106 ERVSKGRAAYARHRATLDAIERRYGVEAHVVAAVWGLESYYGERRGNVPVISSTSTLAYD 165

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR   F +Q   AL +++ G I+   + G+  G +G  QF+P + + +A+D   DG+ D
Sbjct: 166 GRRGALFEKQLIAALKILRNGDIAPQNMTGSWAGAMGHTQFIPTSYLSFAVDFTGDGRRD 225

Query: 221 LVKSN-IDAIASAAKFLAKLGWTKCAGY----------------QPG------EKNFAIL 257
           +   +  DA+AS A +L++ GW K   +                QPG        NF  L
Sbjct: 226 IWSDDPSDALASTAAYLSRNGWQKGVKWGAENGPGAPSGSVIQPQPGGPQFVTTANFRAL 285

Query: 258 KHWNASLNYNKTIAYIAAHIDG 279
           K +N S +Y   + +++  I G
Sbjct: 286 KRYNNSDSYAIGVGHLSDRIAG 307


>gi|167035840|ref|YP_001671071.1| lytic murein transglycosylase [Pseudomonas putida GB-1]
 gi|166862328|gb|ABZ00736.1| lytic murein transglycosylase [Pseudomonas putida GB-1]
          Length = 438

 Score =  129 bits (324), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 72/205 (35%), Positives = 114/205 (55%), Gaps = 6/205 (2%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKM--VTSPPVSFKDYLDGLS 99
           F +W++  R +A++ G+SP T    F  +      I  DR     T P     +YL+G  
Sbjct: 66  FAQWQAGFRQQALQAGISPSTFDRAFLGVTPDMDVIKADRSQPEFTRP---VWEYLEGAL 122

Query: 100 SSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLA 159
           S   +  G  L + N+ LL  L++ YGV   +L+A+WG+E++FG+  G   ++ +LATLA
Sbjct: 123 SPLRVRNGKKLLEQNAELLTRLEQRYGVDRQVLVAVWGMESNFGQFQGNKSVIRSLATLA 182

Query: 160 YDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGK 218
           Y+ RR +F  +Q   AL +++ G I   A+ G+  G +GQ QF+P     +A+D D DG+
Sbjct: 183 YEGRRPQFAQDQLIAALQIIQHGDIQPEAMRGSWAGAMGQTQFIPTTYNTHAVDFDGDGR 242

Query: 219 IDLVKSNIDAIASAAKFLAKLGWTK 243
            D+  S  DA+AS A +L   GW +
Sbjct: 243 RDIWNSTPDALASTAHYLQSSGWKR 267


>gi|163744316|ref|ZP_02151676.1| Lytic murein transglycosylase [Oceanibulbus indolifex HEL-45]
 gi|161381134|gb|EDQ05543.1| Lytic murein transglycosylase [Oceanibulbus indolifex HEL-45]
          Length = 382

 Score =  129 bits (324), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 86/260 (33%), Positives = 132/260 (50%), Gaps = 26/260 (10%)

Query: 45  WKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEII 104
           W ++ + RA  +G+S  T    F+   YL   + RDR   T    S +DYL   +S + +
Sbjct: 51  WVASFKGRASAQGISASTLAQGFSGAGYLPGVVKRDRNQ-TEFSRSLEDYLAIAASDDRV 109

Query: 105 AQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRR 164
           ++G A    +   L  ++  YGV   I+ A+WGLE+ FGE  G  P++S  +TLAYD RR
Sbjct: 110 SKGRAAFARHRSTLSAIESRYGVAAEIVAAIWGLESFFGERRGNVPVVSATSTLAYDGRR 169

Query: 165 AKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVK 223
             FF +Q   AL +++ G IS+  L G+  G +G  QF+P +   +A+D   DG+ D+  
Sbjct: 170 GAFFEKQLIAALKILQNGDISADRLTGSWAGAMGHTQFIPTSYQAFAVDFTGDGRRDIWS 229

Query: 224 SN-IDAIASAAKFLAKLGWTK-------------CAG--YQPG--------EKNFAILKH 259
            +  DA+AS A +L++ GWT+              AG   QP           NF  LK 
Sbjct: 230 EDPSDALASTAAYLSRNGWTRGIKWGGELGSIPASAGSVIQPQAGGPQFVVTSNFRALKR 289

Query: 260 WNASLNYNKTIAYIAAHIDG 279
           +N S +Y   + ++A  I G
Sbjct: 290 YNNSDSYAIGVGHLADRIAG 309


>gi|238756995|ref|ZP_04618183.1| Lytic murein transglycosylase [Yersinia aldovae ATCC 35236]
 gi|238704825|gb|EEP97354.1| Lytic murein transglycosylase [Yersinia aldovae ATCC 35236]
          Length = 358

 Score =  129 bits (324), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 72/205 (35%), Positives = 114/205 (55%), Gaps = 6/205 (2%)

Query: 44  EWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEI 103
           E K+ ARA+    G+S  T    FA++ ++D  I  DR  +    V+  DYL  + ++  
Sbjct: 67  ELKAQARAK----GISQATLDVAFANIHFVDRVIQSDRNQLEKK-VTLDDYLAKVLTATK 121

Query: 104 IAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCR 163
           I QG  + +     L  +   YGVP   ++ALWG+E+ FG+  GK  ++S L+TLA++ R
Sbjct: 122 IEQGKEIYQRYQPQLSQVTARYGVPERYIVALWGMESGFGKIQGKEDVISALSTLAFEGR 181

Query: 164 RAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLV 222
           R  FFT +   AL ++++G +    L G+  G +GQ QF+P + + Y +D D DGKID+ 
Sbjct: 182 RETFFTNELIAALKIIQQGKVDDPQLKGSWAGAMGQSQFMPSSFLTYGVDGDGDGKIDIW 241

Query: 223 KSNIDAIASAAKFLAKLGWTKCAGY 247
            +  D  AS A +L+  GW    G+
Sbjct: 242 NNIDDVFASTANYLSTEGWKPGIGW 266


>gi|163742343|ref|ZP_02149730.1| peptidoglycan-binding protein, putative [Phaeobacter gallaeciensis
           2.10]
 gi|161384293|gb|EDQ08675.1| peptidoglycan-binding protein, putative [Phaeobacter gallaeciensis
           2.10]
          Length = 370

 Score =  129 bits (324), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 83/247 (33%), Positives = 125/247 (50%), Gaps = 20/247 (8%)

Query: 45  WKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEII 104
           W +  R RA   G++  T    F    YL   I RDR   T    S +DYL   +S E +
Sbjct: 39  WVAGFRQRASAAGINNSTLNTAFRGAGYLPGVIKRDRNQ-TEFKRSLEDYLSIAASDERV 97

Query: 105 AQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRR 164
           ++G A    +   L  L++ YGV   I+ A+WGLE+ FGE  G  P++S  +TLA+D RR
Sbjct: 98  SKGRAAYARHRSTLNALEQTYGVDAEIITAIWGLESFFGERRGDVPVISATSTLAFDGRR 157

Query: 165 AKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVK 223
             FF +Q   AL +++ G IS+  + G+  G +G  QF+P +   +A+D   DG+ D+  
Sbjct: 158 GAFFEKQLIAALKILQNGDISAARMTGSWAGAMGHTQFIPTSYQAFAVDFTGDGRRDIWS 217

Query: 224 SN-IDAIASAAKFLAKLGWTKCAGY-----------------QPGEKNFAILKHWNASLN 265
            +  DA+AS A +LA+ GWT+   +                 Q G   FA+  ++ A   
Sbjct: 218 EDPSDALASTAAYLARNGWTRGLRWGREVTGTAAASGTLIQPQAGGPKFAVTSNFRAIKR 277

Query: 266 YNKTIAY 272
           YN + AY
Sbjct: 278 YNNSDAY 284


>gi|313500777|gb|ADR62143.1| Lytic murein transglycosylase [Pseudomonas putida BIRD-1]
          Length = 438

 Score =  129 bits (323), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 72/207 (34%), Positives = 116/207 (56%), Gaps = 10/207 (4%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLF----ADLEYLDTTIARDRKMVTSPPVSFKDYLDG 97
           F +W++  R +A++ G+SP T    F     DL+ +     R +   T P     +YL+G
Sbjct: 66  FAQWQAGFREQALQAGISPSTFDRAFLGVTPDLDVIKAD--RSQPEFTRP---VWEYLEG 120

Query: 98  LSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLAT 157
             S   +  G  L + N+ LL  L++ YGV   +L+A+WG+E++FG+  G   ++ +LAT
Sbjct: 121 ALSPLRVRNGKKLLEQNAELLTRLEQRYGVDRQVLVAVWGMESNFGQFQGSKSVIRSLAT 180

Query: 158 LAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADED 216
           LAY+ RR +F  +Q   AL +++ G I   A+ G+  G +GQ QF+P     +A+D D D
Sbjct: 181 LAYEGRRPQFAQDQLIAALQIIQHGDIQPEAMRGSWAGAMGQTQFIPTTYNTHAVDFDGD 240

Query: 217 GKIDLVKSNIDAIASAAKFLAKLGWTK 243
           G+ D+  S  DA+AS A +L   GW +
Sbjct: 241 GRRDIWNSTPDALASTAHYLQSSGWKR 267


>gi|26991478|ref|NP_746903.1| lytic murein transglycosylase [Pseudomonas putida KT2440]
 gi|24986556|gb|AAN70367.1|AE016678_8 membrane-bound lytic murein transglycosylase, putative [Pseudomonas
           putida KT2440]
          Length = 438

 Score =  129 bits (323), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 72/207 (34%), Positives = 116/207 (56%), Gaps = 10/207 (4%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLF----ADLEYLDTTIARDRKMVTSPPVSFKDYLDG 97
           F +W++  R +A++ G+SP T    F     DL+ +     R +   T P     +YL+G
Sbjct: 66  FAQWQAGFREQALQAGISPSTFDRAFLGVTPDLDVIKAD--RSQPEFTRP---VWEYLEG 120

Query: 98  LSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLAT 157
             S   +  G  L + N+ LL  L++ YGV   +L+A+WG+E++FG+  G   ++ +LAT
Sbjct: 121 ALSPLRVRNGKKLLEQNAELLTRLEQRYGVDRQVLVAVWGMESNFGQFQGSKSVIRSLAT 180

Query: 158 LAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADED 216
           LAY+ RR +F  +Q   AL +++ G I   A+ G+  G +GQ QF+P     +A+D D D
Sbjct: 181 LAYEGRRPQFAQDQLIAALQIIQHGDIQPEAMRGSWAGAMGQTQFIPTTYNTHAVDFDGD 240

Query: 217 GKIDLVKSNIDAIASAAKFLAKLGWTK 243
           G+ D+  S  DA+AS A +L   GW +
Sbjct: 241 GRRDIWNSTPDALASTAHYLQSSGWKR 267


>gi|148549875|ref|YP_001269977.1| lytic murein transglycosylase [Pseudomonas putida F1]
 gi|148513933|gb|ABQ80793.1| lytic murein transglycosylase [Pseudomonas putida F1]
          Length = 438

 Score =  129 bits (323), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 72/207 (34%), Positives = 116/207 (56%), Gaps = 10/207 (4%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLF----ADLEYLDTTIARDRKMVTSPPVSFKDYLDG 97
           F +W++  R +A++ G+SP T    F     DL+ +     R +   T P     +YL+G
Sbjct: 66  FAQWQAGFREQALQAGISPSTFDRAFLGVTPDLDVIKAD--RSQPEFTRP---VWEYLEG 120

Query: 98  LSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLAT 157
             S   +  G  L + N+ LL  L++ YGV   +L+A+WG+E++FG+  G   ++ +LAT
Sbjct: 121 ALSPLRVRNGKKLLEQNAELLTRLEQRYGVDRQVLVAVWGMESNFGQFQGSKSVIRSLAT 180

Query: 158 LAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADED 216
           LAY+ RR +F  +Q   AL +++ G I   A+ G+  G +GQ QF+P     +A+D D D
Sbjct: 181 LAYEGRRPQFAQDQLIAALQIIQHGDIQPEAMRGSWAGAMGQTQFIPTTYNTHAVDFDGD 240

Query: 217 GKIDLVKSNIDAIASAAKFLAKLGWTK 243
           G+ D+  S  DA+AS A +L   GW +
Sbjct: 241 GRRDIWNSTPDALASTAHYLQSSGWKR 267


>gi|94268922|ref|ZP_01291321.1| Lytic murein transglycosylase [delta proteobacterium MLMS-1]
 gi|93451410|gb|EAT02260.1| Lytic murein transglycosylase [delta proteobacterium MLMS-1]
          Length = 328

 Score =  129 bits (323), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 66/201 (32%), Positives = 111/201 (55%), Gaps = 2/201 (0%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F +W    R  A+  G+  +      +D+E ++  I  DR+      ++F++Y D +   
Sbjct: 30  FDQWLEELRTEALERGIRAEILDAALSDIEPIERVIELDRQQ-PEFTLTFQEYRDRVVPR 88

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             I +G  L   +  LL  + + YGV P  ++ALWG+ET FG   G  P++  +ATLA+D
Sbjct: 89  SRIQRGRKLLAEHRELLTEIGQHYGVQPRFIVALWGIETDFGRITGGFPVIPAMATLAHD 148

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR+ +F  +   AL ++ +G I+   + G+  G +GQ QF+P + + +A+D D DG+ D
Sbjct: 149 GRRSNYFRGELLNALQILDEGHITPEEMKGSWAGAMGQSQFMPSSFINFAVDYDGDGRRD 208

Query: 221 LVKSNIDAIASAAKFLAKLGW 241
           +  +  D  ASAA +LA+ GW
Sbjct: 209 IWHTTEDVFASAANYLAQSGW 229


>gi|163739149|ref|ZP_02146561.1| peptidoglycan binding domain protein [Phaeobacter gallaeciensis
           BS107]
 gi|161387549|gb|EDQ11906.1| peptidoglycan binding domain protein [Phaeobacter gallaeciensis
           BS107]
          Length = 391

 Score =  129 bits (323), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 83/247 (33%), Positives = 125/247 (50%), Gaps = 20/247 (8%)

Query: 45  WKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEII 104
           W +  R RA   G++  T    F    YL   I RDR   T    S +DYL   +S E +
Sbjct: 60  WVAGFRQRASAAGINNSTLNTAFRGAGYLPGVIKRDRNQ-TEFKRSLEDYLSIAASDERV 118

Query: 105 AQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRR 164
           ++G A    +   L  L++ YGV   I+ A+WGLE+ FGE  G  P++S  +TLA+D RR
Sbjct: 119 SKGRAAYARHRGTLNALEQTYGVDAEIITAIWGLESFFGERRGDVPVISATSTLAFDGRR 178

Query: 165 AKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVK 223
             FF +Q   AL +++ G IS+  + G+  G +G  QF+P +   +A+D   DG+ D+  
Sbjct: 179 GAFFEKQLIAALKILQNGDISAARMTGSWAGAMGHTQFIPTSYQAFAVDFTGDGRRDIWS 238

Query: 224 SN-IDAIASAAKFLAKLGWTKCAGY-----------------QPGEKNFAILKHWNASLN 265
            +  DA+AS A +LA+ GWT+   +                 Q G   FA+  ++ A   
Sbjct: 239 EDPSDALASTAAYLARNGWTRGLRWGREVTGTAAASGTLIQPQAGGPKFAVTSNFRAIKR 298

Query: 266 YNKTIAY 272
           YN + AY
Sbjct: 299 YNNSDAY 305


>gi|332161545|ref|YP_004298122.1| putative lipoprotein [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
 gi|325665775|gb|ADZ42419.1| putative lipoprotein [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
          Length = 352

 Score =  128 bits (322), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 69/199 (34%), Positives = 112/199 (56%), Gaps = 2/199 (1%)

Query: 50  RARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIA 109
           +A+A  +G+S  T    FA++ ++D  I  DR  +    V+  DYL  + +   IAQG  
Sbjct: 65  KAQARAQGISEATLAVAFANIHFVDRVIQSDRNQLEKK-VTLDDYLAKVLTPSKIAQGKE 123

Query: 110 LKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFT 169
           + +     L  +   YGVP   ++ALWG+E+ FG+  GK  ++S L+TLA++ RR  FFT
Sbjct: 124 IYQHYQPQLSQVTARYGVPERYIVALWGMESGFGKIQGKEDVVSALSTLAFEGRREAFFT 183

Query: 170 EQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDA 228
           ++   AL ++++G +    L G+  G +GQ QF+P + + Y  D D DGK+D+  +  D 
Sbjct: 184 KELIAALKIIQQGRVEDPQLKGSWAGAMGQSQFMPSSFLTYGADGDGDGKVDIWNNIDDV 243

Query: 229 IASAAKFLAKLGWTKCAGY 247
            AS A +L+  GW    G+
Sbjct: 244 FASTANYLSAEGWKPGIGW 262


>gi|110634376|ref|YP_674584.1| lytic murein transglycosylase [Mesorhizobium sp. BNC1]
 gi|110285360|gb|ABG63419.1| lytic murein transglycosylase [Chelativorans sp. BNC1]
          Length = 394

 Score =  128 bits (322), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 78/223 (34%), Positives = 115/223 (51%), Gaps = 12/223 (5%)

Query: 22  AVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHL---FADLEYLDTTIA 78
           A++ P  A  Q    D    F  W++   A A  +G+ P     L     D   LD    
Sbjct: 13  ALSLPSMAAAQQCGGD----FAAWRAGVEAEAQSQGVGPAGLDALQRARIDQRVLD---- 64

Query: 79  RDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGL 138
           RDR        +F+++ + + S + + +G A     + +    + EYGVP  ++ A W L
Sbjct: 65  RDRSQGVFTQ-TFREFANRMISRDRMQRGAANLTKYASVFQRAESEYGVPGPVIAAFWAL 123

Query: 139 ETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQ 198
           ET FG   G    L+ LATL++DCRR + F  +F   L LV +G++++   GA  GEIGQ
Sbjct: 124 ETDFGAVQGDFNTLNALATLSHDCRRPELFRPEFVAFLKLVDRGLVTTDTTGAWAGEIGQ 183

Query: 199 FQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
            Q LP + ++  +D D DG++DL  S  DAI +AA  LAKLGW
Sbjct: 184 LQVLPSDYLEKGVDGDGDGRVDLKGSAADAILTAANKLAKLGW 226


>gi|318605527|emb|CBY27025.1| membrane-bound lytic murein transglycosylase B [Yersinia
           enterocolitica subsp. palearctica Y11]
 gi|330863463|emb|CBX73581.1| hypothetical protein YEW_EH18230 [Yersinia enterocolitica W22703]
          Length = 356

 Score =  128 bits (322), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 69/199 (34%), Positives = 112/199 (56%), Gaps = 2/199 (1%)

Query: 50  RARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIA 109
           +A+A  +G+S  T    FA++ ++D  I  DR  +    V+  DYL  + +   IAQG  
Sbjct: 69  KAQARAQGISEATLAVAFANIHFVDRVIQSDRNQLEKK-VTLDDYLAKVLTPSKIAQGKE 127

Query: 110 LKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFT 169
           + +     L  +   YGVP   ++ALWG+E+ FG+  GK  ++S L+TLA++ RR  FFT
Sbjct: 128 IYQHYQPQLSQVTARYGVPERYIVALWGMESGFGKIQGKEDVVSALSTLAFEGRREAFFT 187

Query: 170 EQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDA 228
           ++   AL ++++G +    L G+  G +GQ QF+P + + Y  D D DGK+D+  +  D 
Sbjct: 188 KELIAALKIIQQGRVEDPQLKGSWAGAMGQSQFMPSSFLTYGADGDGDGKVDIWNNIDDV 247

Query: 229 IASAAKFLAKLGWTKCAGY 247
            AS A +L+  GW    G+
Sbjct: 248 FASTANYLSAEGWKPGIGW 266


>gi|300717014|ref|YP_003741817.1| Lytic murein transglycosylase [Erwinia billingiae Eb661]
 gi|299062850|emb|CAX59970.1| Lytic murein transglycosylase [Erwinia billingiae Eb661]
          Length = 362

 Score =  128 bits (322), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 71/220 (32%), Positives = 124/220 (56%), Gaps = 3/220 (1%)

Query: 23  VTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRK 82
           + QP K T      D A+ F  +    +A+A+++G+   T    FA++ ++D  I  DR 
Sbjct: 47  LQQPSKTTLAATGRDPAE-FPGYVEQLKAQALQQGIDRATVDAAFANVHFVDHVITSDRN 105

Query: 83  MVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHF 142
            +    V+  DYL  + + + I QG    +     L+ + ++ GV P  ++ALW +E+ F
Sbjct: 106 QLEKK-VTLSDYLSRVMTDKKIQQGRDNLQLYQGQLMPVSQQTGVQPQYIVALWAMESSF 164

Query: 143 GETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQF 201
           G+  G+  ++S+L+TLA++ RR  FFT++   AL ++++  I    + G+  G +GQ QF
Sbjct: 165 GKIQGREDVISSLSTLAFEGRREAFFTKELIAALKIIQQQHIEPEEMKGSWAGAMGQNQF 224

Query: 202 LPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
           +P ++++Y  D D DGKID+  +  D  AS A +L+K GW
Sbjct: 225 MPSSLMQYGADGDGDGKIDIWNNVDDVFASTANYLSKEGW 264


>gi|260427736|ref|ZP_05781715.1| membrane-bound lytic murein transglycosylase B [Citreicella sp.
           SE45]
 gi|260422228|gb|EEX15479.1| membrane-bound lytic murein transglycosylase B [Citreicella sp.
           SE45]
          Length = 415

 Score =  128 bits (322), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 69/201 (34%), Positives = 110/201 (54%), Gaps = 3/201 (1%)

Query: 45  WKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEII 104
           W ++ R+RA   G+S  T    F +  +L   + RDR   T    + +DY    +S E +
Sbjct: 49  WVASFRSRAASRGISAATLDTAFRNAGFLPGVVKRDRSQ-TEFTRTLEDYFAIAASDEKV 107

Query: 105 AQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRR 164
           + G +  +    LL  ++  YGVPP I+ A+WG+E+ +GE  G  P++S  +TLAYD RR
Sbjct: 108 STGRSKLRQYGGLLQEIEGRYGVPPQIVTAVWGMESRYGERRGDIPVVSATSTLAYDGRR 167

Query: 165 AKFFTEQFFYALDLVKKG-VISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVK 223
           A FF  Q   AL ++++G   +S   G+  G +G  QF+P     YA+D   DG+ D+  
Sbjct: 168 ADFFESQLMAALRILQRGDTTASQLTGSWAGAMGHTQFIPTTYQDYAVDFRGDGRRDIWS 227

Query: 224 SN-IDAIASAAKFLAKLGWTK 243
            +  D +AS A +L++ GW +
Sbjct: 228 EDPTDGLASTANYLSRSGWRR 248


>gi|145299137|ref|YP_001141978.1| membrane-bound lytic murein transglycosylase [Aeromonas salmonicida
           subsp. salmonicida A449]
 gi|142851909|gb|ABO90230.1| membrane-bound lytic murein transglycosylase [Aeromonas salmonicida
           subsp. salmonicida A449]
          Length = 319

 Score =  128 bits (321), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 72/193 (37%), Positives = 109/193 (56%), Gaps = 2/193 (1%)

Query: 50  RARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIA 109
           +  A+  G+  +T    FAD+  ++  I  D+       V+   Y+        + Q  A
Sbjct: 32  KQEALAAGIKAETVAAAFADIRVIEPAIKHDKNQPEFK-VTLDTYIPRAVPQWKVNQARA 90

Query: 110 LKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFT 169
           L + +  LL  +  EY V P  ++ALWG+ET+FG+  GK PL+S+LATLA+D RR  FF 
Sbjct: 91  LYRQHLPLLTKIGAEYDVQPRFIVALWGVETNFGKLTGKFPLISSLATLAWDGRREAFFK 150

Query: 170 EQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDA 228
            Q F AL ++++G ++  A  G+  G +GQ QF+P + +KYA+D D DGK DL  +  D 
Sbjct: 151 GQLFDALHIIEQGHVTPAAFKGSWAGAMGQVQFMPSSFLKYAVDQDGDGKKDLWGNLADV 210

Query: 229 IASAAKFLAKLGW 241
             SAA +L + GW
Sbjct: 211 FGSAANYLHQNGW 223


>gi|297182413|gb|ADI18577.1| membrane-bound lytic murein transglycosylase b [uncultured
           Oceanospirillales bacterium HF4000_23O15]
          Length = 385

 Score =  128 bits (321), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 83/235 (35%), Positives = 126/235 (53%), Gaps = 24/235 (10%)

Query: 12  LMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLE 71
           +++  P+ AQA T  +              F EW +A RA A+  G+S  T     A L+
Sbjct: 1   MLLAVPIQAQAQTLEQS-------------FDEWITALRAEAIALGISEAT----LAALD 43

Query: 72  YLDTTIARDRKMVTSPP---VSFKDYLDGLSSSEI-IAQGIALKKANSRLLINLKKEYGV 127
            L+  ++R  ++  S P    +F  YL GL  +E  I +G +L + ++ LL  ++  YGV
Sbjct: 44  QLEP-VSRVLELDNSQPEFVQTFTHYL-GLRVTEAQIERGQSLLRQHAALLEEVRSRYGV 101

Query: 128 PPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSH 187
            P  L A W +E++FG   G   +L  LATLAYD RRA+FF  +   AL ++  G I++ 
Sbjct: 102 QPHYLAAFWAIESNFGRNTGGFSVLQALATLAYDPRRAEFFRRELLTALQIIDDGHIAAD 161

Query: 188 ALGATF-GEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
           ++  ++ G +GQ QFLP     Y +D D DG+ID+  S  D   SAA FL++ GW
Sbjct: 162 SMSGSWAGAMGQLQFLPSVFYSYGVDGDNDGRIDIWNSLPDIFHSAANFLSESGW 216


>gi|146338987|ref|YP_001204035.1| hypothetical protein BRADO1935 [Bradyrhizobium sp. ORS278]
 gi|146191793|emb|CAL75798.1| conserved hypothetical protein [Bradyrhizobium sp. ORS278]
          Length = 412

 Score =  128 bits (321), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 75/225 (33%), Positives = 121/225 (53%), Gaps = 4/225 (1%)

Query: 22  AVTQPKKATT-QFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARD 80
           A  +PK+A + +         F  + +  + RAV EG+S +        L Y    + RD
Sbjct: 6   AAPRPKQAPSMRAAACHNGQNFDRFLAELKQRAVAEGVSQRAIAAASPYLTYDQGIVNRD 65

Query: 81  RKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLET 140
           R       + F ++   +++   +  G    KA++      +KEYGVPP ++ A WGLE+
Sbjct: 66  RGQRVFGQL-FTEFAGRMAAVYRMQNGQQHIKAHAAAFARAEKEYGVPPAVIAAFWGLES 124

Query: 141 HFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQF 199
            FG  MG  P+L +L +LAYDCRR++ F  +   AL ++ +G ++ +  +G+  GE+GQ 
Sbjct: 125 DFGSNMGNLPVLPSLVSLAYDCRRSERFQNETIAALKVIDRGDLTPTEMIGSWAGELGQT 184

Query: 200 QFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAK-LGWTK 243
           QFLP + V Y +D D DG+ DL++S  D I S A ++A  L W +
Sbjct: 185 QFLPTHYVTYGVDYDGDGRRDLLRSAPDVIGSTANYIATGLKWRR 229


>gi|83645387|ref|YP_433822.1| membrane-bound lytic murein transglycosylase B [Hahella chejuensis
           KCTC 2396]
 gi|83633430|gb|ABC29397.1| Membrane-bound lytic murein transglycosylase B [Hahella chejuensis
           KCTC 2396]
          Length = 404

 Score =  128 bits (321), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 87/238 (36%), Positives = 128/238 (53%), Gaps = 16/238 (6%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPV--SFKDYLDGLS 99
           F E  +  + +A +EG+S K        ++  +  I  D K    P    +F +YL+   
Sbjct: 30  FAECVAGLQEKAKQEGISEKIVDEALGQVKLSERVIELDGK---QPEFIDTFTNYLNRRV 86

Query: 100 SSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLA 159
           + E + +G  +   ++ LL  + KE GVP   L+A WGLET++G   GK P+L +LATLA
Sbjct: 87  TDERVNKGREMLAKHAPLLDQIAKESGVPAQYLVAFWGLETNYGGYTGKMPILDSLATLA 146

Query: 160 YDCRRAKFFTEQFFYALDLVKKG-VISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGK 218
            D RR+ +FT +   AL +++KG V     LG+  G +G FQF+P   ++YA D D DGK
Sbjct: 147 CDPRRSGYFTGELMAALKIIEKGDVTVDKMLGSWAGAMGNFQFMPSVYLQYATDRDGDGK 206

Query: 219 IDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGE-----KNFAILKHWNASLNYNKTIA 271
            DL  S  DA ASA  FL  LGW    G++ G      +NFA   +  A L  +KT++
Sbjct: 207 RDLWGSLPDAAASAGLFLNGLGWQN--GFRWGREVKLPENFA---YGEAGLKRSKTLS 259


>gi|255264816|ref|ZP_05344158.1| lytic murein transglycosylase [Thalassiobium sp. R2A62]
 gi|255107151|gb|EET49825.1| lytic murein transglycosylase [Thalassiobium sp. R2A62]
          Length = 369

 Score =  127 bits (320), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 78/250 (31%), Positives = 129/250 (51%), Gaps = 21/250 (8%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F  W +A R RA+R G+S  T     A   ++   I RDR  + +   + ++YL   +S 
Sbjct: 36  FSSWLTAFRPRALRAGISAATVDRALASAGFVPGVITRDRTQIQTR-RTLEEYLSIATSD 94

Query: 102 EIIAQG-IALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAY 160
           + +A+G +AL +  S  L  ++  YGV   I+ A+WGLE+ FGE  G+ P++S+ ATLA+
Sbjct: 95  DRLAKGRVALARYGS-TLTAIQSRYGVDRHIIAAIWGLESQFGEKRGQVPVISSTATLAF 153

Query: 161 DCRRAKFFTEQFFYALDLVKKG-VISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKI 219
           + RRA F+  Q   AL ++ +G       LG+  G +G  QF+P +   +A+D + DG+ 
Sbjct: 154 EGRRAAFYESQLIAALRILDRGDTTPDQMLGSWAGAMGHTQFIPTSYRSFAVDFNGDGRR 213

Query: 220 DLVKSN-IDAIASAAKFLAKLGWTKCAGY----------------QPGEKNFAILKHWNA 262
           D+   +  DA+AS A +L++ GW     +                Q G   F + +++N 
Sbjct: 214 DIWGDDPTDALASTASYLSRNGWRSGLRWGAEAGTGGPSGRSIRPQRGGVQFTVTRNFNV 273

Query: 263 SLNYNKTIAY 272
              YN +  Y
Sbjct: 274 IKTYNNSDLY 283


>gi|270158264|ref|ZP_06186921.1| lytic murein transglycosylase family protein [Legionella
           longbeachae D-4968]
 gi|289163479|ref|YP_003453617.1| lytic murein transglycosylase [Legionella longbeachae NSW150]
 gi|269990289|gb|EEZ96543.1| lytic murein transglycosylase family protein [Legionella
           longbeachae D-4968]
 gi|288856652|emb|CBJ10463.1| lytic murein transglycosylase [Legionella longbeachae NSW150]
          Length = 323

 Score =  127 bits (320), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 114/204 (55%), Gaps = 7/204 (3%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPP---VSFKDYLDGL 98
           + +W +  RA A+++G+SP+     FA++      I   + ++ S P   ++F  Y +  
Sbjct: 24  WNQWVAGVRAEALQQGISPEIFDEAFANIHEPSHQI---KGLLHSQPEHRLTFIKYRNTR 80

Query: 99  SSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATL 158
             S  IA G    K N  +L  + K+YGV P  +++ WG+ET +G  MG  P++  LATL
Sbjct: 81  VDSYRIAIGRKEYKRNQAVLDAVAKQYGVNPCFIVSFWGMETSYGTYMGNFPVIKALATL 140

Query: 159 AYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDG 217
           AYD  R +FF ++ F AL ++ +G +  +   G   G  GQ QFLP + VKYA+D D DG
Sbjct: 141 AYDSNRKEFFRKELFIALRILNEGHVDLADFKGEWAGASGQPQFLPSSWVKYAVDYDGDG 200

Query: 218 KIDLVKSNIDAIASAAKFLAKLGW 241
           + D+ +S  D  AS A ++ + GW
Sbjct: 201 RKDIWRSKPDVFASIANYMKQNGW 224


>gi|238751616|ref|ZP_04613106.1| Lytic murein transglycosylase [Yersinia rohdei ATCC 43380]
 gi|238710178|gb|EEQ02406.1| Lytic murein transglycosylase [Yersinia rohdei ATCC 43380]
          Length = 322

 Score =  127 bits (320), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 69/199 (34%), Positives = 111/199 (55%), Gaps = 2/199 (1%)

Query: 50  RARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIA 109
           +A+A  +G+S  T    FA++ ++D  I  DR  +    V+  DYL  + +   I QG  
Sbjct: 33  KAQARAKGISDATLNLAFANIHFVDRVIQSDRNQLEKK-VTLDDYLAKVLTPSKIEQGKE 91

Query: 110 LKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFT 169
           + +     L  +   YGVP   ++ALWG+E+ FG+  GK  ++S L+TLA++ RR  FFT
Sbjct: 92  IYQRYQPQLSQVTARYGVPERYIVALWGMESGFGKIQGKEDVISALSTLAFEGRREAFFT 151

Query: 170 EQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDA 228
           ++   AL ++++G +    L G+  G +GQ QF+P + + Y  D D DGKID+  +  D 
Sbjct: 152 KELIAALQIIQQGKVDDPQLKGSWAGAMGQSQFMPSSFLTYGADGDGDGKIDIWNNIDDV 211

Query: 229 IASAAKFLAKLGWTKCAGY 247
            AS A +L+  GW    G+
Sbjct: 212 FASTANYLSTEGWKPGIGW 230


>gi|254436937|ref|ZP_05050431.1| hypothetical protein OA307_1807 [Octadecabacter antarcticus 307]
 gi|198252383|gb|EDY76697.1| hypothetical protein OA307_1807 [Octadecabacter antarcticus 307]
          Length = 146

 Score =  127 bits (319), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 88/146 (60%), Gaps = 1/146 (0%)

Query: 132 LMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGA 191
           ++ + G+E  FG  MG TP++ ++ T+AYDCRRA FFT     AL LV +G +  +  GA
Sbjct: 1   MLTIHGMENGFGRWMGSTPVVDSITTVAYDCRRAAFFTPHAIAALMLVDQGGLGPNQQGA 60

Query: 192 TFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGE 251
             GE+G  QFLP N ++Y +DAD +G +DL  S  D++AS A FL + GW     +Q G 
Sbjct: 61  AHGEMGHTQFLPGNALRYGVDADGNGHVDLY-SIRDSLASTANFLRQKGWQPSQSFQEGS 119

Query: 252 KNFAILKHWNASLNYNKTIAYIAAHI 277
            NF +L  WNA+    K I+  AA +
Sbjct: 120 ANFRVLNDWNAATVDQKAISLSAARL 145


>gi|254454008|ref|ZP_05067445.1| lytic murein transglycosylase [Octadecabacter antarcticus 238]
 gi|198268414|gb|EDY92684.1| lytic murein transglycosylase [Octadecabacter antarcticus 238]
          Length = 359

 Score =  127 bits (319), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 71/204 (34%), Positives = 109/204 (53%), Gaps = 3/204 (1%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F  W S  R RA R+G+   T    F  + Y  T I RDR   +    S  DYLD   S 
Sbjct: 53  FNAWISGFRNRATRQGILTATFDAAFDGIIYNTTVIERDRNQ-SEFTKSLWDYLDTAVSD 111

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
           E +  G      N +LL  ++  +GV   +++A+WGLE+ +G   G T ++  +ATLAYD
Sbjct: 112 ERVRNGRRALDNNRQLLNRIEDTFGVDKDVVVAIWGLESAYGAVRGSTNVIEAMATLAYD 171

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR +FF +Q   AL +++ G  +   + G+  G +G  QF+P + + YA+D + DG+ D
Sbjct: 172 GRRGEFFEQQLIAALQILQAGDTAPRNMTGSWAGAMGHTQFIPTSFLDYAVDGNGDGRRD 231

Query: 221 LVKSN-IDAIASAAKFLAKLGWTK 243
           +   +  DA+AS A +L   GW +
Sbjct: 232 IWADDPTDALASTANYLRSFGWVQ 255


>gi|104783758|ref|YP_610256.1| membrane-bound lytic murein transglycosylase [Pseudomonas
           entomophila L48]
 gi|95112745|emb|CAK17473.1| membrane-bound lytic murein transglycosylase [Pseudomonas
           entomophila L48]
          Length = 437

 Score =  127 bits (319), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 71/205 (34%), Positives = 114/205 (55%), Gaps = 6/205 (2%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKM--VTSPPVSFKDYLDGLS 99
           F +W++  R +A++ G+SP      F  +      I  DR     T P     +YLDG  
Sbjct: 66  FAQWQAGFRQQALQAGISPSLFDRAFLGVTPDMDVIKADRSQPEFTRP---VWEYLDGAL 122

Query: 100 SSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLA 159
           S   +  G  L + NS LL  +++ YGV   +L+++WG+E++FG+  G   ++ +LATLA
Sbjct: 123 SPLRVRNGKKLLEQNSELLSRIEQRYGVDRQVLVSVWGMESNFGQFQGSKSVIRSLATLA 182

Query: 160 YDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGK 218
           Y+ RR +F  +Q   AL +++ G I   A+ G+  G +GQ QF+P   + +A+D D DG+
Sbjct: 183 YEGRRPQFAQDQLIAALQILQNGDIQPDAMRGSWAGAMGQTQFIPTTYLTHAVDFDGDGR 242

Query: 219 IDLVKSNIDAIASAAKFLAKLGWTK 243
            D+  S  DA+AS A +L   GW +
Sbjct: 243 RDIWNSTADALASTAHYLQASGWKR 267


>gi|209964477|ref|YP_002297392.1| membrane-bound lytic murein transglycosylase B, putative
           [Rhodospirillum centenum SW]
 gi|209957943|gb|ACI98579.1| membrane-bound lytic murein transglycosylase B, putative
           [Rhodospirillum centenum SW]
          Length = 328

 Score =  127 bits (319), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 78/259 (30%), Positives = 135/259 (52%), Gaps = 12/259 (4%)

Query: 32  QFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSF 91
           Q   +  A  F  W  A R  A  +G+S  T +     ++ +   +  DR+      ++F
Sbjct: 21  QAAPAQAATDFAAWLEALRQDAGAQGISEATLREALTGVQPIPRVLELDRRQPEGT-ITF 79

Query: 92  KDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPL 151
             Y++ + +++ + +G  L + +  +L  + ++YGV P  ++ALWG+ET FG   G   +
Sbjct: 80  ARYIERVVTAQRVRRGRGLYRQHRAVLEEVGRKYGVQPRFIVALWGIETSFGSNQGGFKV 139

Query: 152 LSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISS-HALGATFGEIGQFQFLPVNVVKYA 210
           +  LATLAYD RR+ +F ++   AL ++ +  I +   LG+  G +GQ QF+P + ++YA
Sbjct: 140 IDALATLAYDGRRSAYFRKELINALRILDEDHIGADRMLGSWAGAMGQSQFMPSSFLRYA 199

Query: 211 IDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHW---NASLNYN 267
           +D D DGK D+  +  D  ASAA +L+ +GW     +    +   I KH+   +A L   
Sbjct: 200 VDFDRDGKRDIWGTLPDVFASAANYLSTVGWNPDRTWG---REVRIPKHFKESHAGLQTR 256

Query: 268 KTI----AYIAAHIDGVPI 282
           KT+    A     +DG P+
Sbjct: 257 KTLRDWQAMGVRQVDGGPL 275


>gi|148253742|ref|YP_001238327.1| hypothetical protein BBta_2243 [Bradyrhizobium sp. BTAi1]
 gi|146405915|gb|ABQ34421.1| hypothetical protein BBta_2243 [Bradyrhizobium sp. BTAi1]
          Length = 412

 Score =  127 bits (319), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 70/196 (35%), Positives = 110/196 (56%), Gaps = 3/196 (1%)

Query: 50  RARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIA 109
           + RAV EG+S +        L Y    + RDR       + F ++   +++   +  G  
Sbjct: 35  KQRAVAEGVSQRAIAAASPYLTYDQGIVNRDRGQRVFGQL-FTEFAGRMAAVYRMQNGQQ 93

Query: 110 LKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFT 169
             K ++      +K+YGVPP ++ A WGLE+ FG  MG  P+L +L +LAYDCRR++ F 
Sbjct: 94  HIKMHAAAFARAEKDYGVPPAVIAAFWGLESDFGANMGNLPVLPSLVSLAYDCRRSERFQ 153

Query: 170 EQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDA 228
            +   AL ++ +G +S +  +G+  GE+GQ QFLP + V YA+D D DG+ DL++S  D 
Sbjct: 154 NETIAALKVIDRGDLSPTEMIGSWAGELGQTQFLPTHYVTYAVDYDGDGRRDLLRSAPDV 213

Query: 229 IASAAKFLAK-LGWTK 243
           I S A ++A  L W +
Sbjct: 214 IGSTANYIATGLKWRR 229


>gi|300723135|ref|YP_003712433.1| putative lipoprotein [Xenorhabdus nematophila ATCC 19061]
 gi|297629650|emb|CBJ90253.1| putative lipoprotein precursor [Xenorhabdus nematophila ATCC 19061]
          Length = 361

 Score =  127 bits (319), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 71/203 (34%), Positives = 110/203 (54%), Gaps = 9/203 (4%)

Query: 50  RARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIA 109
           + +A  +G S KT +  F+++ ++   I  DR        +  DYL  +  +  I QG+ 
Sbjct: 65  KQQAREQGFSEKTVERAFSNIHFIPRVIKADRNQ-PEKKATLDDYLSRVLPAWKIEQGVT 123

Query: 110 LKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFT 169
             K +   L  + ++YGVP   ++ALWGLE+ FG+  GK  ++S LATLA++ RR  FF 
Sbjct: 124 QYKNHLPQLEKISRKYGVPKAYIVALWGLESGFGKIQGKEDVISALATLAFEGRREVFFI 183

Query: 170 EQFFYALDLVKKGVISSHAL--GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNID 227
           +Q   AL++++   I       G+  G +GQ QF+P + + Y  D D DG+ID+  +  D
Sbjct: 184 KQLLAALEIMENQYIGEGQTLNGSWAGAMGQSQFMPTSYLTYGADGDGDGRIDIWNNKED 243

Query: 228 AIASAAKFLAKLGWTKCAGYQPG 250
             AS A +LAK GW      QPG
Sbjct: 244 VFASTANYLAKEGW------QPG 260


>gi|71083687|ref|YP_266407.1| membrane-bound lytic transglycolase-related protein [Candidatus
           Pelagibacter ubique HTCC1062]
 gi|71062800|gb|AAZ21803.1| membrane-bound lytic transglycolase-related protein [Candidatus
           Pelagibacter ubique HTCC1062]
          Length = 333

 Score =  127 bits (319), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 75/207 (36%), Positives = 120/207 (57%), Gaps = 9/207 (4%)

Query: 41  RFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKD---YLDG 97
            F EW    +A A+ + +S KT     +D+ +L   I  DR      P  ++D   Y+  
Sbjct: 25  EFKEWLVNFKAYALEKKISEKTFNLAMSDVVFLPDVIKYDR----FQPEFYEDTKTYISK 80

Query: 98  LSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLAT 157
            +S + ++ GI L + N   + ++  ++ V   +L+AL G+ET+FG  +GK  +LS+LAT
Sbjct: 81  RTSKQKVSAGIKLYELNKDFINSVDNKFSVEKELLLALMGIETNFGTYVGKMDILSSLAT 140

Query: 158 LAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADED 216
           L+YD RR+ FFT++    L L+ +G I+ + L G+  G  G FQF+P  +  YAID D++
Sbjct: 141 LSYDQRRSDFFTKELITILQLIDEGKINHNILYGSWAGAFGFFQFMPSTIDNYAIDYDKN 200

Query: 217 GKIDLVKSNIDAIASAAKFLAKLGWTK 243
             I+L KS  D+ ASAA ++ K+GW K
Sbjct: 201 NIIEL-KSTKDSFASAANYINKIGWKK 226


>gi|300021906|ref|YP_003754517.1| lytic murein transglycosylase [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299523727|gb|ADJ22196.1| lytic murein transglycosylase [Hyphomicrobium denitrificans ATCC
           51888]
          Length = 412

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 71/242 (29%), Positives = 123/242 (50%), Gaps = 6/242 (2%)

Query: 6   YLLISLLMMVYPMLAQAV---TQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKT 62
           +L+ S+  M +  ++ A      P     +  C +T   F  W +  R  A+ EG+   T
Sbjct: 5   FLIFSIATMAFASMSGAAFAEATPPPPANKRNCQNTVP-FQRWLADFRREAIAEGIHAGT 63

Query: 63  AKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLK 122
                  +    + +ARDRK       +F D+   L+++     G +  +    +    +
Sbjct: 64  IDDAIGGMTPDMSVVARDRKQGFFSQ-TFIDFYFKLATNGREKMGKSYLQRYKSIFDRAE 122

Query: 123 KEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKG 182
           ++YGVP  ++   W LE+ FG  MG   ++ +L TLA+DCRR  FF  +   AL ++++G
Sbjct: 123 QQYGVPGAVITGFWALESDFGGGMGNLSVMRSLVTLAWDCRRGDFFRNELKAALKIIERG 182

Query: 183 -VISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
            + +   +G+  GE+GQ QFLP +   Y +D D DG++DL++   D I S+A F+A +GW
Sbjct: 183 DLTADQMIGSWAGELGQTQFLPQHYYNYGVDYDGDGRVDLIRDIPDIIGSSANFIASMGW 242

Query: 242 TK 243
            +
Sbjct: 243 KR 244


>gi|110833131|ref|YP_691990.1| glycosidases [Alcanivorax borkumensis SK2]
 gi|110646242|emb|CAL15718.1| glycosidases [Alcanivorax borkumensis SK2]
          Length = 401

 Score =  127 bits (318), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 75/197 (38%), Positives = 109/197 (55%), Gaps = 6/197 (3%)

Query: 50  RARAVREGMSPKTAKHLFADLEYLDTTIARDRKM--VTSPPVSFKDYLDGLSSSEIIAQG 107
           RA+A  EG+  +        ++  +  I  DR     TS   SF DY     S   I  G
Sbjct: 36  RAQAHEEGIPAQVISRSLNTVKLNERVIELDRSQPEFTS---SFSDYYTRRVSETRIETG 92

Query: 108 IALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKF 167
               +    LL  L +EYGVP   L+A WGLET++G  +G  P+L +L+TLA + RR ++
Sbjct: 93  RKKYREQQPLLQELAREYGVPGHYLVAFWGLETNYGGFLGSIPVLDSLSTLACEGRRGEY 152

Query: 168 FTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNI 226
           F+ + F AL +++ G   +  + G+  G +GQ QF+P   ++YA+D D DGK +L KS  
Sbjct: 153 FSGELFNALRIIQAGDAEAKQMEGSWAGAMGQTQFMPAVFLRYAVDHDGDGKRNLWKSTD 212

Query: 227 DAIASAAKFLAKLGWTK 243
           DA+ASAA FL  LGW +
Sbjct: 213 DALASAANFLQGLGWER 229


>gi|255077103|ref|XP_002502203.1| glycoside hydrolase family 103 protein [Micromonas sp. RCC299]
 gi|226517468|gb|ACO63461.1| glycoside hydrolase family 103 protein [Micromonas sp. RCC299]
          Length = 442

 Score =  127 bits (318), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 82/253 (32%), Positives = 126/253 (49%), Gaps = 29/253 (11%)

Query: 15  VYPMLAQAVTQP---KKATTQFICSD-------------------TADRFGEWKSAARAR 52
           V P +A  VTQP   + ATT     D                       F  W    R  
Sbjct: 74  VSPFVASTVTQPGVARAATTWKSMKDLPAIEPGAHPALTVRELTPRQREFTAWLDGVREE 133

Query: 53  AVREGMSPKTAKHLFADLEYLDTTIARD--RKMVTSPP--VSFKDYLDGLSSSEIIAQGI 108
            +R G+S +T    F +LE L  T+        V +P   +S + YL  + S + + +G 
Sbjct: 134 CIRRGISEETVGSCFNELEPLPETVVEKTASSHVLNPEKNLSVEAYLRRMVSKDRVTKGA 193

Query: 109 ALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAK-- 166
           AL   ++ LL  +++EYGVPP IL+A+WG+E+HFG   G+   +  LATL ++ R  K  
Sbjct: 194 ALLVEHAELLNEVEREYGVPPEILVAIWGIESHFGGFQGEHDCIRALATLGFEHRHWKGD 253

Query: 167 FFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSN 225
           +F  +   A+ ++ +G +    L G+  G +GQ QF+P N  +YA+D D+DG+ D+ +S 
Sbjct: 254 YFGNELVEAVRIIDEGHVPPEDLVGSWAGALGQCQFMPSNFHRYAVDKDDDGRADIWRSL 313

Query: 226 IDAIASAAKFLAK 238
            D  AS A FL +
Sbjct: 314 PDVFASMANFLKQ 326


>gi|238788493|ref|ZP_04632286.1| Lytic murein transglycosylase [Yersinia frederiksenii ATCC 33641]
 gi|238723406|gb|EEQ15053.1| Lytic murein transglycosylase [Yersinia frederiksenii ATCC 33641]
          Length = 359

 Score =  127 bits (318), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 69/199 (34%), Positives = 109/199 (54%), Gaps = 2/199 (1%)

Query: 50  RARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIA 109
           + +A   G+S  T    FA++ ++D  I  DR  +    V+  DYL  + ++  I QG  
Sbjct: 70  KTQARVNGISDATLNVAFANIHFVDRVIQSDRNQL-EKKVTLDDYLAKVLTANRIKQGKE 128

Query: 110 LKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFT 169
             +     L  +   YGVP   ++ALWGLE+ FG+  GK  ++S L+TLA++ RR  FFT
Sbjct: 129 NYQRYRPQLSQVTARYGVPERYIVALWGLESSFGKIQGKEDVISALSTLAFEGRREAFFT 188

Query: 170 EQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDA 228
           ++   AL ++++G +    L G+  G +GQ QF+P + + Y  D D DGKID+  +  D 
Sbjct: 189 QELMAALQIIQQGKVEDRQLKGSWAGAMGQSQFMPSSFLTYGADGDGDGKIDIWNNIDDV 248

Query: 229 IASAAKFLAKLGWTKCAGY 247
            AS A +L+  GW    G+
Sbjct: 249 FASTANYLSTEGWQPDIGW 267


>gi|330814084|ref|YP_004358323.1| membrane-bound lytic murein transglycosylase B precursor
           [Candidatus Pelagibacter sp. IMCC9063]
 gi|327487179|gb|AEA81584.1| membrane-bound lytic murein transglycosylase B precursor
           [Candidatus Pelagibacter sp. IMCC9063]
          Length = 326

 Score =  126 bits (317), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 74/206 (35%), Positives = 118/206 (57%), Gaps = 7/206 (3%)

Query: 42  FGEWKSAARARAV-REGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKD--YLDGL 98
           F  W    + +A+ +EG+S  T    F+ +++L   +  D++    P    K   Y+   
Sbjct: 27  FDIWVVDFKKKAIEKEGISSATVNKAFSRVKFLKKLLIYDKRQ---PEFIEKTETYIGKR 83

Query: 99  SSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATL 158
            + + + +  +L   N  LL  ++K++GVP   L+ALWG+ET FG   GK  ++S LATL
Sbjct: 84  VNKKRVLKAKSLLLENKNLLSRIEKDFGVPKEYLVALWGIETSFGRHRGKVDIISALATL 143

Query: 159 AYDCRRAKFFTEQFFYALDLV-KKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDG 217
           ++D RR+ +F+++    L L+ KK V   +  G+  G  G FQF+P ++  YAID D+DG
Sbjct: 144 SFDKRRSAYFSKELITILRLIDKKKVKLENLYGSWAGAHGNFQFMPSSINNYAIDYDKDG 203

Query: 218 KIDLVKSNIDAIASAAKFLAKLGWTK 243
           +IDLV S  D+ ASAA +L  +GW K
Sbjct: 204 QIDLVNSLEDSFASAANYLKTIGWNK 229


>gi|238765468|ref|ZP_04626388.1| Lytic murein transglycosylase [Yersinia kristensenii ATCC 33638]
 gi|238696325|gb|EEP89122.1| Lytic murein transglycosylase [Yersinia kristensenii ATCC 33638]
          Length = 355

 Score =  126 bits (317), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 70/197 (35%), Positives = 110/197 (55%), Gaps = 6/197 (3%)

Query: 46  KSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIA 105
           KS ARA+ + E     T    FA++ ++D  I  DR  +    V+  DYL  + +   IA
Sbjct: 68  KSQARAQGITEA----TLDIAFANIHFVDRVIQSDRNQLEK-KVTLDDYLAKVLTPSKIA 122

Query: 106 QGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRA 165
           QG  + +     L  +   YGVP   ++ALWG+E+ FG+  GK  ++S L+TLA++ RR 
Sbjct: 123 QGREIYQRYQPQLSQVTARYGVPERYIVALWGMESGFGKIQGKEDVISALSTLAFEGRRE 182

Query: 166 KFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKS 224
            FFT++   AL ++++G +    L G+  G +GQ QF+P + + Y  D D DGK+D+  +
Sbjct: 183 AFFTKELMAALKIIQQGRVEDPQLKGSWAGAMGQSQFMPSSFLTYGADGDGDGKVDIWNN 242

Query: 225 NIDAIASAAKFLAKLGW 241
             D  AS A +L+  GW
Sbjct: 243 IDDVFASTANYLSTEGW 259


>gi|325276751|ref|ZP_08142465.1| lytic murein transglycosylase [Pseudomonas sp. TJI-51]
 gi|324098115|gb|EGB96247.1| lytic murein transglycosylase [Pseudomonas sp. TJI-51]
          Length = 438

 Score =  126 bits (316), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 71/204 (34%), Positives = 113/204 (55%), Gaps = 4/204 (1%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVT-SPPVSFKDYLDGLSS 100
           F +W++  R +A++ G+SP      F  +      I  DR     S PV   +YL+G  S
Sbjct: 66  FAQWQAGFREQALQAGISPSIFDRAFLGVTPDMDVIKADRSQPEFSRPV--WEYLEGALS 123

Query: 101 SEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAY 160
              +  G  L   N+ LL  +++ YGV   +L+A+WG+E++FG+  G   ++ +LATLAY
Sbjct: 124 PLRVRNGKRLLDQNAELLTRIEQRYGVDRQVLVAVWGMESNFGQFQGNKSVIRSLATLAY 183

Query: 161 DCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKI 219
           + RR +F  +Q   AL +++ G I   A+ G+  G +GQ QF+P     +A+D D DG+ 
Sbjct: 184 EGRRPQFAQDQLIAALQIIQHGDIQPEAMRGSWAGAMGQTQFIPTTYNTHAVDFDGDGRR 243

Query: 220 DLVKSNIDAIASAAKFLAKLGWTK 243
           D+  S  DA+AS A +L   GW +
Sbjct: 244 DIWNSTPDALASTAHYLQSSGWKR 267


>gi|183599030|ref|ZP_02960523.1| hypothetical protein PROSTU_02475 [Providencia stuartii ATCC 25827]
 gi|188021246|gb|EDU59286.1| hypothetical protein PROSTU_02475 [Providencia stuartii ATCC 25827]
          Length = 360

 Score =  126 bits (316), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 69/204 (33%), Positives = 110/204 (53%), Gaps = 5/204 (2%)

Query: 50  RARAVREGMSPKTAKHLFADLEYLDTTIARDR-KMVTSPPVSFKDYLDGLSSSEIIAQGI 108
           +  A+ +G+ P T +  FA + +++  +  D+ +      V+ + YL  +  +  I  G 
Sbjct: 66  KEHALAQGIQPATIERGFAHIHFIERVVKADKGQPEKRATVTLESYLKNVLPASRINAGA 125

Query: 109 ALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFF 168
                N  LL  +   YGVPP  ++ALWGLE+ FG + GK  ++S LATL+++ RR   F
Sbjct: 126 EKYWENESLLNAISHRYGVPPQYIVALWGLESGFGRSQGKEDVISALATLSFEGRREALF 185

Query: 169 TEQFFYALDLVKKGVISSHAL--GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNI 226
           ++Q   AL+++ KG I       G+  G +GQ QF+P + + YA D D DGK+D+  +  
Sbjct: 186 SKQLLAALEIMDKGYIPEEQQLKGSWAGAMGQSQFMPTSYLSYAADGDGDGKMDIWNNKA 245

Query: 227 DAIASAAKFLAKLGWTKCA--GYQ 248
           D  AS A +L+  GW      GYQ
Sbjct: 246 DVFASIANYLSTEGWQSALPWGYQ 269


>gi|332141835|ref|YP_004427573.1| putative transglycosylase [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|327551857|gb|AEA98575.1| putative transglycosylase [Alteromonas macleodii str. 'Deep
           ecotype']
          Length = 353

 Score =  126 bits (316), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 78/240 (32%), Positives = 127/240 (52%), Gaps = 6/240 (2%)

Query: 5   KYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADR-FGEWKSAARARAVREGMSPKTA 63
           K L+ S + +++ ML   ++   +A T    S+  +R F  + +  +  A+ +G+     
Sbjct: 22  KRLIASKVPLIFIMLTLLLSASIEAATN---SELTERGFNAYVAQLKEEALSKGIDRPLL 78

Query: 64  KHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKK 123
              FAD+ +  T +  D+       ++  DYL        + Q +A  K +  LL  + +
Sbjct: 79  DAAFADIAFRPTVVKSDKNQ-PEKKITLDDYLATRVPDWKVKQAVAQYKDHKALLEEIAQ 137

Query: 124 EYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGV 183
            YGV    ++ALWG E++FG+  G   +LS LA+LAY+ RR K F + FF AL ++ KG 
Sbjct: 138 RYGVQSRFIVALWGNESNFGKIQGNYSVLSALASLAYEGRREKLFKDNFFAALQILAKGH 197

Query: 184 ISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWT 242
            S + L G+  G +GQ QF+PV+ + YA+D D DG+ D+  +  D  AS A +LA  GW 
Sbjct: 198 TSVNELKGSWAGAMGQTQFMPVSFLNYAVDYDGDGRKDIWGTKADVFASIANYLASEGWN 257


>gi|146276109|ref|YP_001166268.1| lytic murein transglycosylase [Rhodobacter sphaeroides ATCC 17025]
 gi|145554350|gb|ABP68963.1| lytic murein transglycosylase [Rhodobacter sphaeroides ATCC 17025]
          Length = 421

 Score =  125 bits (315), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 75/199 (37%), Positives = 107/199 (53%), Gaps = 3/199 (1%)

Query: 45  WKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEII 104
           W    R RA+  G+ P+T    F  + Y    +ARDR        +  DYLD   S   I
Sbjct: 54  WIVEFRPRALAAGIRPETLAAAFRGVRYDAEAVARDRNQAEFN-RTLWDYLDSAVSEVRI 112

Query: 105 AQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRR 164
           A G A    +  LL  ++  YGVP  I++A+WG+ET +G   G  PL+  LATLA+D RR
Sbjct: 113 ANGRAALVRHGALLERIEARYGVPKEIVVAVWGMETSYGTRRGDHPLVGALATLAHDGRR 172

Query: 165 AKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVK 223
           A FF EQ   AL ++  G +   A+ G+  G +G  QF+P + + +A+D   DG+ D+  
Sbjct: 173 AAFFEEQLIAALKILDTGDVRPEAMTGSWAGAMGHTQFMPTSYLAHAVDFTGDGRRDIWS 232

Query: 224 SN-IDAIASAAKFLAKLGW 241
            +  DA+AS A +LA  GW
Sbjct: 233 EDPSDALASTAAYLAGSGW 251


>gi|159042572|ref|YP_001531366.1| lytic murein transglycosylase [Dinoroseobacter shibae DFL 12]
 gi|157910332|gb|ABV91765.1| lytic murein transglycosylase [Dinoroseobacter shibae DFL 12]
          Length = 415

 Score =  125 bits (315), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 74/205 (36%), Positives = 106/205 (51%), Gaps = 3/205 (1%)

Query: 41  RFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSS 100
           RF  W  A   RA   G+ P T +  FA ++YL   I RDR           +YLD   S
Sbjct: 46  RFEAWIGAFERRARAAGIRPATFRAAFAGVDYLPDVIRRDRSQAEFTK-QIWEYLDSAVS 104

Query: 101 SEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAY 160
              +  G A   A    L  +++ YGV   ++ A+WGLE+ +G   G TP LS +ATLAY
Sbjct: 105 DARLRNGRAAFAARRDTLRAIERRYGVEAEVVTAIWGLESAYGSYRGATPTLSAMATLAY 164

Query: 161 DCRRAKFFTEQFFYALDLVKKG-VISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKI 219
           + RRA FF +Q   AL +++ G        G+  G +G  QF+P + + YA+D   DG+ 
Sbjct: 165 EGRRAAFFEDQLIAALKILQDGDTTPGRMTGSWAGAMGHTQFMPTSYLDYAVDFTGDGRR 224

Query: 220 DLVKSN-IDAIASAAKFLAKLGWTK 243
           D+   +  DA+AS A +L   GWT+
Sbjct: 225 DIWGEDPTDALASTAAYLEAFGWTR 249


>gi|212212629|ref|YP_002303565.1| membrane-bound lytic murein transglycosylase B [Coxiella burnetii
           CbuG_Q212]
 gi|212011039|gb|ACJ18420.1| membrane-bound lytic murein transglycosylase B [Coxiella burnetii
           CbuG_Q212]
          Length = 333

 Score =  125 bits (315), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 77/249 (30%), Positives = 122/249 (48%), Gaps = 22/249 (8%)

Query: 1   MSFKKYLLISLLMMVYPML-------AQAVTQPKKATTQFICSDTADRFGEWKSAARARA 53
           M+ +K++L+S L+             A+AV QP  A               W    R  A
Sbjct: 1   MTKRKFILLSALIFFLSAWLLLDNSSARAVQQPSWAV--------------WVKQLREEA 46

Query: 54  VREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKA 113
           +  G+ P+     F+ ++     +    ++     ++F  Y    +    I  G A  + 
Sbjct: 47  ISRGIRPEVFDQAFSTVKEPSRKVMHLERIQPERRITFLKYRSTRADPFRIRIGRAKYQK 106

Query: 114 NSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFF 173
           + R+L  +  +YGV P  +++LWG+ET +G  MG  P++ +LATLAY+ +R  FF +Q F
Sbjct: 107 HHRILTEIGNKYGVNPCFIVSLWGMETSYGSYMGNFPVIQSLATLAYESQRKAFFRKQLF 166

Query: 174 YALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASA 232
           YAL+++  G ++     G   G  GQ QFLP +   YA+D D DG+ D+     DA AS 
Sbjct: 167 YALEILNGGHVTLQNFKGEWAGASGQPQFLPSSWHNYAVDYDGDGRKDIWNDLPDAFASI 226

Query: 233 AKFLAKLGW 241
           A +LAK GW
Sbjct: 227 ANYLAKHGW 235


>gi|91793495|ref|YP_563146.1| lytic murein transglycosylase [Shewanella denitrificans OS217]
 gi|91715497|gb|ABE55423.1| Lytic murein transglycosylase [Shewanella denitrificans OS217]
          Length = 437

 Score =  125 bits (315), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 72/192 (37%), Positives = 105/192 (54%), Gaps = 2/192 (1%)

Query: 53  AVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKK 112
           A + G+S    +   A ++++D  IA D +       SF DY +   +   + QG     
Sbjct: 77  ARQRGVSEHIIESSLAKVKFVDKVIALDGQQ-PEFSTSFADYFEKRVTPWRVEQGRKYFA 135

Query: 113 ANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQF 172
            +  LL  L ++YGVP   +MA WGLET+FG   G  P+L +LATLA + RRA++FT + 
Sbjct: 136 IHRELLNQLTQKYGVPGQYIMAFWGLETNFGSYKGSMPVLDSLATLACNPRRAEYFTAEL 195

Query: 173 FYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIAS 231
             AL L +K   +S  + G+  G +G  QF+P     +A+D D DGK+DL  S  D + S
Sbjct: 196 MQALKLQEKYQFNSRDMVGSWAGAMGHTQFMPTTYANHAVDGDGDGKVDLWNSVADGLTS 255

Query: 232 AAKFLAKLGWTK 243
           AA FL  LGW +
Sbjct: 256 AANFLHSLGWKE 267


>gi|82494640|gb|ABB79949.1| translycolase-related protein [uncultured bacterium pES01019D12]
          Length = 409

 Score =  125 bits (314), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 74/210 (35%), Positives = 113/210 (53%), Gaps = 8/210 (3%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F + K+  + RA  EG+ P T  H+   ++Y    I  D++       SF +Y     ++
Sbjct: 35  FEQCKANLKDRARAEGIDPSTINHVLDAVDYNAKVIELDQRQ-PEFTRSFGNYYHLRVTT 93

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             +A G AL   +  LL  ++++ GVPP  L+A WGLET+FG   G   +  +L TLA D
Sbjct: 94  SRVAIGRALLATHIDLLQRVRRQTGVPPHYLVAFWGLETNFGNIFGNMSVPDSLTTLACD 153

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR++FF+ +   AL +++ G +    + G+  G +G  QF+P   + YA+D D DG+ D
Sbjct: 154 PRRSEFFSAELMNALRIIEAGDVEVEKMRGSWAGAMGHVQFMPSAYLNYAVDGDGDGRRD 213

Query: 221 LVKSNIDAIASAAKFLAKLGWTKCAGYQPG 250
           L  S  DA+ SA  FL +LGW      QPG
Sbjct: 214 LWGSIPDAMFSAGNFLQQLGW------QPG 237


>gi|310817038|ref|YP_003965002.1| membrane-bound lytic murein transglycosylase B [Ketogulonicigenium
           vulgare Y25]
 gi|308755773|gb|ADO43702.1| membrane-bound lytic murein transglycosylase B [Ketogulonicigenium
           vulgare Y25]
          Length = 419

 Score =  125 bits (314), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 66/200 (33%), Positives = 111/200 (55%), Gaps = 3/200 (1%)

Query: 44  EWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEI 103
            W+++ R RA+  G+S +T    F +  YL   +  DR        +   YL   +S   
Sbjct: 56  NWQASFRPRALAAGISARTFDAAFRNATYLPNVVENDRNQAEFT-RALGAYLSTAASDAR 114

Query: 104 IAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCR 163
           +  G A+   ++ LL  +++ YGV   I++A+WG+E+++G   G  P++S L+TLAYD R
Sbjct: 115 VENGRAMLAQHANLLSQIEQRYGVDRHIVVAVWGMESNYGARRGDVPIISALSTLAYDGR 174

Query: 164 RAKFFTEQFFYALDLVKKG-VISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLV 222
           RA FF  Q   AL +++     + H LG+  G +G  QF+P + ++YA+D   DG+ D+ 
Sbjct: 175 RASFFENQLIAALRIIQANDTDAEHMLGSWAGAMGHTQFMPTSFLEYAVDFRGDGRRDIW 234

Query: 223 KSN-IDAIASAAKFLAKLGW 241
             +  D +AS A +L++ GW
Sbjct: 235 SDDPTDGLASTAAYLSRHGW 254


>gi|126733869|ref|ZP_01749616.1| Membrane-bound lytic murein transglycosylase B [Roseobacter sp.
           CCS2]
 gi|126716735|gb|EBA13599.1| Membrane-bound lytic murein transglycosylase B [Roseobacter sp.
           CCS2]
          Length = 399

 Score =  125 bits (313), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 80/247 (32%), Positives = 128/247 (51%), Gaps = 22/247 (8%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSP 60
           M  + ++  SL  +  P LA A                A  F  W +A R RA   G++ 
Sbjct: 5   MHRRHFIAASLSTIALPSLATA---------------QASGFQNWIAAFRGRARAAGIND 49

Query: 61  KTAKHLFADLEYLDTTIARDRKMV--TSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLL 118
           +T    FAD++YL  +I RDR       P     DY+    S   ++ G  + +  + LL
Sbjct: 50  RTFNAAFADIQYLPDSIERDRNQAEFVRP---LADYMSTAVSDTRVSNGRDMVRRYAGLL 106

Query: 119 INLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDL 178
             ++  + V P +++A+WG+E+++G+  G TPL+STLATLAYD RR +FF  Q   AL +
Sbjct: 107 AQIEARFDVEPQVVVAVWGMESNYGQRRGDTPLISTLATLAYDGRRGQFFESQLIAALKI 166

Query: 179 VKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSN-IDAIASAAKFL 236
           ++ G ++   + G+  G +G  QF+P +   YA+D   DG+ D+   +  DA+AS A + 
Sbjct: 167 LQNGDVAPRNMTGSWAGAMGHTQFIPTSYEAYAVDFTGDGRRDIWTDDPSDALASTAAYF 226

Query: 237 AKLGWTK 243
            + GW K
Sbjct: 227 RRFGWRK 233


>gi|222833254|gb|EEE71731.1| predicted protein [Populus trichocarpa]
          Length = 398

 Score =  125 bits (313), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 81/232 (34%), Positives = 118/232 (50%), Gaps = 7/232 (3%)

Query: 14  MVYPMLAQAVTQPKKATTQFICSDT-ADRFGEWKSAARARAVREGMSPKTAKHLF--ADL 70
           M  P    A  QP+ AT         A  F  WK     +A+  G+S KT +     A L
Sbjct: 1   MPAPTAPVAPVQPEPATAPDAAQQAEATSFEAWKRDFARKALDAGISEKTVRSALEPARL 60

Query: 71  EYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPG 130
           +     + R +   T  P     YLD   S++ IAQG A  +  +  L +  + YGVP  
Sbjct: 61  QRRAVQLDRSQPEFTRTPWQ---YLDSAVSAQRIAQGRAKLREAAAPLQSASQRYGVPAE 117

Query: 131 ILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVI-SSHAL 189
           ++ A+WG+E++FG   G  P +  LATLA+D RRA +  ++   AL ++  G I ++H +
Sbjct: 118 VIAAIWGMESNFGGNFGNFPTVDALATLAFDGRRAAWAQKELLAALRIIDNGDIDAAHMI 177

Query: 190 GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
           G+  G +G  QFLP   + YA+DAD DG+ D+  S  D  AS A +LA  GW
Sbjct: 178 GSWAGAMGHTQFLPSVFLAYAVDADGDGRRDIWGSLPDVTASTANYLAHSGW 229


>gi|160897467|ref|YP_001563049.1| lytic murein transglycosylase [Delftia acidovorans SPH-1]
 gi|160363051|gb|ABX34664.1| lytic murein transglycosylase [Delftia acidovorans SPH-1]
          Length = 457

 Score =  125 bits (313), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 81/232 (34%), Positives = 118/232 (50%), Gaps = 7/232 (3%)

Query: 14  MVYPMLAQAVTQPKKATTQFICSDT-ADRFGEWKSAARARAVREGMSPKTAKHLF--ADL 70
           M  P    A  QP+ AT         A  F  WK     +A+  G+S KT +     A L
Sbjct: 60  MPAPTAPVAPVQPEPATAPDAAQQAEATSFEAWKRDFARKALDAGISEKTVRSALEPARL 119

Query: 71  EYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPG 130
           +     + R +   T  P     YLD   S++ IAQG A  +  +  L +  + YGVP  
Sbjct: 120 QRRAVQLDRSQPEFTRTPWQ---YLDSAVSAQRIAQGRAKLREAAAPLQSASQRYGVPAE 176

Query: 131 ILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVI-SSHAL 189
           ++ A+WG+E++FG   G  P +  LATLA+D RRA +  ++   AL ++  G I ++H +
Sbjct: 177 VIAAIWGMESNFGGNFGNFPTVDALATLAFDGRRAAWAQKELLAALRIIDNGDIDAAHMI 236

Query: 190 GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
           G+  G +G  QFLP   + YA+DAD DG+ D+  S  D  AS A +LA  GW
Sbjct: 237 GSWAGAMGHTQFLPSVFLAYAVDADGDGRRDIWGSLPDVTASTANYLAHSGW 288


>gi|307611802|emb|CBX01515.1| hypothetical protein LPW_32021 [Legionella pneumophila 130b]
          Length = 320

 Score =  125 bits (313), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 68/204 (33%), Positives = 108/204 (52%), Gaps = 1/204 (0%)

Query: 39  ADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGL 98
           +  + +W +  R  A+++G+ P      FA +      I    +      ++F  Y +  
Sbjct: 21  SQSWNQWVAGVREEALQQGIPPSLFDEAFAGIHEPSRKIKGFLRSQPEHRLTFMKYRNTR 80

Query: 99  SSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATL 158
           + +  I  G    K N  +L  + ++YGV P  +++ WG+ET +G  MG  P+++ LATL
Sbjct: 81  ADNYRIVIGRKEYKRNKEILEEIAQQYGVNPCFIVSFWGMETSYGSYMGNFPVINALATL 140

Query: 159 AYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDG 217
           AYD  R  FF ++ F AL ++K G +S +   G   G  GQ QFLP + VKYA+D D DG
Sbjct: 141 AYDSNRKDFFRKELFLALHILKGGHVSLADFKGEWAGASGQPQFLPSSWVKYAVDYDGDG 200

Query: 218 KIDLVKSNIDAIASAAKFLAKLGW 241
           + D+ KS  D  AS A ++ + GW
Sbjct: 201 RKDIWKSKPDVFASIANYMKQNGW 224


>gi|260429209|ref|ZP_05783186.1| peptidoglycan binding domain protein [Citreicella sp. SE45]
 gi|260419832|gb|EEX13085.1| peptidoglycan binding domain protein [Citreicella sp. SE45]
          Length = 423

 Score =  125 bits (313), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 74/204 (36%), Positives = 112/204 (54%), Gaps = 3/204 (1%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F +W    R+RA+ +G++P+     F  +EY    I RDR         +  YLD  +S 
Sbjct: 55  FADWVRDFRSRALEQGITPEVFDAAFRGVEYDPKVIERDRNQNEFTKTVWV-YLDSAASE 113

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             IA G      N  LL  +++ YGV    ++A+WGLE+ FG   G  P++ +LA+LAYD
Sbjct: 114 ARIAAGKKALAENRALLDRIEERYGVDKQAVVAIWGLESAFGTFRGTEPVIRSLASLAYD 173

Query: 162 CRRAKFFTEQFFYALDLVKKG-VISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR  FF  Q   AL +++ G  + ++  G+  G +G  QF+P + +  A D D DG+ D
Sbjct: 174 TRRGTFFEGQLVDALTILQSGDTVPANMKGSWAGAMGHTQFMPSSFLALAQDWDGDGRRD 233

Query: 221 LVKSN-IDAIASAAKFLAKLGWTK 243
           +   +  DA+ASAA +LA+ GWTK
Sbjct: 234 IWSDDPADALASAAHYLAENGWTK 257


>gi|54298921|ref|YP_125290.1| hypothetical protein lpp2988 [Legionella pneumophila str. Paris]
 gi|148361252|ref|YP_001252459.1| lytic murein transglycosylase [Legionella pneumophila str. Corby]
 gi|296108591|ref|YP_003620292.1| lytic murein transglycosylase [Legionella pneumophila 2300/99
           Alcoy]
 gi|53752706|emb|CAH14141.1| hypothetical protein lpp2988 [Legionella pneumophila str. Paris]
 gi|148283025|gb|ABQ57113.1| lytic murein transglycosylase [Legionella pneumophila str. Corby]
 gi|295650493|gb|ADG26340.1| lytic murein transglycosylase [Legionella pneumophila 2300/99
           Alcoy]
          Length = 320

 Score =  125 bits (313), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 68/204 (33%), Positives = 108/204 (52%), Gaps = 1/204 (0%)

Query: 39  ADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGL 98
           +  + +W +  R  A+++G+ P      FA +      I    +      ++F  Y +  
Sbjct: 21  SQSWNQWVAGVREEALQQGIPPSLFDEAFAGIHEPSRKIKGFLRSQPEHRLTFMKYRNTR 80

Query: 99  SSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATL 158
           + +  I  G    K N  +L  + ++YGV P  +++ WG+ET +G  MG  P+++ LATL
Sbjct: 81  ADNYRIVIGRKEYKRNKEILEEIAQQYGVNPCFIVSFWGMETSYGSYMGNFPVINALATL 140

Query: 159 AYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDG 217
           AYD  R  FF ++ F AL ++K G +S +   G   G  GQ QFLP + VKYA+D D DG
Sbjct: 141 AYDSNRKDFFRKELFLALHILKGGHVSLADFKGEWAGASGQPQFLPSSWVKYAVDYDGDG 200

Query: 218 KIDLVKSNIDAIASAAKFLAKLGW 241
           + D+ KS  D  AS A ++ + GW
Sbjct: 201 RKDIWKSKPDVFASIANYMKQNGW 224


>gi|52843112|ref|YP_096911.1| lytic murein transglycosylase [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|52630223|gb|AAU28964.1| lytic murein transglycosylase [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
          Length = 325

 Score =  125 bits (313), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 68/204 (33%), Positives = 108/204 (52%), Gaps = 1/204 (0%)

Query: 39  ADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGL 98
           +  + +W +  R  A+++G+ P      FA +      I    +      ++F  Y +  
Sbjct: 26  SQSWNQWVAGVREEALQQGIPPSLFDEAFAGIHEPSRKIKGFLRSQPEHRLTFMKYRNTR 85

Query: 99  SSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATL 158
           + +  I  G    K N  +L  + ++YGV P  +++ WG+ET +G  MG  P+++ LATL
Sbjct: 86  ADNYRIVIGRKEYKKNKEILEEIAQQYGVNPCFIVSFWGMETSYGSYMGNFPVINALATL 145

Query: 159 AYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDG 217
           AYD  R  FF ++ F AL ++K G +S +   G   G  GQ QFLP + VKYA+D D DG
Sbjct: 146 AYDSNRKDFFRKELFLALHILKGGHVSLADFKGEWAGASGQPQFLPSSWVKYAVDYDGDG 205

Query: 218 KIDLVKSNIDAIASAAKFLAKLGW 241
           + D+ KS  D  AS A ++ + GW
Sbjct: 206 RKDIWKSKPDVFASIANYMKQNGW 229


>gi|83949918|ref|ZP_00958651.1| Membrane-bound lytic murein transglycosylase B [Roseovarius
           nubinhibens ISM]
 gi|83837817|gb|EAP77113.1| Membrane-bound lytic murein transglycosylase B [Roseovarius
           nubinhibens ISM]
          Length = 460

 Score =  125 bits (313), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 67/208 (32%), Positives = 114/208 (54%), Gaps = 11/208 (5%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFK----DYLDG 97
           F  W +  R+RA  +G+S +T    F  ++Y  + + +DR         FK    +YLD 
Sbjct: 90  FANWINGFRSRARAQGISNRTFDAAFRGVQYDPSVVKKDRNQS-----EFKKEIWEYLDF 144

Query: 98  LSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLAT 157
             S+  +  G  + +        ++  +GV   ++ A+WG+E+ +GE  G+ PL+ ++AT
Sbjct: 145 AVSTSRVRNGTKVLRQYRNTFDRIEAHFGVEKEVVAAIWGMESAYGERRGREPLIQSIAT 204

Query: 158 LAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADED 216
           LAYD RR KFF +Q   AL +++ G ++ + + G+  G +G  QF+P + + YA+D   D
Sbjct: 205 LAYDGRRGKFFEQQLIAALKIIQSGDVAPNRMTGSWAGAMGHTQFIPTSYLAYAVDFTGD 264

Query: 217 GKIDLVKSN-IDAIASAAKFLAKLGWTK 243
           GK D+   +  DA+AS A +L + GW K
Sbjct: 265 GKRDIWSDDPTDALASTAAYLKRFGWKK 292


>gi|91763273|ref|ZP_01265237.1| membrane-bound lytic transglycolase-related protein [Candidatus
           Pelagibacter ubique HTCC1002]
 gi|91717686|gb|EAS84337.1| membrane-bound lytic transglycolase-related protein [Candidatus
           Pelagibacter ubique HTCC1002]
          Length = 333

 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 74/206 (35%), Positives = 119/206 (57%), Gaps = 9/206 (4%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKD---YLDGL 98
           F EW    +A A+ + +S KT     +D+ +L   I  DR      P  ++D   Y+   
Sbjct: 26  FKEWLVNFKAYALEKKISEKTFNLAMSDVVFLPDVIKYDR----FQPEFYEDTKTYISKR 81

Query: 99  SSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATL 158
           +S + ++ GI L + N   + ++  ++ V   +L+AL G+ET+FG  +GK  +LS+LATL
Sbjct: 82  TSKQKVSAGIKLYELNKDFINSVDNKFSVEKELLLALMGIETNFGTYVGKMDILSSLATL 141

Query: 159 AYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDG 217
           ++D RR+ FFT++    L L+ +G I  + L G+  G  G FQF+P  +  YAID D++ 
Sbjct: 142 SFDQRRSDFFTKELITILQLIDEGKIDHNILYGSWAGAFGFFQFMPSTIDNYAIDYDKNN 201

Query: 218 KIDLVKSNIDAIASAAKFLAKLGWTK 243
            I+L KS  D+ ASAA ++ K+GW K
Sbjct: 202 IIEL-KSTKDSFASAANYINKIGWKK 226


>gi|154707085|ref|YP_001424513.1| membrane-bound lytic murein transglycosylase B [Coxiella burnetii
           Dugway 5J108-111]
 gi|154356371|gb|ABS77833.1| membrane-bound lytic murein transglycosylase B [Coxiella burnetii
           Dugway 5J108-111]
          Length = 333

 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 79/257 (30%), Positives = 124/257 (48%), Gaps = 25/257 (9%)

Query: 1   MSFKKYLLISLLMMVYPML-------AQAVTQPKKATTQFICSDTADRFGEWKSAARARA 53
           M+ +K++L+S L+             A+AV QP  A               W    R  A
Sbjct: 1   MTKRKFILLSALIFFLSAWLLLDNSSARAVQQPSWAV--------------WVKQLREEA 46

Query: 54  VREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKA 113
           +  G+ P+     F+ ++     +    +      ++F  Y    +    I  G A  + 
Sbjct: 47  ISRGIRPEVFDRAFSTVKEPSRKVMHLERTQPERRITFLKYRSTRADPFRIRIGRAKYQK 106

Query: 114 NSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFF 173
           + R+L  +  +YGV P  +++LWG+ET +G  MG  P++ +LATLAY+ +R  FF +Q F
Sbjct: 107 HHRILTEIGNKYGVNPCFIVSLWGMETSYGSYMGNFPVIQSLATLAYESQRKAFFRKQLF 166

Query: 174 YALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASA 232
           YAL+++  G ++     G   G  GQ QFLP +   YA+D D DG+ D+     DA AS 
Sbjct: 167 YALEILNGGHVTLQNFKGEWAGASGQPQFLPSSWHNYAVDYDGDGRKDIWNDLPDAFASI 226

Query: 233 AKFLAKLGWTKCAGYQP 249
           A +LAK GW     +QP
Sbjct: 227 ANYLAKHGWK---AHQP 240


>gi|254496664|ref|ZP_05109527.1| lytic murein transglycosylase [Legionella drancourtii LLAP12]
 gi|254354092|gb|EET12764.1| lytic murein transglycosylase [Legionella drancourtii LLAP12]
          Length = 355

 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 111/204 (54%), Gaps = 7/204 (3%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPP---VSFKDYLDGL 98
           + +W +  R  A+R+G+SP+     FA +      I   + ++ S P   ++F  Y    
Sbjct: 57  WNQWVADVRTEALRQGISPEIFDSAFAGIHEPSHQI---KGLLRSQPEHRLTFSKYRSTR 113

Query: 99  SSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATL 158
             +  IA G    K N  +L ++ K+YGV P  +++ WG+ET +G  MG  P++  LATL
Sbjct: 114 VDNYRIAIGRKEFKKNRAVLEDVAKKYGVNPCFIVSFWGMETSYGTYMGNFPVIKALATL 173

Query: 159 AYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDG 217
           AYD  R  FF ++ F AL ++ +G +S +   G   G  GQ QFLP + VKYA+D D DG
Sbjct: 174 AYDSNRKDFFRKELFIALRILNEGHVSLADFKGEWAGASGQPQFLPSSWVKYAVDYDGDG 233

Query: 218 KIDLVKSNIDAIASAAKFLAKLGW 241
             D+ +S  D  AS A ++ + GW
Sbjct: 234 HRDIWRSKPDVFASIANYMKQNGW 257


>gi|54295756|ref|YP_128171.1| hypothetical protein lpl2846 [Legionella pneumophila str. Lens]
 gi|53755588|emb|CAH17090.1| hypothetical protein lpl2846 [Legionella pneumophila str. Lens]
          Length = 320

 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 68/204 (33%), Positives = 108/204 (52%), Gaps = 1/204 (0%)

Query: 39  ADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGL 98
           +  + +W +  R  A+++G+ P      FA +      I    +      ++F  Y +  
Sbjct: 21  SQSWNQWVAGVREEALQQGIPPGLFDEAFAGIHEPSRKIKGFLRSQPEHRLTFMKYRNTR 80

Query: 99  SSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATL 158
           + +  I  G    K N  +L  + ++YGV P  +++ WG+ET +G  MG  P+++ LATL
Sbjct: 81  ADNYRIVIGRKEYKRNKEILEEIAQQYGVNPCFIVSFWGMETSYGSYMGNFPVINALATL 140

Query: 159 AYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDG 217
           AYD  R  FF ++ F AL ++K G +S +   G   G  GQ QFLP + VKYA+D D DG
Sbjct: 141 AYDSNRKDFFRKELFLALHILKGGHVSLADFKGEWAGASGQPQFLPSSWVKYAVDYDGDG 200

Query: 218 KIDLVKSNIDAIASAAKFLAKLGW 241
           + D+ KS  D  AS A ++ + GW
Sbjct: 201 RKDIWKSKPDVFASIANYMKQNGW 224


>gi|99082831|ref|YP_614985.1| lytic murein transglycosylase [Ruegeria sp. TM1040]
 gi|99039111|gb|ABF65723.1| Lytic murein transglycosylase [Ruegeria sp. TM1040]
          Length = 455

 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 77/240 (32%), Positives = 123/240 (51%), Gaps = 6/240 (2%)

Query: 7   LLISLLMMVYPMLAQAVT---QPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTA 63
           L ++ L  + PM  ++V    Q   A  + +  D    F  W +A + RA  +G+   T 
Sbjct: 49  LALASLTTIRPMARKSVAPAAQDALAPAREVDGDANAGFQRWITAFKIRAQTQGIGAATL 108

Query: 64  KHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKK 123
           +  F  + Y  + I RDR   +    +  DYLD  +S   +  G     A+   L  ++K
Sbjct: 109 RAAFNGVTYDASVIKRDRNQ-SEFTKTIWDYLDSAASESRVRNGTKALDAHRNTLERIEK 167

Query: 124 EYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGV 183
            +GV   I++A+WGLE+ +G   G   ++ +LATLAYD RR  FF EQ   AL +++ G 
Sbjct: 168 HFGVDKEIVVAVWGLESSYGSFRGDMDIIRSLATLAYDGRRGDFFEEQLIAALKIIEAGD 227

Query: 184 ISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDL-VKSNIDAIASAAKFLAKLGW 241
           ++   + G+  G +G  QF+P + + YA+D   DGK D+   +  DA+AS A +L   GW
Sbjct: 228 VNPRTMTGSWAGAMGHTQFIPTSYLDYAVDFTGDGKRDIWSDTPTDALASTAAYLKAFGW 287


>gi|163761095|ref|ZP_02168172.1| putative transglycosylase transmembrane protein [Hoeflea
           phototrophica DFL-43]
 gi|162281646|gb|EDQ31940.1| putative transglycosylase transmembrane protein [Hoeflea
           phototrophica DFL-43]
          Length = 395

 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 70/201 (34%), Positives = 106/201 (52%), Gaps = 2/201 (0%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
            G +    +A AV +G+SP  A+    +       ++RDR        +F ++     S+
Sbjct: 30  LGSFLEGVKAEAVAKGVSPDAARQALRNAAIDRKVLSRDRAQGVFR-QTFLEFSKRSVSA 88

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             +  G       ++     + EYGVP  +L A WGLET FG   G    ++ L TLA+D
Sbjct: 89  NRMQVGAQKMTQFAKTFARAEAEYGVPAPVLTAFWGLETDFGGFQGDFNTMNALVTLAHD 148

Query: 162 CRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
           CRR + F  Q   A+++V  G +  +   GA  GEIGQ Q LP +++++ +D D DG +D
Sbjct: 149 CRRPELFRPQLIAAIEMVGHGDLDPARTTGAWAGEIGQVQMLPRDIIEFGVDGDGDGHVD 208

Query: 221 LVKSNIDAIASAAKFLAKLGW 241
           L KS+ DAI +AAKF+  LGW
Sbjct: 209 LKKSSPDAILTAAKFIKSLGW 229


>gi|332992450|gb|AEF02505.1| putative transglycosylase [Alteromonas sp. SN2]
          Length = 329

 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 75/238 (31%), Positives = 122/238 (51%), Gaps = 10/238 (4%)

Query: 5   KYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAK 64
           K+L  SLLM+   + +    Q +          TA  F E+ +A +A A ++G       
Sbjct: 3   KWLKASLLMVAGVLASIGFAQAE--------DKTAKGFAEYVTALKAEAQQKGFDESLLN 54

Query: 65  HLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKE 124
             F+D+ +  T I  D+       ++   YL        + Q + +   +  LL  + K+
Sbjct: 55  DAFSDISFRPTVIKSDKNQ-PEKKITLDSYLASRVPDWKVQQAVEMYNKHKPLLEEIGKK 113

Query: 125 YGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVI 184
           + V P  ++ALWG E++FG   G   +LS LA+LAY+ RR K F +  F AL ++ +G  
Sbjct: 114 FQVQPRFIVALWGNESNFGRIQGNYSVLSALASLAYEGRREKLFKDNLFAALTILDEGHT 173

Query: 185 SSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
           S  AL G+  G +GQ QF+P++ + YA+D D DG+ D+ ++  D  AS A +L+  GW
Sbjct: 174 SVDALKGSWAGAMGQSQFMPISFLNYAVDYDGDGRKDIWQTEADVFASIANYLSSEGW 231


>gi|255589227|ref|XP_002534885.1| Membrane-bound lytic murein transglycosylase B precursor, putative
           [Ricinus communis]
 gi|223524426|gb|EEF27500.1| Membrane-bound lytic murein transglycosylase B precursor, putative
           [Ricinus communis]
          Length = 366

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 82/244 (33%), Positives = 128/244 (52%), Gaps = 23/244 (9%)

Query: 50  RARAVREGMSPKTAKHLFADLEYLDTTIARDRK---MVTSPPVSFKDYLDGLSSSEIIAQ 106
           R  A+   ++P         + +L   I  DRK    VTS    F  Y++   +  ++A+
Sbjct: 2   RQEALALHVAPAAVDATLNQVTFLPRLIELDRKQPEFVTS----FSAYVNRRINPRVVAK 57

Query: 107 GIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAK 166
           G  + +    +L  +++ Y VP  +L+A WGLET+FG  MG  PL S LATL+Y+ RRA+
Sbjct: 58  GKQMAEDYQGVLYVVEELYQVPREVLVAFWGLETNFGGFMGDIPLASALATLSYEGRRAE 117

Query: 167 FFTEQFFYALDLV-KKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSN 225
           FF  +    + +V ++    S  +G+  G  G  QF+P  ++KY +DAD DGKID+  S 
Sbjct: 118 FFKRELLNLMRVVEREQRYDSPVVGSWAGATGHMQFMPSTLLKYGVDADADGKIDIWNSY 177

Query: 226 IDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNY-------NKTIA-YIAAHI 277
            D  +SAA +L++ GW      QPG K  +I     A  +Y       NK ++ ++ A +
Sbjct: 178 PDVFSSAANYLSQAGW------QPG-KPISIQVALPAGFDYSQAQWQLNKPVSEWVKAGV 230

Query: 278 DGVP 281
            GVP
Sbjct: 231 AGVP 234


>gi|153207654|ref|ZP_01946318.1| putative lytic murein transglycosylase [Coxiella burnetii 'MSU Goat
           Q177']
 gi|212218496|ref|YP_002305283.1| membrane-bound lytic murein transglycosylase B [Coxiella burnetii
           CbuK_Q154]
 gi|120576473|gb|EAX33097.1| putative lytic murein transglycosylase [Coxiella burnetii 'MSU Goat
           Q177']
 gi|212012758|gb|ACJ20138.1| membrane-bound lytic murein transglycosylase B [Coxiella burnetii
           CbuK_Q154]
          Length = 333

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 79/257 (30%), Positives = 124/257 (48%), Gaps = 25/257 (9%)

Query: 1   MSFKKYLLISLLMMVYPML-------AQAVTQPKKATTQFICSDTADRFGEWKSAARARA 53
           M+ +K++L+S L+             A+AV QP  A               W    R  A
Sbjct: 1   MTKRKFILLSALIFFLSAWLLLDNSSARAVQQPSWAL--------------WVKQLREEA 46

Query: 54  VREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKA 113
           +  G+ P+     F+ ++     +    +      ++F  Y    +    I  G A  + 
Sbjct: 47  ISRGIRPEVFDRAFSTVKESSRKVMHLERTQPERRITFLKYRSTRADPFRIRIGRAKYQK 106

Query: 114 NSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFF 173
           + R+L  +  +YGV P  +++LWG+ET +G  MG  P++ +LATLAY+ +R  FF +Q F
Sbjct: 107 HHRILTEIGNKYGVNPCFIVSLWGMETSYGSYMGNFPVIQSLATLAYESQRKAFFRKQLF 166

Query: 174 YALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASA 232
           YAL+++  G ++     G   G  GQ QFLP +   YA+D D DG+ D+     DA AS 
Sbjct: 167 YALEILNGGHVTLQNFKGEWAGASGQPQFLPSSWHNYAVDYDGDGRKDIWNDLPDAFASI 226

Query: 233 AKFLAKLGWTKCAGYQP 249
           A +LAK GW     +QP
Sbjct: 227 ANYLAKHGWK---AHQP 240


>gi|167623768|ref|YP_001674062.1| lytic murein transglycosylase [Shewanella halifaxensis HAW-EB4]
 gi|167353790|gb|ABZ76403.1| lytic murein transglycosylase [Shewanella halifaxensis HAW-EB4]
          Length = 331

 Score =  124 bits (311), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 75/239 (31%), Positives = 126/239 (52%), Gaps = 14/239 (5%)

Query: 4   KKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTA 63
           K+ L +   + + P++A A ++PK   + ++ S             +  A+ +G+S +T 
Sbjct: 5   KQVLALVCCLSLLPVVAFAESEPKAHFSDYVVS------------LKQEALDKGVSLQTV 52

Query: 64  KHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKK 123
             +F  ++     +A D+    +  V+ + YL  +     +    AL K +   L  + K
Sbjct: 53  NDVFPKIKMFKKALASDKNQPENQ-VTLETYLPKVVPQSKVDTARALYKQHYPELEKIGK 111

Query: 124 EYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLV-KKG 182
            YGV P  ++ALWG+E++FG+  G  P+LS  A+LAY+ RR  FF E+FF AL +  ++G
Sbjct: 112 RYGVQPRFIVALWGVESNFGQYGGDYPILSVTASLAYEGRREAFFREEFFAALKIAEREG 171

Query: 183 VISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
           +  S   G+  G +GQ QF+P + + YA D D DGK D+  +  D  AS A +L + GW
Sbjct: 172 IAFSELKGSWAGAMGQTQFMPSSYLTYAQDGDGDGKKDIWTNTSDVFASLAYYLQQTGW 230


>gi|170719809|ref|YP_001747497.1| lytic murein transglycosylase [Pseudomonas putida W619]
 gi|169757812|gb|ACA71128.1| lytic murein transglycosylase [Pseudomonas putida W619]
          Length = 438

 Score =  124 bits (311), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 70/205 (34%), Positives = 113/205 (55%), Gaps = 6/205 (2%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKM--VTSPPVSFKDYLDGLS 99
           F +W++  R +A++ G+S  T    F  +      I  DR     T P     +YL+G  
Sbjct: 66  FAQWQAGFRQQALQAGISANTFDRAFIGVTPDMDVIKADRSQPEFTRP---VWEYLEGAL 122

Query: 100 SSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLA 159
           S   +  G  L + N+ LL  L++ YGV   +L+++WG+E++FG+  G   ++ +LATLA
Sbjct: 123 SPLRVRNGKKLLEQNAELLARLEQRYGVDRQVLVSVWGMESNFGQFQGSKSVIRSLATLA 182

Query: 160 YDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGK 218
           Y+ RR +F  +Q   AL +++ G I   A+ G+  G +GQ QF+P     +A+D D DG+
Sbjct: 183 YEGRRPQFAQDQLIAALQIIQHGDIQPEAMRGSWAGAMGQTQFIPTTYNTHAVDFDGDGR 242

Query: 219 IDLVKSNIDAIASAAKFLAKLGWTK 243
            D+  S  DA+AS A +L   GW +
Sbjct: 243 RDIWNSTPDALASTAHYLQSSGWKR 267


>gi|254438235|ref|ZP_05051729.1| lytic murein transglycosylase subfamily, putative [Octadecabacter
           antarcticus 307]
 gi|198253681|gb|EDY77995.1| lytic murein transglycosylase subfamily, putative [Octadecabacter
           antarcticus 307]
          Length = 398

 Score =  124 bits (311), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 79/262 (30%), Positives = 132/262 (50%), Gaps = 25/262 (9%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F +W +  ++RA   G+S  T    FAD  YL   +ARD   + +   + ++YL   +S 
Sbjct: 65  FIDWVARFKSRAGSAGISSATIDAAFADAGYLRGVVARDGSQIQTRR-TLEEYLSIATSD 123

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
           E I +G A    ++     ++ +YGV   I+ A+WG+E+ +GE  G+ P++S  ATLA+D
Sbjct: 124 ERIRKGRAAFSRHATTFSAIETQYGVDAYIVAAIWGMESQYGEKRGQIPVISATATLAFD 183

Query: 162 CRRAKFFTEQFFYALDLVKKG-VISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR  F+  Q   AL ++++G    +  +G+  G +G  QF+P +   +A+D   DG+ D
Sbjct: 184 GRRGNFYESQLLAALRILQRGDTTPAQLVGSWAGAMGHTQFIPTSYQAFAVDFTGDGRRD 243

Query: 221 LVKSN-IDAIASAAKFLAKLGWTKCAGY--------------QPGE--------KNFAIL 257
           +   +  DA+AS A +LA+ GW     +              QP          +NF ++
Sbjct: 244 IWGDDPADALASTASYLARNGWRSGLKWGAEAGTDGPSGRTIQPQSGGVRFTVTRNFDVV 303

Query: 258 KHWNASLNYNKTIAYIAAHIDG 279
           K +N S  Y   + Y+A  I G
Sbjct: 304 KTYNNSDLYALGVGYLADRIAG 325


>gi|165918874|ref|ZP_02218960.1| putative lytic murein transglycosylase [Coxiella burnetii RSA 334]
 gi|165917422|gb|EDR36026.1| putative lytic murein transglycosylase [Coxiella burnetii RSA 334]
          Length = 333

 Score =  124 bits (311), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 79/257 (30%), Positives = 124/257 (48%), Gaps = 25/257 (9%)

Query: 1   MSFKKYLLISLLMMVYPML-------AQAVTQPKKATTQFICSDTADRFGEWKSAARARA 53
           M+ +K++L+S L+             A+AV QP  A               W    R  A
Sbjct: 1   MTKRKFILLSALIFFLSAWLLLDNSSARAVQQPSWAL--------------WVKQLREEA 46

Query: 54  VREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKA 113
           +  G+ P+     F+ ++     +    +      ++F  Y    +    I  G A  + 
Sbjct: 47  ISRGIRPEVFDRAFSTVKESSRKVMHLERTQPERRITFLKYRSTRADPFRIRIGRAKYQK 106

Query: 114 NSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFF 173
           + R+L  +  +YGV P  +++LWG+ET +G  MG  P++ +LATLAY+ +R  FF +Q F
Sbjct: 107 HHRILTEIGNKYGVNPCFIVSLWGMETSYGSYMGNFPVIQSLATLAYESQRKAFFRKQLF 166

Query: 174 YALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASA 232
           YAL+++  G ++     G   G  GQ QFLP +   YA+D D DG+ D+     DA AS 
Sbjct: 167 YALEILNGGHVTLQNFKGEWAGASGQPQFLPSSWHNYAVDYDGDGRKDIWNDLPDAFASI 226

Query: 233 AKFLAKLGWTKCAGYQP 249
           A +LAK GW     +QP
Sbjct: 227 ANYLAKHGWK---AHQP 240


>gi|325983369|ref|YP_004295771.1| lytic murein transglycosylase [Nitrosomonas sp. AL212]
 gi|325532888|gb|ADZ27609.1| lytic murein transglycosylase [Nitrosomonas sp. AL212]
          Length = 406

 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 83/243 (34%), Positives = 130/243 (53%), Gaps = 14/243 (5%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSP 60
           M+ KK+ L S++++V  +++ +          F  +DTA  FGE  S  +  A  EG+S 
Sbjct: 1   MTRKKFCL-SIVVLVAELISLS----------FAYADTAS-FGECISRMKILARSEGISD 48

Query: 61  KTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLIN 120
           +T   +   ++++   I  DR+       +F  Y +   + E I +G AL      LL  
Sbjct: 49  RTVNQVLDKVKHIPRVIELDRRQPEFTQ-TFSGYFNTRINDERIKRGRALLTQYRPLLER 107

Query: 121 LKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVK 180
           ++ E G+P   L++ WGLET++G   G   +  +LATLA D RR+ FFT++   A+ ++ 
Sbjct: 108 IQLETGIPAQYLVSFWGLETNYGGYFGDWLVTDSLATLACDPRRSTFFTQELLNAMRILD 167

Query: 181 KGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKL 239
            G IS    +G+  G +G  QF+P   + YA D D DG+ DL  S  DA+ SAA FL +L
Sbjct: 168 AGDISHERMIGSWAGAMGHMQFMPSTFLSYAKDIDGDGRRDLWGSIPDAMGSAANFLRQL 227

Query: 240 GWT 242
           GWT
Sbjct: 228 GWT 230


>gi|84515467|ref|ZP_01002829.1| peptidoglycan-binding protein, putative [Loktanella vestfoldensis
           SKA53]
 gi|84510750|gb|EAQ07205.1| peptidoglycan-binding protein, putative [Loktanella vestfoldensis
           SKA53]
          Length = 311

 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 78/241 (32%), Positives = 125/241 (51%), Gaps = 14/241 (5%)

Query: 45  WKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEII 104
           W +  R RA+ +G+S  T    F ++ +L   + RDR   T    + ++YL   +S E I
Sbjct: 45  WVAGFRRRALAQGVSSTTFDAAFQNVGFLPGVVTRDRNQ-TEFRRTLQEYLAIAASDERI 103

Query: 105 AQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRR 164
           A+G A    ++ +L  ++  YGV   I+ A+WGLE+ +G   G  P+++  +TLAY+ RR
Sbjct: 104 AKGRAAYARHASVLNAIEARYGVNRYIVTAIWGLESFYGARQGNIPVIAATSTLAYEGRR 163

Query: 165 AKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVK 223
             FF  Q   AL +++ G IS +   G+  G +G  QF+P    ++A+D   DG+ D+  
Sbjct: 164 GAFFEAQTLQALRILQAGDISPARMTGSWAGAMGHTQFIPTTYAEFAVDFTGDGRRDIWA 223

Query: 224 SN-IDAIASAAKFLAKLGWTKCAGY-----------QPGEKNFAILKHWNASLNYNKTIA 271
            +  DA+ASAA +LA+ GW    G+           Q G   F    ++ A   YN + A
Sbjct: 224 VDPSDALASAANYLARSGWQTGIGWGRENPRGTLEPQRGGPRFTTTANFRAIKRYNNSDA 283

Query: 272 Y 272
           Y
Sbjct: 284 Y 284


>gi|74316079|ref|YP_313819.1| lytic murein transglycosylase [Thiobacillus denitrificans ATCC
           25259]
 gi|74055574|gb|AAZ96014.1| lytic murein transglycosylase [Thiobacillus denitrificans ATCC
           25259]
          Length = 434

 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 71/203 (34%), Positives = 113/203 (55%), Gaps = 6/203 (2%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPV--SFKDYLDGLS 99
           F  W +A R  A  +G+SP T       +E ++  I  DR+    P    +F  YL    
Sbjct: 41  FDTWLAAFRDEAQAQGISPATLASALDGIEPVERVIELDRRQ---PEFLQTFAAYLARRV 97

Query: 100 SSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLA 159
           +SE + +G  + +A++ L   ++  YGV   +L A WGLET +G   G   + ++LATLA
Sbjct: 98  TSEQVDRGQTMLEAHADLFDAVETRYGVAANVLAAFWGLETRYGAFKGGLNIPASLATLA 157

Query: 160 YDCRRAKFFTEQFFYALDLVKKGVISSHALGATF-GEIGQFQFLPVNVVKYAIDADEDGK 218
           YD RR+ FF ++   AL ++  G +++  +  ++ G +G  QF+P     YA+DAD D +
Sbjct: 158 YDGRRSAFFRKELLDALRIIDAGHVTAPEMNGSWAGAMGHMQFMPSTFRAYAVDADGDAR 217

Query: 219 IDLVKSNIDAIASAAKFLAKLGW 241
           IDL +S  DA+ SAA +L++ GW
Sbjct: 218 IDLWQSLPDAMNSAANYLSRAGW 240


>gi|90411628|ref|ZP_01219638.1| putative lytic murein transglycosylase [Photobacterium profundum
           3TCK]
 gi|90327518|gb|EAS43871.1| putative lytic murein transglycosylase [Photobacterium profundum
           3TCK]
          Length = 323

 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 66/202 (32%), Positives = 108/202 (53%), Gaps = 2/202 (0%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F E+ S  +  A   G+S       F +++Y +  +  D+       ++  +Y+      
Sbjct: 27  FDEYVSGLKVEARNNGISESIINSAFDNIQYTERAVKADKNQ-PEKKLTLDEYIPRAVPD 85

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             + Q   L + +   L  + +EYGV P  ++ALWG+E++FG  MG   ++  L+TLAYD
Sbjct: 86  WKVKQANRLYQEHKTALERIGREYGVQPRFIVALWGVESNFGRLMGNYNVVEALSTLAYD 145

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR  FF +Q   AL ++ +G IS   + G+  G +GQ QF+P + + YA+D + DGKID
Sbjct: 146 GRREAFFRKQVMAALQILNEGHISPENMKGSWAGAMGQPQFMPTSFLTYAVDGNNDGKID 205

Query: 221 LVKSNIDAIASAAKFLAKLGWT 242
           + ++  D  ASAA +L   GW 
Sbjct: 206 IWQNVDDVFASAANYLKMSGWN 227


>gi|119385237|ref|YP_916293.1| lytic murein transglycosylase [Paracoccus denitrificans PD1222]
 gi|119375004|gb|ABL70597.1| lytic murein transglycosylase [Paracoccus denitrificans PD1222]
          Length = 417

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 74/204 (36%), Positives = 114/204 (55%), Gaps = 8/204 (3%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKM--VTSPPVSFKDYLDGLS 99
           F  W  + R RA+  G+SP T     A   Y  + +A DRK    T P     +YLDG  
Sbjct: 52  FQNWVQSFRPRALAAGVSPGTFDSAMAGAHYQPSIVALDRKQSEFTKP---IWEYLDGAI 108

Query: 100 SSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLA 159
            +   A G A     +  L  ++  YGVP  I++A+WG+E++FG   G T ++  LATLA
Sbjct: 109 GTRG-ATGRAKAAQYAGTLSAIEARYGVPREIVLAVWGMESNFGANRGNTRIVPALATLA 167

Query: 160 YDCRRAKFFTEQFFYALDLVKKG-VISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGK 218
           YD RR +FF  +   AL +++ G V S+H +G+  G +G  QF+P + + +A+D + DG+
Sbjct: 168 YDGRRGEFFAGELVAALRIIQSGDVDSAHMVGSWAGAMGHTQFMPSSFLSHAVDFNGDGR 227

Query: 219 IDLVKSN-IDAIASAAKFLAKLGW 241
            D+  ++  DA+AS A +L + GW
Sbjct: 228 RDIWSNDPTDALASTASYLRQNGW 251


>gi|23011047|ref|ZP_00051533.1| COG2951: Membrane-bound lytic murein transglycosylase B
           [Magnetospirillum magnetotacticum MS-1]
          Length = 377

 Score =  123 bits (309), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 78/206 (37%), Positives = 114/206 (55%), Gaps = 5/206 (2%)

Query: 39  ADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDT-TIARDRKMVT-SPPVSFKDYLD 96
            D F  + +  RA A   G+S KT +  FAD+   D   IAR R+    S PV   DYL 
Sbjct: 31  GDDFARFVAGVRADAEARGVSRKTVEAAFADVSGPDNAVIARTRRQGEFSRPV--WDYLV 88

Query: 97  GLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLA 156
           G  S   IA+G A  K  S  L  ++ + GVP  +++A WG+E+ FG + G  P + +LA
Sbjct: 89  GAVSPGRIARGQAQAKRLSATLAAIEAKTGVPRSVVLAFWGVESDFGASAGSLPTIRSLA 148

Query: 157 TLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADE 215
           +LAY   R   F ++   AL +++ G I  +  +G+  G +GQ QFLP   ++ A+D D 
Sbjct: 149 SLAYARHRGSLFRDELLAALQILENGDIEPARMVGSWAGAMGQVQFLPSVYLREAVDFDG 208

Query: 216 DGKIDLVKSNIDAIASAAKFLAKLGW 241
           DG+ D+ +S  DA+AS A +L  LGW
Sbjct: 209 DGRRDIWRSEADALASIAHYLRSLGW 234


>gi|29654246|ref|NP_819938.1| putative lytic murein transglycosylase [Coxiella burnetii RSA 493]
 gi|29541512|gb|AAO90452.1| membrane-bound lytic murein transglycosylase B [Coxiella burnetii
           RSA 493]
          Length = 333

 Score =  123 bits (309), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 78/257 (30%), Positives = 123/257 (47%), Gaps = 25/257 (9%)

Query: 1   MSFKKYLLISLLMMVYPML-------AQAVTQPKKATTQFICSDTADRFGEWKSAARARA 53
           M+ +K++L+S L+             A+AV QP                  W    R  A
Sbjct: 1   MTKRKFILLSALIFFLSAWLLLDNSSARAVQQPSWVV--------------WVKQLREEA 46

Query: 54  VREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKA 113
           +  G+ P+     F+ ++     +    +      ++F  Y    +    I  G A  + 
Sbjct: 47  ISRGIRPEVFDRAFSTVKEPSRKVMHLERTQPERRITFLKYRSTRADPFRIRIGRAKYQK 106

Query: 114 NSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFF 173
           + R+L  +  +YGV P  +++LWG+ET +G  MG  P++ +LATLAY+ +R  FF +Q F
Sbjct: 107 HHRILTEIGNKYGVNPCFIVSLWGMETSYGSYMGNFPVIQSLATLAYESQRRAFFRKQLF 166

Query: 174 YALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASA 232
           YAL+++  G ++     G   G  GQ QFLP +   YA+D D DG+ D+     DA AS 
Sbjct: 167 YALEILNGGHVTLQNFKGEWAGASGQPQFLPSSWHNYAVDYDGDGRKDIWNDLPDAFASI 226

Query: 233 AKFLAKLGWTKCAGYQP 249
           A +LAK GW     +QP
Sbjct: 227 ANYLAKHGWK---AHQP 240


>gi|297569618|ref|YP_003690962.1| lytic murein transglycosylase [Desulfurivibrio alkaliphilus AHT2]
 gi|296925533|gb|ADH86343.1| lytic murein transglycosylase [Desulfurivibrio alkaliphilus AHT2]
          Length = 328

 Score =  123 bits (308), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 70/201 (34%), Positives = 108/201 (53%), Gaps = 2/201 (0%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F +W +  R  A   G+S  T       +E +   I  DR+      ++F  Y D +   
Sbjct: 31  FEQWLTELRQEAKGRGISATTLDAALTGIEPIPRVIELDRQQPEFT-LTFVQYRDRVVPQ 89

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             I  G  L + +  LL  + KE+GV P  ++ALWG+ET FG   G  P+++ LATLAYD
Sbjct: 90  SRINMGRRLLEEHRELLTEIGKEFGVQPRFIVALWGIETDFGRITGGFPVINALATLAYD 149

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR+ +F  +   AL ++ +G I    + G+  G +GQ QF+P + + +A+D + DG+ D
Sbjct: 150 GRRSSYFRGELLNALQILDEGHIGVDEMKGSWAGAMGQSQFMPSSFLNFAVDYNGDGRRD 209

Query: 221 LVKSNIDAIASAAKFLAKLGW 241
           +  +  D  ASAA +LAK GW
Sbjct: 210 IWHTLPDVFASAANYLAKSGW 230


>gi|114320621|ref|YP_742304.1| lytic murein transglycosylase [Alkalilimnicola ehrlichii MLHE-1]
 gi|114227015|gb|ABI56814.1| lytic murein transglycosylase [Alkalilimnicola ehrlichii MLHE-1]
          Length = 400

 Score =  123 bits (308), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 70/188 (37%), Positives = 102/188 (54%), Gaps = 6/188 (3%)

Query: 57  GMSPKTAKHLFADLEYLDTTIARDRKMVTSPPV--SFKDYLDGLSSSEIIAQGIALKKAN 114
           G+S    +   AD+  L+  I+ DR+    P    +F  YLD   +   + +G AL   +
Sbjct: 42  GLSESAIEAALADITPLERVISSDRR---QPEFVQTFWTYLDQRVTDRRVERGRALLDEH 98

Query: 115 SRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFY 174
             LL  +  +YGV P  L+ALWG+ET+FG   G  P++  LATLA D RR+ FF  Q   
Sbjct: 99  QDLLWRIHADYGVRPQYLLALWGMETNFGGYFGDVPVIDALATLACDTRRSAFFRTQVVE 158

Query: 175 ALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAA 233
           A+ ++ +G +    + G+  G +G  QF+P     YA+D D  G+IDL  S  DA AS+A
Sbjct: 159 AIRIIDEGHMDRDGMVGSWAGAMGHTQFMPSTFTAYAVDYDGSGRIDLWNSLPDAFASSA 218

Query: 234 KFLAKLGW 241
            +L  LGW
Sbjct: 219 NYLRALGW 226


>gi|115523412|ref|YP_780323.1| lytic murein transglycosylase [Rhodopseudomonas palustris BisA53]
 gi|115517359|gb|ABJ05343.1| lytic murein transglycosylase [Rhodopseudomonas palustris BisA53]
          Length = 449

 Score =  122 bits (307), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 72/215 (33%), Positives = 111/215 (51%), Gaps = 12/215 (5%)

Query: 56  EGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANS 115
           EG+SP+        L Y  + + RDR       + F  +   ++S     +G  L K ++
Sbjct: 61  EGVSPRALAQASPYLVYDQSIVNRDRGQRVFGQI-FTVFAGRMASEGRRVKGQQLIKQHA 119

Query: 116 RLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYA 175
           +     +KEYGVPP ++ A W LE+ FG   G    L +L +LAYDCRR+K F  +   A
Sbjct: 120 QAFARAEKEYGVPPAVIAAFWALESDFGAVQGNLSTLRSLVSLAYDCRRSKMFENETIAA 179

Query: 176 LDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAK 234
           L +V +G ++ +  +G+  GE+GQ QFLP +   YA+D D DG  D+++S  D I S A 
Sbjct: 180 LKIVDRGDLAPAEMIGSWAGELGQTQFLPTHYYNYAVDYDGDGHRDMLRSAPDVIGSTAN 239

Query: 235 FLAK-LGW---------TKCAGYQPGEKNFAILKH 259
           ++A  L W          + AG  P ++    +KH
Sbjct: 240 YIANGLKWRRGEPWLQEVRVAGNVPWDQADLTIKH 274


>gi|239992933|ref|ZP_04713457.1| putative transglycosylase [Alteromonas macleodii ATCC 27126]
          Length = 360

 Score =  122 bits (307), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 73/236 (30%), Positives = 122/236 (51%), Gaps = 7/236 (2%)

Query: 7   LLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHL 66
           L++S + + + +   A  QP   +     S+T   F  + +  +  A  +G+        
Sbjct: 33  LVLSSITLSFSLTVHAENQPSNDSG---LSETG--FKSYVAQLKKEAAEKGIDKTKLDLA 87

Query: 67  FADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYG 126
           FAD+ +  T +  D+       ++  DYL        + Q +     +  LL  + ++YG
Sbjct: 88  FADITFRPTVVKSDKSQ-PEKKITLDDYLATRVPDWKVKQAVEQYNEHKVLLDEIAQKYG 146

Query: 127 VPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISS 186
           V    ++ALWG E++FG+  G   +LS LA+LAY+ RR K F + FF AL ++ +G IS 
Sbjct: 147 VQARFIVALWGNESNFGKIQGNFSVLSALASLAYEGRREKLFKDNFFAALQILDEGHISV 206

Query: 187 HAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
            AL G+  G +GQ QF+P++ + YA+D D DG+ D+  +  D  AS A +L+  GW
Sbjct: 207 EALKGSWAGAMGQTQFMPISFLNYAVDYDGDGRKDIWGTKADVFASIANYLSSEGW 262


>gi|268589704|ref|ZP_06123925.1| type III effector HopAJ2 [Providencia rettgeri DSM 1131]
 gi|291314934|gb|EFE55387.1| type III effector HopAJ2 [Providencia rettgeri DSM 1131]
          Length = 362

 Score =  122 bits (307), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 70/232 (30%), Positives = 119/232 (51%), Gaps = 16/232 (6%)

Query: 50  RARAVREGMSPKTAKHLFADLEYLDTTIARDR-KMVTSPPVSFKDYLDGLSSSEIIAQGI 108
           +  A+ +G+ P T +  FA++ +++  +  D+ +      ++   YL  +     I  G 
Sbjct: 68  KEHAITQGIKPDTIERAFANVHFIERVVKADKGQPEKRATITLASYLKNVLPQSRINAGY 127

Query: 109 ALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFF 168
                N  +L  +  +YG+PP  +++LWGLE+ FG + GK  ++S LATL+++ RR   F
Sbjct: 128 DKYLENKSILDAISDKYGIPPQFIVSLWGLESGFGRSQGKEDVVSALATLSFEGRREALF 187

Query: 169 TEQFFYALDLVKKGVI--SSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNI 226
           ++Q   AL+++ KG I       G+  G +GQ QF+P + + YA D D DGK+D+  +  
Sbjct: 188 SKQLLAALEIMDKGYIPEDQQLKGSWAGAMGQSQFMPTSYLSYAADGDGDGKMDIWNNKS 247

Query: 227 DAIASAAKFLAKLGWTKCA--GYQPGEKNFAILKHWNASLNYNKTIAYIAAH 276
           D  AS A +L+  GW      GYQ            N   ++NKT+  + A 
Sbjct: 248 DVFASIANYLSTEGWQAPLPWGYQV-----------NLPADFNKTLEGVKAE 288


>gi|83593041|ref|YP_426793.1| lytic murein transglycosylase [Rhodospirillum rubrum ATCC 11170]
 gi|83575955|gb|ABC22506.1| Lytic murein transglycosylase [Rhodospirillum rubrum ATCC 11170]
          Length = 454

 Score =  122 bits (307), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 75/205 (36%), Positives = 111/205 (54%), Gaps = 10/205 (4%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F +W    RA A+  G+S  T              +  DRK        F   L G  +S
Sbjct: 78  FAQWLVGMRAEALAAGISRATVDSALGRARIEPRIVELDRKQP-----EFNKTLAGYFAS 132

Query: 102 EI----IAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLAT 157
            +    IA+   +   ++ LL +L++ YGVP   L+A WGLET+FG T+G   ++  L+T
Sbjct: 133 TLPDSRIAKAREMMALHAPLLRSLEQRYGVPGRFLVAFWGLETNFGGTLGSFRVVDALST 192

Query: 158 LAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADED 216
           LA++ RR  FF  Q   AL ++  G +S+ A+ G+  G +GQ QF+P     +A+D D D
Sbjct: 193 LAFEGRRGAFFRAQLLDALRIIDAGHVSADAMIGSWAGAMGQTQFMPSTFRAHAVDYDGD 252

Query: 217 GKIDLVKSNIDAIASAAKFLAKLGW 241
           G+ID+  S  DA+ASAAK+L+ LGW
Sbjct: 253 GRIDIWGSLPDALASAAKYLSDLGW 277


>gi|222110881|ref|YP_002553145.1| lytic murein transglycosylase [Acidovorax ebreus TPSY]
 gi|221730325|gb|ACM33145.1| lytic murein transglycosylase [Acidovorax ebreus TPSY]
          Length = 466

 Score =  122 bits (307), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 73/203 (35%), Positives = 107/203 (52%), Gaps = 6/203 (2%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKM--VTSPPVSFKDYLDGLS 99
           F  W SA    A+  G+ P+T        ++    +  DR     T PP +   YLD   
Sbjct: 97  FHAWVSAFAREALAAGIRPQTVAATLGQAQWQPRVVELDRAQPEFTRPPWA---YLDSAV 153

Query: 100 SSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLA 159
           SS+ IAQG   +   +  L    + YGVP  ++ A+WG+E+++G   G    +  LATLA
Sbjct: 154 SSQRIAQGREQRHQYADALDAAAQRYGVPASVVTAIWGMESNYGRNFGSFRTVDALATLA 213

Query: 160 YDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGK 218
           YD RR+ +   +   AL +V +G I++ AL G+  G +G  QFLP   + +A+DAD DG+
Sbjct: 214 YDGRRSAWAQRELLAALRIVDQGDIAADALIGSWAGAMGHTQFLPSVFLAHAVDADGDGR 273

Query: 219 IDLVKSNIDAIASAAKFLAKLGW 241
            D+  S  D +AS A FLA  GW
Sbjct: 274 RDIWGSVPDVVASTANFLAHSGW 296


>gi|148244220|ref|YP_001218914.1| hypothetical protein COSY_0052 [Candidatus Vesicomyosocius okutanii
           HA]
 gi|146326047|dbj|BAF61190.1| hypothetical protein [Candidatus Vesicomyosocius okutanii HA]
          Length = 221

 Score =  122 bits (307), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 74/202 (36%), Positives = 112/202 (55%), Gaps = 5/202 (2%)

Query: 52  RAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQG-IAL 110
           +A++ G+S  T  + F DL      +  DR   T   ++F  YL+   +   + +G I L
Sbjct: 6   KAIQLGISQTTINNYFNDLIPNPKVLKYDRNQ-TKFNLNFWHYLNSRVNQNRLDKGLIKL 64

Query: 111 KKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTE 170
           KK    L  N KK YG+P  I++ALWGLET++G+ +GK  ++ +LATL++D RR +FFT 
Sbjct: 65  KKYQKYLQENYKK-YGIPTHIIVALWGLETNYGKNIGKINIIRSLATLSFDKRRREFFTH 123

Query: 171 QFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIA 230
           +    L L+ +  +  +  G+    +G  QF+P NV  Y IDA+ DGKI L  +  D  A
Sbjct: 124 ELLTLLKLIDEDRLPLNTQGSWASAMGSIQFIPTNVATYDIDANLDGKIHLWHTQEDIFA 183

Query: 231 SAAKFLAKLGWTKCAGYQPGEK 252
           SA  FL  + W +  G + G K
Sbjct: 184 SAVYFLKNICWYQ--GERRGRK 203


>gi|254282058|ref|ZP_04957026.1| glycosidase family protein [gamma proteobacterium NOR51-B]
 gi|219678261|gb|EED34610.1| glycosidase family protein [gamma proteobacterium NOR51-B]
          Length = 395

 Score =  122 bits (307), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 83/205 (40%), Positives = 117/205 (57%), Gaps = 6/205 (2%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPV--SFKDYLDGLS 99
           F + K+  + +A  +G+S  T K +   LEY    I  DR   + P    SF DY     
Sbjct: 25  FEQCKTQMQLQASAQGVSEATVKEVIPTLEYQARVIELDR---SQPEFTQSFADYFGKRV 81

Query: 100 SSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLA 159
           S   I +G  L       L  L ++YGVP   L+A WGLET+FG  +G  P L +LATLA
Sbjct: 82  SQSRIDKGRELYAQYRDFLAELTRKYGVPGQYLVAFWGLETNFGSYLGGMPTLDSLATLA 141

Query: 160 YDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGK 218
            D RR++FFT +F  AL L+++  +    + G+  G +G  QF+P + ++YAID D+DG 
Sbjct: 142 CDPRRSEFFTTEFLLALKLLERENLRVDDMKGSWAGAVGHTQFMPSSYLRYAIDGDDDGS 201

Query: 219 IDLVKSNIDAIASAAKFLAKLGWTK 243
           IDL  S  DA+ASAA FL++LGW +
Sbjct: 202 IDLWSSRRDALASAAHFLSQLGWQR 226


>gi|312112921|ref|YP_004010517.1| lytic murein transglycosylase [Rhodomicrobium vannielii ATCC 17100]
 gi|311218050|gb|ADP69418.1| lytic murein transglycosylase [Rhodomicrobium vannielii ATCC 17100]
          Length = 418

 Score =  122 bits (306), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 76/212 (35%), Positives = 113/212 (53%), Gaps = 6/212 (2%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDR-KMVTSPPVSFKD 93
           CS ++  F  W S  +A A  +G+S +    L   + +  + I +DR + V S   SF +
Sbjct: 44  CSTSSAGFDRWLSQFKAEARSQGLSSRALSALDG-VTFDQSVINKDRGQSVFSQ--SFLE 100

Query: 94  YLDGLSSSEIIAQGIALKKAN-SRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
           + D +++   I +   L      R     ++E+GVP  I+ A W LET FG   G    +
Sbjct: 101 FSDRMAAKYRIEKARQLIGGKYKREFDRAEREFGVPGAIISAFWALETDFGANNGNMETV 160

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAI 211
            +LATLAYDCRR + F E+    L ++ +G +S S   G   GE+GQ QF+P   +KY I
Sbjct: 161 RSLATLAYDCRRPEKFREELLDVLKIIDRGDLSASEMRGPWAGELGQTQFVPSVYLKYGI 220

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGWTK 243
           D D DG  DL++S  D I S+A +L  LGW +
Sbjct: 221 DYDGDGHADLIRSAPDVIGSSANYLKALGWRR 252



 Score = 38.9 bits (89), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 15/29 (51%), Positives = 18/29 (62%)

Query: 253 NFAILKHWNASLNYNKTIAYIAAHIDGVP 281
           NF +   WN SL Y  T+AY+A  IDG P
Sbjct: 319 NFKVFLEWNQSLIYATTVAYLATRIDGAP 347


>gi|212711896|ref|ZP_03320024.1| hypothetical protein PROVALCAL_02971 [Providencia alcalifaciens DSM
           30120]
 gi|212685418|gb|EEB44946.1| hypothetical protein PROVALCAL_02971 [Providencia alcalifaciens DSM
           30120]
          Length = 367

 Score =  122 bits (306), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 67/204 (32%), Positives = 110/204 (53%), Gaps = 5/204 (2%)

Query: 50  RARAVREGMSPKTAKHLFADLEYLDTTIARDR-KMVTSPPVSFKDYLDGLSSSEIIAQGI 108
           +  A+ +G+   T    FA++ +L+  +  D+ +      V+   YL  +     I  G+
Sbjct: 73  KQHAIAQGIKQSTIDRGFANIYFLERVVKADKGQPEKRATVTLASYLKNVLPQSRINMGV 132

Query: 109 ALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFF 168
                N  +L  + ++YGVPP  +++LWGLE+ FG + GK  ++S LATL+++ RR   F
Sbjct: 133 EKYYENQVVLNAVSQKYGVPPQYIVSLWGLESGFGRSQGKEDVISALATLSFEGRREALF 192

Query: 169 TEQFFYALDLVKKGVI--SSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNI 226
           ++Q   AL+++ KG I       G+  G +GQ QF+P + + YA D D DGK+D+  +  
Sbjct: 193 SKQLLAALEIMDKGYIPEDQQLKGSWAGAMGQSQFMPTSYLSYAADGDGDGKMDIWNNKA 252

Query: 227 DAIASAAKFLAKLGWTKCA--GYQ 248
           D  AS A +L+  GW      GYQ
Sbjct: 253 DVFASIANYLSTEGWQSALPWGYQ 276


>gi|161831017|ref|YP_001596781.1| putative lytic murein transglycosylase [Coxiella burnetii RSA 331]
 gi|161762884|gb|ABX78526.1| putative lytic murein transglycosylase [Coxiella burnetii RSA 331]
          Length = 333

 Score =  122 bits (306), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 78/257 (30%), Positives = 122/257 (47%), Gaps = 25/257 (9%)

Query: 1   MSFKKYLLISLLMMVYPML-------AQAVTQPKKATTQFICSDTADRFGEWKSAARARA 53
           M+ +K++L+S L+             A+AV QP                  W    R  A
Sbjct: 1   MTKRKFILLSALIFFLSAWLLLDNSSARAVQQPSWVV--------------WVKQLREEA 46

Query: 54  VREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKA 113
           +  G+ P+     F  ++     +    +      ++F  Y    +    I  G A  + 
Sbjct: 47  ISRGIRPEVFDRAFNTVKEPSRKVMHLERTQPERRITFLKYRSTRADPFRIRIGRAKYQK 106

Query: 114 NSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFF 173
           + R+L  +  +YGV P  +++LWG+ET +G  MG  P++ +LATLAY+ +R  FF +Q F
Sbjct: 107 HHRILTEIGNKYGVNPCFIVSLWGMETSYGSYMGNFPVIQSLATLAYESQRRAFFRKQLF 166

Query: 174 YALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASA 232
           YAL+++  G ++     G   G  GQ QFLP +   YA+D D DG+ D+     DA AS 
Sbjct: 167 YALEILNGGHVTLQNFKGEWAGASGQPQFLPSSWHNYAVDYDGDGRKDIWNDLPDAFASI 226

Query: 233 AKFLAKLGWTKCAGYQP 249
           A +LAK GW     +QP
Sbjct: 227 ANYLAKHGWK---AHQP 240


>gi|282599681|ref|ZP_05971471.2| type III effector HopAJ2 [Providencia rustigianii DSM 4541]
 gi|282568209|gb|EFB73744.1| type III effector HopAJ2 [Providencia rustigianii DSM 4541]
          Length = 330

 Score =  122 bits (306), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 68/204 (33%), Positives = 108/204 (52%), Gaps = 5/204 (2%)

Query: 50  RARAVREGMSPKTAKHLFADLEYLDTTIARDR-KMVTSPPVSFKDYLDGLSSSEIIAQGI 108
           +  A  +G+   T    FA++ +L+  +  D+ +      V+   YL  +     I  G+
Sbjct: 36  KQHAAVQGIKQSTIDRGFANIYFLERVVKADKGQPEKRATVTLASYLKNVLPQSRINAGV 95

Query: 109 ALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFF 168
              K N   L    ++YGVPP  +++LWGLE+ FG + GK  ++S LATL+++ RR   F
Sbjct: 96  EKYKENQATLDATSQKYGVPPQFIVSLWGLESGFGRSQGKEDVISALATLSFEGRRETLF 155

Query: 169 TEQFFYALDLVKKGVISSHAL--GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNI 226
           ++Q   AL+++ KG I       G+  G +GQ QF+P + + YA D D DGK+D+  +  
Sbjct: 156 SKQLLAALEIMDKGYIPEEQQLKGSWAGAMGQSQFMPTSYLSYAADGDGDGKMDIWNNKA 215

Query: 227 DAIASAAKFLAKLGWTKCA--GYQ 248
           D  AS A +L+  GW      GYQ
Sbjct: 216 DVFASIANYLSTEGWQAALPWGYQ 239


>gi|254437168|ref|ZP_05050662.1| lytic murein transglycosylase subfamily [Octadecabacter antarcticus
           307]
 gi|198252614|gb|EDY76928.1| lytic murein transglycosylase subfamily [Octadecabacter antarcticus
           307]
          Length = 421

 Score =  122 bits (306), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 69/204 (33%), Positives = 108/204 (52%), Gaps = 3/204 (1%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F  W    R RA R+G+   T    F  + Y  T I RDR   +    S  DYLD   S 
Sbjct: 53  FNAWIFGFRNRATRQGILEATFDAAFDGITYNTTVIDRDRNQ-SEFTKSLWDYLDTAVSD 111

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             +  G      N +LL  +++ +GV   +++A+WGLE+ +G   G T ++  +ATLAYD
Sbjct: 112 ARVRNGRRALADNMQLLNRIEQTFGVDKEVVVAIWGLESAYGAVRGSTNVIGAMATLAYD 171

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR  FF +Q   AL +++ G  +   + G+  G +G  QF+P + ++YA+D + DG+ D
Sbjct: 172 GRRGAFFEQQLIAALQILQAGDTAPRNMTGSWAGAMGHTQFMPTSFLEYAVDGNGDGRRD 231

Query: 221 LVKSN-IDAIASAAKFLAKLGWTK 243
           +   +  DA+AS A +L   GW +
Sbjct: 232 IWADDPTDALASTANYLRSFGWVQ 255


>gi|126726117|ref|ZP_01741959.1| hypothetical protein RB2150_07913 [Rhodobacterales bacterium
           HTCC2150]
 gi|126705321|gb|EBA04412.1| hypothetical protein RB2150_07913 [Rhodobacterales bacterium
           HTCC2150]
          Length = 381

 Score =  122 bits (306), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 72/203 (35%), Positives = 99/203 (48%), Gaps = 2/203 (0%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F  W    +  AV  G S  T     A       T+  DR       + F D+   + S 
Sbjct: 18  FNSWLKGVKKEAVANGHSKGTVDKFLASARQDSRTLKADRAQGVFK-LGFVDFSRRVISQ 76

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             I  G       + +    +++YGVP G+L+A W LET FG   G    L++L TL++D
Sbjct: 77  HRINNGRKNGSKYASVFARTERDYGVPAGVLLAFWALETDFGAVQGDFNTLTSLLTLSHD 136

Query: 162 CRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
           CRR + F  Q F AL+L ++G  S S   GA  GEIG  Q LP +++   +D D DG++ 
Sbjct: 137 CRRPELFRPQIFAALELYERGDFSPSKTTGAWAGEIGMVQMLPEDILHNGVDGDGDGQVK 196

Query: 221 LVKSNIDAIASAAKFLAKLGWTK 243
           L  S  DA+ S AK L  LGW K
Sbjct: 197 LKTSAPDALLSGAKMLKGLGWRK 219


>gi|119944833|ref|YP_942513.1| lytic murein transglycosylase [Psychromonas ingrahamii 37]
 gi|119863437|gb|ABM02914.1| lytic murein transglycosylase [Psychromonas ingrahamii 37]
          Length = 349

 Score =  122 bits (305), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 64/203 (31%), Positives = 109/203 (53%), Gaps = 2/203 (0%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F E+    +  A   G+ P   ++ FA++E+L  ++  D++      ++   Y+      
Sbjct: 46  FAEYVEQIKIEAKENGIDPDVIENAFANVEFLQRSVKSDKEQ-PEFKLTLDTYIPRAVPE 104

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             + Q     + + +LL  +   YGV P  ++ALWG+ET+FG   G   ++S+L T+AY+
Sbjct: 105 WKVKQARKAYQEHYQLLHEIGNAYGVQPRFIVALWGIETNFGRFTGNHYIISSLTTMAYE 164

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR   F +Q F AL ++++G +     +G+  G +GQ QF+P + + YA+D D DGK D
Sbjct: 165 GRREALFKKQLFAALIILQQGHVDPEDFIGSWAGAMGQVQFMPTSYLNYAVDYDGDGKKD 224

Query: 221 LVKSNIDAIASAAKFLAKLGWTK 243
           +  +N D  ASAA +L   GW  
Sbjct: 225 IWNTNADIFASAANYLKTEGWNN 247


>gi|121594204|ref|YP_986100.1| lytic murein transglycosylase [Acidovorax sp. JS42]
 gi|120606284|gb|ABM42024.1| lytic murein transglycosylase [Acidovorax sp. JS42]
          Length = 474

 Score =  122 bits (305), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 72/203 (35%), Positives = 107/203 (52%), Gaps = 6/203 (2%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKM--VTSPPVSFKDYLDGLS 99
           F  W SA    A+  G+ P+T        ++    +  DR     T PP +   YLD   
Sbjct: 105 FHAWVSAFAREALAAGIRPQTVAATLGQAQWQPRVVELDRAQPEFTRPPWA---YLDSAV 161

Query: 100 SSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLA 159
           S + IAQG   ++  +  L    + YGVP  ++ A+WG+E+++G   G    +  LATLA
Sbjct: 162 SPQRIAQGREQRRQYADALDAAAQRYGVPASVVTAIWGMESNYGRNFGSFRTVDALATLA 221

Query: 160 YDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGK 218
           YD RR+ +   +   AL +V +G I++ AL G+  G +G  QFLP   + +A+DAD DG+
Sbjct: 222 YDGRRSAWAQRELLAALRIVDQGDIAADALIGSWAGAMGHTQFLPSVFLAHAVDADGDGR 281

Query: 219 IDLVKSNIDAIASAAKFLAKLGW 241
            D+  S  D +AS A FLA  GW
Sbjct: 282 RDIWGSVPDVVASTANFLAHSGW 304


>gi|78049951|ref|YP_366126.1| putative transglycosylase precursor [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|78038381|emb|CAJ26126.1| putative transglycosylase precursor [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
          Length = 720

 Score =  121 bits (304), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 62/153 (40%), Positives = 91/153 (59%), Gaps = 1/153 (0%)

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
           DYL  L  S+ ++ G A+   +  LL  L ++ GV P  ++A+WG+E+ +G   GK PLL
Sbjct: 75  DYLASLVDSQRVSDGQAMLVTHRELLARLSEQTGVDPATIVAVWGVESDYGRVTGKRPLL 134

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAI 211
            +LATL+   RR  FF  +F   L L+++G +S+  L G+  G  GQ QF+P    + A+
Sbjct: 135 VSLATLSCAGRRQPFFRGEFLALLSLLQQGDLSAEGLTGSWAGAFGQTQFMPSTYARIAV 194

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGWTKC 244
           D D DG+ DLV S  DA+AS A +L K GW + 
Sbjct: 195 DGDGDGRRDLVTSIPDALASTANYLVKAGWERA 227


>gi|325927220|ref|ZP_08188480.1| lytic murein transglycosylase [Xanthomonas perforans 91-118]
 gi|325542418|gb|EGD13900.1| lytic murein transglycosylase [Xanthomonas perforans 91-118]
          Length = 720

 Score =  121 bits (304), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 62/153 (40%), Positives = 91/153 (59%), Gaps = 1/153 (0%)

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
           DYL  L  S+ ++ G A+   +  LL  L ++ GV P  ++A+WG+E+ +G   GK PLL
Sbjct: 75  DYLASLVDSQRVSDGQAMLVTHRELLARLSEQTGVDPATIVAVWGVESDYGRVTGKRPLL 134

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAI 211
            +LATL+   RR  FF  +F   L L+++G +S+  L G+  G  GQ QF+P    + A+
Sbjct: 135 VSLATLSCAGRRQPFFRGEFLALLSLLQQGDLSAEGLTGSWAGAFGQTQFMPSTYARIAV 194

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGWTKC 244
           D D DG+ DLV S  DA+AS A +L K GW + 
Sbjct: 195 DGDGDGRRDLVTSIPDALASTANYLVKAGWERA 227


>gi|163744878|ref|ZP_02152238.1| hypothetical protein OIHEL45_04805 [Oceanibulbus indolifex HEL-45]
 gi|161381696|gb|EDQ06105.1| hypothetical protein OIHEL45_04805 [Oceanibulbus indolifex HEL-45]
          Length = 392

 Score =  121 bits (304), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 74/214 (34%), Positives = 109/214 (50%), Gaps = 6/214 (2%)

Query: 31  TQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRK--MVTSPP 88
           T +  S     F  + + A+A AV +G  P TA   FA L      +  D+   +   P 
Sbjct: 18  TAYAQSACGGDFSGFIADAKAEAVAKGADPATADGFFAGLRQDPAVLRADQAQGVFQKPF 77

Query: 89  VSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGK 148
           + F  +L    S++ I +G A+      +   ++ EYGV  G+L+A W  ET +G   G 
Sbjct: 78  IEFSRHL---ISNDRINRGRAMADKYDAIFDRVESEYGVSRGVLLAFWAFETDYGAIQGD 134

Query: 149 TPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVV 207
               + LATLA+DCRR + F  Q F AL+L ++G    +   GA  GEIG  Q LP +++
Sbjct: 135 FNTANALATLAHDCRRPELFRPQLFAALELFERGEFDPATTTGAWAGEIGMVQMLPRDII 194

Query: 208 KYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
           +  +D D DG++ L  S  DA+ S AK L  LGW
Sbjct: 195 ENGVDGDGDGEVSLKTSAPDALLSGAKMLQSLGW 228


>gi|226942996|ref|YP_002798069.1| lytic murein transglycosylase [Azotobacter vinelandii DJ]
 gi|226717923|gb|ACO77094.1| lytic murein transglycosylase [Azotobacter vinelandii DJ]
          Length = 438

 Score =  121 bits (304), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 68/205 (33%), Positives = 112/205 (54%), Gaps = 6/205 (2%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKM--VTSPPVSFKDYLDGLS 99
           F +W+   R  A+  G+ P+     FA +    T I+ DR     T P  +   YL+G  
Sbjct: 70  FEDWRDGFRNEALANGIQPQLFDQAFAGVAPDPTVISADRSQPEFTRPVWT---YLEGAL 126

Query: 100 SSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLA 159
           + + +  G  L   ++ LL  ++  YGV    L+A+WG+E++FG+ MG   ++ +LATLA
Sbjct: 127 AEKRVRSGKTLLSQHTALLERIEARYGVDRQALVAVWGMESNFGQVMGSKSVIRSLATLA 186

Query: 160 YDCRRAKFFTEQFFYALDLVKKG-VISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGK 218
           ++ RR +F  +Q   AL +++ G V     +G+  G +GQ QF+P   + +A+D D DG+
Sbjct: 187 FEGRRPQFAHDQLLAALSILQNGDVRPERMIGSWAGAMGQTQFIPTTYLSHAVDFDGDGR 246

Query: 219 IDLVKSNIDAIASAAKFLAKLGWTK 243
            D+  S  DA+AS A +L   GW +
Sbjct: 247 RDIWDSTADALASTAHYLQASGWRR 271


>gi|239814037|ref|YP_002942947.1| lytic murein transglycosylase [Variovorax paradoxus S110]
 gi|239800614|gb|ACS17681.1| lytic murein transglycosylase [Variovorax paradoxus S110]
          Length = 438

 Score =  121 bits (303), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 69/202 (34%), Positives = 106/202 (52%), Gaps = 2/202 (0%)

Query: 41  RFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSS 100
           RF +W +  RA A   G+   T +  F  +++L   I  DR         + DYLD   S
Sbjct: 68  RFAKWVADFRATARASGIREATLQSAFDQVQFLPRVIELDRAQPEFTRTVW-DYLDNTVS 126

Query: 101 SEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAY 160
            + IA G    +            YGVP  +++A+WG+E+++G   G TP++  LATL +
Sbjct: 127 PQRIATGQDKLQQVRAEADAAAARYGVPATVVVAIWGMESNYGGNYGSTPVIDALATLGF 186

Query: 161 DCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKI 219
           + RR  +   +   AL ++  G I+    +G+  G +GQ QFLP N + YA+DAD DG+ 
Sbjct: 187 EGRREDWARRELLAALKILDSGDIARDRMIGSWAGAMGQTQFLPSNFLAYAVDADGDGRR 246

Query: 220 DLVKSNIDAIASAAKFLAKLGW 241
           D+  S  D +AS A FL++ GW
Sbjct: 247 DIWGSMPDVVASTANFLSRSGW 268


>gi|213966847|ref|ZP_03394998.1| HopAJ2 protein [Pseudomonas syringae pv. tomato T1]
 gi|301381978|ref|ZP_07230396.1| lytic murein transglycosylase [Pseudomonas syringae pv. tomato
           Max13]
 gi|302058762|ref|ZP_07250303.1| lytic murein transglycosylase [Pseudomonas syringae pv. tomato K40]
 gi|302135138|ref|ZP_07261128.1| lytic murein transglycosylase [Pseudomonas syringae pv. tomato
           NCPPB 1108]
 gi|213928697|gb|EEB62241.1| HopAJ2 protein [Pseudomonas syringae pv. tomato T1]
          Length = 445

 Score =  121 bits (303), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 75/221 (33%), Positives = 119/221 (53%), Gaps = 9/221 (4%)

Query: 30  TTQFICSDT-----ADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMV 84
           T   +  DT     A  F EW++  RA+A++ G+        FAD+    + +  DR   
Sbjct: 53  TPALVVDDTLTIQPAVSFSEWQAGFRAQALKAGIRADVFDLAFADVTPDMSVVKADRSQP 112

Query: 85  T-SPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFG 143
             S PV   +YLDG  S+  + +G AL    +  L  ++++YGV    L+A+WG+E++FG
Sbjct: 113 EFSRPV--WEYLDGAISAVRVRKGQALLSQYADDLQKIEQQYGVDRQALVAVWGMESNFG 170

Query: 144 ETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFL 202
              G   ++ +LATLAY+ RR  F   Q   AL++++ G I+    LG+  G +GQ QF+
Sbjct: 171 SFQGSQSVIRSLATLAYEGRRPGFAQSQLLAALEIIQHGDITPDKMLGSWAGAMGQTQFI 230

Query: 203 PVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTK 243
           P     +A+D D DG+ D+  +  DA+AS A +L   GW +
Sbjct: 231 PTTYNTHAVDFDGDGRRDIWNTPADALASTAHYLQSSGWQR 271


>gi|262281539|ref|ZP_06059318.1| transglycosylase [Acinetobacter calcoaceticus RUH2202]
 gi|262256998|gb|EEY75737.1| transglycosylase [Acinetobacter calcoaceticus RUH2202]
          Length = 430

 Score =  121 bits (303), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 74/200 (37%), Positives = 110/200 (55%), Gaps = 16/200 (8%)

Query: 50  RARAVREGMSPKT----AKHLFADLEYLDTTIARDRKMVTSPPVSFK--DYLDGLSSSEI 103
           R++AV  G+S  T     ++L  D   +D       K+   P  S    DYL GL   E 
Sbjct: 57  RSQAVAAGVSGTTYDRYTQNLTPDYSVID-------KLNYQPEFSTPIWDYLSGLVDEER 109

Query: 104 IAQGIALKKANSRLLINLKKE-YGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDC 162
           +  G   K A  R ++N   + YGVPP  ++A+WG+E++FG+  GK PLL  L TL+ + 
Sbjct: 110 VELG-KQKLAQYRDVLNRASQTYGVPPETIVAVWGVESNFGDISGKYPLLQALGTLSCEG 168

Query: 163 RRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDL 221
           RR  +F  +FF  + ++++G ++   L G+  G  G  QF+P    + A+D D DG+ DL
Sbjct: 169 RRQSYFRTEFFATMRILQRGDLTEDQLKGSWAGAFGHTQFMPSTYERLAVDFDGDGRRDL 228

Query: 222 VKSNIDAIASAAKFLAKLGW 241
           V S +DA+AS A FL K GW
Sbjct: 229 VSSTVDALASTANFLNKAGW 248


>gi|260772437|ref|ZP_05881353.1| membrane-bound lytic murein transglycosylase B [Vibrio
           metschnikovii CIP 69.14]
 gi|260611576|gb|EEX36779.1| membrane-bound lytic murein transglycosylase B [Vibrio
           metschnikovii CIP 69.14]
          Length = 302

 Score =  121 bits (303), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 65/201 (32%), Positives = 112/201 (55%), Gaps = 2/201 (0%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F ++    + +A +EG+S +     FA++EY    +  DR       ++  +Y+      
Sbjct: 3   FEQYLEGLKQQARQEGISEQILAEAFANVEYRPRAVTADRNQ-PERRLTLDEYIPRAVPD 61

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             + Q  AL + +   L  + K+YGV P  ++ALWG+E++FG   G  P++  L+T+AYD
Sbjct: 62  WKVKQAQALYEKHYDELQRIGKQYGVQPRFIVALWGVESNFGSFTGNFPVIDALSTMAYD 121

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR +FF ++   AL ++++G I+   + G+  G +GQ QF+P + + +A D D DGK D
Sbjct: 122 GRREEFFRKETMAALQILQQGHITVDEMKGSWAGAMGQCQFMPSSFLAFAADGDGDGKKD 181

Query: 221 LVKSNIDAIASAAKFLAKLGW 241
           +  +  D  AS A +L+K GW
Sbjct: 182 IWGTKADVFASTANYLSKSGW 202


>gi|325917841|ref|ZP_08180020.1| lytic murein transglycosylase [Xanthomonas vesicatoria ATCC 35937]
 gi|325535952|gb|EGD07769.1| lytic murein transglycosylase [Xanthomonas vesicatoria ATCC 35937]
          Length = 720

 Score =  120 bits (302), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 98/172 (56%), Gaps = 4/172 (2%)

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
           DYL  L  S+ +  G A+   +  LL  L ++ GV P  ++A+WG+E+ +G   GK PLL
Sbjct: 75  DYLASLVDSQRVTDGQAMLVTHRDLLTRLSEQTGVDPATIVAVWGVESDYGRVTGKRPLL 134

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAI 211
            +LATL+   RR  FF  +F   L L+++G +S   L G+  G  GQ QF+P    + A+
Sbjct: 135 VSLATLSCAGRRQPFFRGEFLALLSLLQRGDLSPEQLTGSWAGAFGQTQFMPSTYARIAV 194

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNAS 263
           D D DG+ DLV S  DA+AS A +L K GW +    +P     A+ + ++AS
Sbjct: 195 DGDGDGRRDLVASIPDALASTANYLVKAGWERA---RPWGMEVALPRGFDAS 243


>gi|56478199|ref|YP_159788.1| putative peptidoglycan-binding protein [Aromatoleum aromaticum
           EbN1]
 gi|56314242|emb|CAI08887.1| putative peptidoglycan-binding protein [Aromatoleum aromaticum
           EbN1]
          Length = 401

 Score =  120 bits (302), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 91/150 (60%), Gaps = 1/150 (0%)

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
           DYL GL   E +A G A+    +  L +++  YGV P  ++A+WG+E++FG   GK PLL
Sbjct: 77  DYLAGLVDDERVADGRAMAVQWAGTLQDIEARYGVDPATVVAVWGVESNFGRNFGKRPLL 136

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVISS-HALGATFGEIGQFQFLPVNVVKYAI 211
            +LATL+   RR  +F  +FF AL +++ G I++ H  G+  G  G  QF+P    + A+
Sbjct: 137 VSLATLSCFGRRQDYFRGEFFTALKIIEDGDIAAQHLAGSWAGAFGHTQFMPSTFRRVAV 196

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
           D D DG+ DL+ S  DA+AS A FL K GW
Sbjct: 197 DFDGDGRRDLIDSIPDALASTANFLRKAGW 226


>gi|117620167|ref|YP_856660.1| membrane-bound lytic murein transglycosylase B [Aeromonas
           hydrophila subsp. hydrophila ATCC 7966]
 gi|117561574|gb|ABK38522.1| membrane-bound lytic murein transglycosylase B [Aeromonas
           hydrophila subsp. hydrophila ATCC 7966]
          Length = 319

 Score =  120 bits (302), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 71/201 (35%), Positives = 109/201 (54%), Gaps = 2/201 (0%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F  + +  +  A+  G+SP T    FAD+  ++  I  D+        +   Y+      
Sbjct: 24  FEHYVTGLKQEALAAGISPATVATAFADIHLIEVAIRHDKNQPEFKQ-TLATYIPRAVPQ 82

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             + Q   L +    LL  +  EY V P  ++ALWG+ET+FG+  GK PL+S+LATLA++
Sbjct: 83  WKVNQAKRLYRQYLPLLTKIGAEYDVQPRFIVALWGIETNFGKLTGKYPLVSSLATLAWE 142

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR  FF  Q F AL ++++  ++   L G+  G +GQ QF+P + +KYA+D D DGK D
Sbjct: 143 GRREAFFKGQLFDALRILEQQKMAPADLKGSWAGAMGQVQFMPSSYLKYAVDQDGDGKQD 202

Query: 221 LVKSNIDAIASAAKFLAKLGW 241
           L  +  D   SAA +L + GW
Sbjct: 203 LWGNLADVFGSAANYLHQNGW 223


>gi|254429098|ref|ZP_05042805.1| lytic murein transglycosylase subfamily [Alcanivorax sp. DG881]
 gi|196195267|gb|EDX90226.1| lytic murein transglycosylase subfamily [Alcanivorax sp. DG881]
          Length = 398

 Score =  120 bits (302), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 66/155 (42%), Positives = 90/155 (58%), Gaps = 1/155 (0%)

Query: 90  SFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKT 149
           SF DY     S   I  G    +    LL  L +EYG+P   L+A WGLET++G  +G  
Sbjct: 75  SFSDYYTRRVSETRIETGRKKYREQQPLLQALTREYGIPGHYLVAFWGLETNYGGFLGSI 134

Query: 150 PLLSTLATLAYDCRRAKFFTEQFFYALDLVKKG-VISSHALGATFGEIGQFQFLPVNVVK 208
           P+L  L+TLA + RR  +F+ +   AL +++ G V +S   G+  G +GQ QF+P   +K
Sbjct: 135 PVLDALSTLACEGRRGDYFSGELMNALRIIQSGDVEASQMEGSWAGAMGQTQFMPAIFLK 194

Query: 209 YAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTK 243
           YAID D DG  +L KS  DA+ASAA FL  LGW +
Sbjct: 195 YAIDHDGDGHRNLWKSEDDALASAANFLQGLGWQR 229


>gi|126728845|ref|ZP_01744660.1| hypothetical protein SSE37_08458 [Sagittula stellata E-37]
 gi|126710775|gb|EBA09826.1| hypothetical protein SSE37_08458 [Sagittula stellata E-37]
          Length = 271

 Score =  120 bits (302), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 75/248 (30%), Positives = 120/248 (48%), Gaps = 6/248 (2%)

Query: 35  CSDTADRFGEWKSA----ARARAV-REGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPV 89
           C      FG +K+A    A +R V + G+       L +     ++  +    +  + P 
Sbjct: 23  CITDQGSFGAYKAAFAQQAASRGVGQRGLQALQGAQLSSITWRFESRPSSQTGVSHADPA 82

Query: 90  SFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKT 149
           +F     G S+   +    +    N+ L  +++++YGVP  +L  +WGLET +G  +GKT
Sbjct: 83  TFLAKRTGGSAQAFVNAARSRMNKNANLFNSIERQYGVPGSVLAVIWGLETSWGGYLGKT 142

Query: 150 PLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKY 209
           P++    TLA  CRR   F      AL +V +G+IS +  G   GE+G  QFL  N ++Y
Sbjct: 143 PIVGGAVTLASYCRRHPRFEPHAEAALMMVDRGMISPNTQGGPSGELGHMQFLAGNWMRY 202

Query: 210 AIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKT 269
            +DA+ DG+ D   +     ++A     + GW K   +  G +NF  L  WN S NY + 
Sbjct: 203 GVDANGDGRADPYNAADALASAANLLR-QNGWQKGQPFGEGTRNFRALSAWNDSGNYQRA 261

Query: 270 IAYIAAHI 277
           IAY A  +
Sbjct: 262 IAYAAQAV 269


>gi|221133642|ref|ZP_03559947.1| lytic murein transglycosylase [Glaciecola sp. HTCC2999]
          Length = 398

 Score =  120 bits (302), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 77/214 (35%), Positives = 105/214 (49%), Gaps = 8/214 (3%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPP--VSFKDYLDGLS 99
           F E  SA   +A   G+S  T        +  +  +  DR     P    +F DY     
Sbjct: 26  FSECISALTTQAKSNGISQVTIDKTLKKAKQREQVVKLDR---NQPEFLATFADYYSKRV 82

Query: 100 SSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLA 159
           +   I +G      +   L  L  +YG+P   LM+ WGLET++G   GK P +  LATLA
Sbjct: 83  NDWRINKGREKFNEHREFLQALTDQYGIPGQYLMSFWGLETNYGGYKGKIPTIDALATLA 142

Query: 160 YDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGK 218
            + RR  FFT +    LD+V+   +    + G+  G +G  QF+P    +YAID D DG 
Sbjct: 143 CEPRRKTFFTNELMTMLDIVQNQSLDVDTMKGSWAGAMGHTQFMPTTYAQYAIDGDGDGN 202

Query: 219 IDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEK 252
           IDL  S  DA+ASAA FL KLGW    GY+ G +
Sbjct: 203 IDLFNSERDALASAANFLHKLGWE--PGYRWGRE 234


>gi|54308274|ref|YP_129294.1| putative lytic murein transglycosylase [Photobacterium profundum
           SS9]
 gi|46912702|emb|CAG19492.1| putative lytic murein transglycosylase [Photobacterium profundum
           SS9]
          Length = 323

 Score =  120 bits (302), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 65/202 (32%), Positives = 107/202 (52%), Gaps = 2/202 (0%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F E+ S  +  A   G+S       F +++Y +  +  D+       ++  +Y+      
Sbjct: 27  FDEYVSGLKVEARSNGISESIINSAFDNIQYTERAVKADKNQ-PEKKLTLDEYIPRAVPD 85

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             + Q   L   +   L  + +EYGV P  ++ALWG+E++FG  MG   ++  L+TLAYD
Sbjct: 86  WKVKQANRLYNEHKTALDRIGREYGVQPRFIVALWGVESNFGRLMGDYNVVEALSTLAYD 145

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR  FF +Q   AL ++ +G I+   + G+  G +GQ QF+P + + YA+D + DGKID
Sbjct: 146 GRREAFFRKQVMAALQILNEGHIAPENMKGSWAGAMGQPQFIPTSFLTYAVDGNNDGKID 205

Query: 221 LVKSNIDAIASAAKFLAKLGWT 242
           + ++  D  ASAA +L   GW 
Sbjct: 206 IWQNVDDVFASAANYLKMSGWN 227


>gi|326572366|gb|EGE22359.1| lytic murein transglycosylase [Moraxella catarrhalis BC7]
          Length = 473

 Score =  120 bits (302), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 67/182 (36%), Positives = 100/182 (54%), Gaps = 12/182 (6%)

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
           DYL  L  SE +  GI  K   + +L  ++  YGV P  ++ +WG+E++FG+T+GK  L 
Sbjct: 83  DYLASLVDSERVQDGIRAKHEQADVLRRIESRYGVKPEHVLGVWGVESNFGQTLGKKNLF 142

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAI 211
           ++LATL+   RR  +F  ++  AL +V+ G I    + G+  G  GQ QF+P   ++ A+
Sbjct: 143 NSLATLSCFDRRQSYFRGEYANALKIVQNGDIHPEDMTGSWAGAFGQTQFMPSTFLELAV 202

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGW---------TKCAGYQ--PGEKNFAILKHW 260
           D D DG+ DLV S  DA+AS A FL K G+          +  GY    G +N   + HW
Sbjct: 203 DFDGDGRKDLVNSKADALASTANFLVKRGYRLGEPWGYEVRLNGYNGSSGRRNKQSINHW 262

Query: 261 NA 262
            A
Sbjct: 263 RA 264


>gi|166710102|ref|ZP_02241309.1| transglycolase; epimerase [Xanthomonas oryzae pv. oryzicola BLS256]
          Length = 720

 Score =  120 bits (302), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 61/153 (39%), Positives = 91/153 (59%), Gaps = 1/153 (0%)

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
           DYL  L  S+ +  G A+   +  LL  L ++ GV P  ++A+WG+E+ +G   GK PLL
Sbjct: 75  DYLASLVDSQRVTDGQAMLVTHRALLTRLSEQTGVDPATIVAVWGVESDYGRVTGKRPLL 134

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAI 211
            +LATL+   RR  FF ++F   L L+++G +++  L G+  G  GQ QF+P    + A+
Sbjct: 135 VSLATLSCAGRRQPFFRDEFLALLSLLQRGDLAADGLTGSWAGAFGQTQFMPSTYTRIAV 194

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGWTKC 244
           D D DG+ DLV S  DA+AS A +L K GW + 
Sbjct: 195 DGDGDGRRDLVASIPDALASTANYLVKAGWERA 227


>gi|255262308|ref|ZP_05341650.1| lytic murein transglycosylase [Thalassiobium sp. R2A62]
 gi|255104643|gb|EET47317.1| lytic murein transglycosylase [Thalassiobium sp. R2A62]
          Length = 413

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 77/238 (32%), Positives = 120/238 (50%), Gaps = 7/238 (2%)

Query: 11  LLMMVYPMLAQAVT----QPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHL 66
           +L  + P+ AQA      +P+   T      +      W    RARA+ +G+   T   +
Sbjct: 8   VLACLLPIGAQAAPDTAPRPQARITLAQADGSTAGLEHWIINFRARAISKGIEAATLNSV 67

Query: 67  FADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYG 126
             +L Y    I RDR   +    +  DYLD  +S   +  G A  + +  LL  ++  YG
Sbjct: 68  LRNLTYDRDIIRRDRNQ-SEFTKTIWDYLDTAASDLRVKNGQAALRKHETLLSEIETLYG 126

Query: 127 VPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISS 186
           V   I++A+WGLE+ +G   G  P++ +LATLAYD RR  FF EQ   AL +++ G  ++
Sbjct: 127 VDRHIVVAIWGLESSYGAFRGSQPVIQSLATLAYDGRRGDFFEEQLIAALRILQTGDTTA 186

Query: 187 HAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSN-IDAIASAAKFLAKLGWT 242
             + G+  G +G  QF+P + + Y +D   DG  D+   +  DA+AS A +L   GWT
Sbjct: 187 QNMTGSWAGAMGHTQFIPTSYLDYVVDFRGDGARDIWSDDPTDALASTAAYLKAFGWT 244


>gi|296112423|ref|YP_003626361.1| lytic murein transglycosylase [Moraxella catarrhalis RH4]
 gi|295920117|gb|ADG60468.1| lytic murein transglycosylase [Moraxella catarrhalis RH4]
          Length = 473

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 67/182 (36%), Positives = 99/182 (54%), Gaps = 12/182 (6%)

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
           DYL  L  SE +  GI  K   + +L  ++  YGV P  ++ +WG+E++FG+T+GK  L 
Sbjct: 83  DYLASLVDSERVQDGIRAKHEQADVLRRIESRYGVKPEHVLGVWGVESNFGQTLGKKNLF 142

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAI 211
            +LATL+   RR  +F  ++  AL +V+ G I    + G+  G  GQ QF+P   ++ A+
Sbjct: 143 DSLATLSCFDRRQSYFRGEYANALKIVQNGDIRPEDMTGSWAGAFGQTQFMPSTFLELAV 202

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGW---------TKCAGYQ--PGEKNFAILKHW 260
           D D DG+ DLV S  DA+AS A FL K G+          +  GY    G +N   + HW
Sbjct: 203 DFDGDGRKDLVNSKADALASTANFLVKRGYRLGEPWGYEVRLNGYNGSSGRRNKQSINHW 262

Query: 261 NA 262
            A
Sbjct: 263 RA 264


>gi|56460924|ref|YP_156205.1| membrane-bound lytic murein transglycosylase [Idiomarina loihiensis
           L2TR]
 gi|56179934|gb|AAV82656.1| Membrane-bound lytic murein transglycosylase [Idiomarina loihiensis
           L2TR]
          Length = 345

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 75/212 (35%), Positives = 111/212 (52%), Gaps = 10/212 (4%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDY 94
             D   +F  +  A +A A+  G    T    FA ++Y +  +  D+         FK  
Sbjct: 40  SEDVNQQFATYVEALKAEAIESGYKQDTLDKAFAKVKYYERAVELDKNQP-----EFKLT 94

Query: 95  LDGLSSSEI--IAQGIALKKANS--RLLINLKKEYGVPPGILMALWGLETHFGETMGKTP 150
           LD      +       AL+K N    LL  + KEYGV P  ++ALWG+ET+FG   G   
Sbjct: 95  LDTYLPRAVPDWKAEKALEKYNEHKELLEKVGKEYGVQPRFIVALWGIETNFGSFTGGFD 154

Query: 151 LLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKY 209
           ++S L TLA+D RR +FF +Q + AL +++ G I    + G+  G +GQ QF+P + + Y
Sbjct: 155 VVSALTTLAFDGRREEFFKKQLWEALTIIEDGHIEPEQMKGSWAGAMGQTQFMPSSFMSY 214

Query: 210 AIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
           A+D D DGK D+  S  D  ASAA +L+ +GW
Sbjct: 215 AVDYDGDGKKDIWGSYPDVFASAANYLSSVGW 246


>gi|326578049|gb|EGE27913.1| lytic murein transglycosylase [Moraxella catarrhalis O35E]
          Length = 473

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 67/182 (36%), Positives = 99/182 (54%), Gaps = 12/182 (6%)

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
           DYL  L  SE +  GI  K   + +L  ++  YGV P  ++ +WG+E++FG+T+GK  L 
Sbjct: 83  DYLASLVDSERVQDGIRAKHEQADVLRRIESRYGVKPEHVLGVWGVESNFGQTLGKKNLF 142

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAI 211
            +LATL+   RR  +F  ++  AL +V+ G I    + G+  G  GQ QF+P   ++ A+
Sbjct: 143 DSLATLSCFDRRQSYFRGEYANALKIVQNGDIHPEDMTGSWAGAFGQTQFMPSTFLELAV 202

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGW---------TKCAGYQ--PGEKNFAILKHW 260
           D D DG+ DLV S  DA+AS A FL K G+          +  GY    G +N   + HW
Sbjct: 203 DFDGDGRKDLVNSKADALASTANFLVKRGYRLGEPWGYEVRLNGYNGSSGRRNKQSINHW 262

Query: 261 NA 262
            A
Sbjct: 263 RA 264


>gi|152985260|ref|YP_001346502.1| putative lipoprotein [Pseudomonas aeruginosa PA7]
 gi|150960418|gb|ABR82443.1| lipoprotein, putative [Pseudomonas aeruginosa PA7]
          Length = 448

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 70/219 (31%), Positives = 117/219 (53%), Gaps = 2/219 (0%)

Query: 24  TQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKM 83
           T P  ++     +  A  F +W+ A R +A+ +G+  +T    FAD++     +  DR  
Sbjct: 58  TVPGYSSVTADAAQPAQSFEQWREAFRQQALADGIDAQTFDRAFADVQPDPAVVEADRSQ 117

Query: 84  VTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFG 143
                  +K YL+G      + QG A    ++R+L  +   Y V    ++A+WG+E+++G
Sbjct: 118 PEFTRPVWK-YLEGALDPLRVRQGQARLARHARILEQVDARYAVDANAVVAIWGMESNYG 176

Query: 144 ETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKG-VISSHALGATFGEIGQFQFL 202
             MG   ++ +LATLAY+ RR +F   Q   +L +++ G V +S  +G+  G +GQ QF+
Sbjct: 177 SHMGNKNVIRSLATLAYEGRRPEFAHAQLLASLKILQHGDVPASFMIGSWAGAMGQTQFI 236

Query: 203 PVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
           P    +YA+D D DG+ D+  S  DA+AS A +L   GW
Sbjct: 237 PTTYNQYAVDFDGDGRRDIWGSPGDALASTANYLKASGW 275


>gi|326567028|gb|EGE17151.1| lytic murein transglycosylase [Moraxella catarrhalis 12P80B1]
          Length = 473

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 67/182 (36%), Positives = 99/182 (54%), Gaps = 12/182 (6%)

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
           DYL  L  SE +  GI  K   + +L  ++  YGV P  ++ +WG+E++FG+T+GK  L 
Sbjct: 83  DYLASLVDSERVQDGIRAKHEQADVLRRIESRYGVKPEHVLGVWGVESNFGQTLGKKNLF 142

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAI 211
            +LATL+   RR  +F  ++  AL +V+ G I    + G+  G  GQ QF+P   ++ A+
Sbjct: 143 DSLATLSCFDRRQSYFRGEYANALKIVQNGDIHPEDMTGSWAGAFGQTQFMPSTFLELAV 202

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGW---------TKCAGYQ--PGEKNFAILKHW 260
           D D DG+ DLV S  DA+AS A FL K G+          +  GY    G +N   + HW
Sbjct: 203 DFDGDGRKDLVNSKADALASTANFLVKRGYRLGEPWGYEVRLNGYNGSSGRRNKQSINHW 262

Query: 261 NA 262
            A
Sbjct: 263 RA 264


>gi|326570329|gb|EGE20373.1| lytic murein transglycosylase [Moraxella catarrhalis BC1]
          Length = 473

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 67/182 (36%), Positives = 99/182 (54%), Gaps = 12/182 (6%)

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
           DYL  L  SE +  GI  K   + +L  ++  YGV P  ++ +WG+E++FG+T+GK  L 
Sbjct: 83  DYLASLVDSERVQDGIRAKHEQADVLRRIESRYGVKPEHVLGVWGVESNFGQTLGKKNLF 142

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAI 211
            +LATL+   RR  +F  ++  AL +V+ G I    + G+  G  GQ QF+P   ++ A+
Sbjct: 143 DSLATLSCFDRRQSYFRGEYANALKIVQNGDIHPEDMTGSWAGAFGQTQFMPSTFLELAV 202

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGW---------TKCAGYQ--PGEKNFAILKHW 260
           D D DG+ DLV S  DA+AS A FL K G+          +  GY    G +N   + HW
Sbjct: 203 DFDGDGRKDLVNSKADALASTANFLVKRGYRLGEPWGYEVRLNGYNGSSGRRNKQSINHW 262

Query: 261 NA 262
            A
Sbjct: 263 RA 264


>gi|326561927|gb|EGE12262.1| lytic murein transglycosylase [Moraxella catarrhalis 7169]
 gi|326569567|gb|EGE19621.1| lytic murein transglycosylase [Moraxella catarrhalis BC8]
          Length = 473

 Score =  120 bits (301), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 67/182 (36%), Positives = 99/182 (54%), Gaps = 12/182 (6%)

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
           DYL  L  SE +  GI  K   + +L  ++  YGV P  ++ +WG+E++FG+T+GK  L 
Sbjct: 83  DYLASLVDSERVQDGIRAKHEQADVLRRIESRYGVKPEHVLGVWGVESNFGQTLGKKNLF 142

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAI 211
            +LATL+   RR  +F  ++  AL +V+ G I    + G+  G  GQ QF+P   ++ A+
Sbjct: 143 DSLATLSCFDRRQSYFRGEYANALKIVQNGDIHPEDMTGSWAGAFGQTQFMPSTFLELAV 202

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGW---------TKCAGYQ--PGEKNFAILKHW 260
           D D DG+ DLV S  DA+AS A FL K G+          +  GY    G +N   + HW
Sbjct: 203 DFDGDGRKDLVNSKADALASTANFLVKRGYRLGEPWGYEVRLNGYNGSSGRRNKQSINHW 262

Query: 261 NA 262
            A
Sbjct: 263 RA 264


>gi|326563045|gb|EGE13319.1| lytic murein transglycosylase [Moraxella catarrhalis 103P14B1]
 gi|326573639|gb|EGE23598.1| lytic murein transglycosylase [Moraxella catarrhalis CO72]
 gi|326577288|gb|EGE27176.1| lytic murein transglycosylase [Moraxella catarrhalis 101P30B1]
          Length = 473

 Score =  120 bits (300), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 67/182 (36%), Positives = 99/182 (54%), Gaps = 12/182 (6%)

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
           DYL  L  SE +  GI  K   + +L  ++  YGV P  ++ +WG+E++FG+T+GK  L 
Sbjct: 83  DYLASLVDSERVQDGIRAKHEQADVLRRIESRYGVKPEHVLGVWGVESNFGQTLGKKNLF 142

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAI 211
            +LATL+   RR  +F  ++  AL +V+ G I    + G+  G  GQ QF+P   ++ A+
Sbjct: 143 DSLATLSCFDRRQSYFRGEYANALKIVQNGDIHPEDMTGSWAGAFGQTQFMPSTFLELAV 202

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGW---------TKCAGYQ--PGEKNFAILKHW 260
           D D DG+ DLV S  DA+AS A FL K G+          +  GY    G +N   + HW
Sbjct: 203 DFDGDGRKDLVNSKADALASTANFLVKRGYRLGEPWGYEVRLNGYNGSSGRRNKQSINHW 262

Query: 261 NA 262
            A
Sbjct: 263 RA 264


>gi|326560825|gb|EGE11191.1| lytic murein transglycosylase [Moraxella catarrhalis 46P47B1]
          Length = 473

 Score =  120 bits (300), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 67/182 (36%), Positives = 99/182 (54%), Gaps = 12/182 (6%)

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
           DYL  L  SE +  GI  K   + +L  ++  YGV P  ++ +WG+E++FG+T+GK  L 
Sbjct: 83  DYLASLVDSERVQDGIRAKHEQADVLRRIESRYGVKPEHVLGVWGVESNFGQTLGKKNLF 142

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAI 211
            +LATL+   RR  +F  ++  AL +V+ G I    + G+  G  GQ QF+P   ++ A+
Sbjct: 143 DSLATLSCFDRRQSYFRGEYANALKIVQNGDIHPEDMTGSWAGAFGQTQFMPSTFLELAV 202

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGW---------TKCAGYQ--PGEKNFAILKHW 260
           D D DG+ DLV S  DA+AS A FL K G+          +  GY    G +N   + HW
Sbjct: 203 DFDGDGRKDLVNSKADALASTANFLVKRGYRLGEPWGYEVRLNGYNGSSGRRNKQSINHW 262

Query: 261 NA 262
            A
Sbjct: 263 RA 264


>gi|330960159|gb|EGH60419.1| hypothetical protein PMA4326_16506 [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 445

 Score =  120 bits (300), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 70/204 (34%), Positives = 113/204 (55%), Gaps = 4/204 (1%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVT-SPPVSFKDYLDGLSS 100
           F EW++  RA+A++ G+        FA +    + +  DR     S PV   +YLDG  S
Sbjct: 70  FSEWQAGFRAQALKAGIRADVFDQAFAGVTPDMSVVKADRSQPEFSRPV--WEYLDGAIS 127

Query: 101 SEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAY 160
           +  + +G AL    +  L  ++++YGV    L+A+WG+E++FG   G   ++ +LATLAY
Sbjct: 128 AARVRKGQALLSQYADDLQKIEQQYGVDRQALVAVWGMESNFGSFQGTQSVIRSLATLAY 187

Query: 161 DCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKI 219
           + RR  F   Q   AL++++ G I+    LG+  G +GQ QF+P     +A+D D DG+ 
Sbjct: 188 EGRRPGFAQSQLLAALEIIQHGDITPDKMLGSWAGAMGQTQFIPTTYNTHAVDFDGDGRR 247

Query: 220 DLVKSNIDAIASAAKFLAKLGWTK 243
           D+  +  DA+AS A +L   GW +
Sbjct: 248 DIWNTPADALASTAHYLQSSGWQR 271


>gi|328544294|ref|YP_004304403.1| Lytic murein transglycosylase subfamily [polymorphum gilvum
           SL003B-26A1]
 gi|326414036|gb|ADZ71099.1| Lytic murein transglycosylase subfamily [Polymorphum gilvum
           SL003B-26A1]
          Length = 379

 Score =  120 bits (300), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 67/195 (34%), Positives = 101/195 (51%), Gaps = 2/195 (1%)

Query: 50  RARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIA 109
           +A AV  G+S + A    A+     T ++RDR        +F ++     +S  +  G A
Sbjct: 23  KAEAVAAGLSAQAADATLANARIDKTVLSRDRAQGVFK-QTFLEFSKRSVNSYRLKHGAA 81

Query: 110 LKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFT 169
                + +    +  YGVP  ++ A W LET FG   G    ++ LATLA+DCRR   F 
Sbjct: 82  NMTKYASVFARAEANYGVPAAVITAFWALETDFGAVQGDFNTVNALATLAHDCRRPHLFR 141

Query: 170 EQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDA 228
            Q   A+ +V+ G +  +   GA  GEIGQ Q LP ++++Y +D D D  +DL  S  DA
Sbjct: 142 PQLIAAIHMVQNGDLDPARTTGAWAGEIGQVQMLPEDIIRYGVDGDGDAHVDLKASAPDA 201

Query: 229 IASAAKFLAKLGWTK 243
           I +AA+F+  LGW +
Sbjct: 202 ILTAARFIQSLGWRR 216


>gi|21110734|gb|AAM39126.1| transglycolase [Xanthomonas axonopodis pv. citri str. 306]
          Length = 828

 Score =  120 bits (300), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 62/153 (40%), Positives = 89/153 (58%), Gaps = 1/153 (0%)

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
           DYL  L  S+ +  G A+   +  LL  L  + GV P  ++A+WG+E+ +G   GK PLL
Sbjct: 183 DYLASLVDSQRVTDGQAMLVTHRELLSRLSDQTGVDPATIVAVWGVESDYGRVTGKRPLL 242

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAI 211
            +LATL+   RR  FF  +F   L L+++G +S+  L G+  G  GQ QF+P    + A+
Sbjct: 243 VSLATLSCAGRRQPFFRGEFLALLSLLQQGDLSADGLTGSWAGAFGQTQFMPSTYARIAV 302

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGWTKC 244
           D D DG+ DLV S  DA+AS A +L K GW + 
Sbjct: 303 DGDGDGRRDLVTSIPDALASTANYLVKAGWERA 335


>gi|184156347|ref|YP_001844686.1| membrane-bound lytic murein transglycosylase B [Acinetobacter
           baumannii ACICU]
 gi|183207941|gb|ACC55339.1| Membrane-bound lytic murein transglycosylase B [Acinetobacter
           baumannii ACICU]
          Length = 430

 Score =  119 bits (299), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 78/234 (33%), Positives = 118/234 (50%), Gaps = 17/234 (7%)

Query: 18  MLAQAVTQPKKATTQFICSDT---ADRFGEWKSAARARAVREGMSPKT----AKHLFADL 70
           ++    T    AT     SDT    + F    +  R++A+  G+S  T     ++L  D 
Sbjct: 22  LVINGSTISSNATVPVTNSDTYTPNNNFQSCLANLRSQAIAAGVSGSTYDGYTQNLTPDY 81

Query: 71  EYLDTTIARDRKMVTSPPVSFK--DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVP 128
             +D       K+   P  S    DYL GL   E +A G      +  +L    +EYGVP
Sbjct: 82  SVID-------KLNYQPEFSTPIWDYLSGLVDEERVALGKQKLVQHRDVLNRASQEYGVP 134

Query: 129 PGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHA 188
              ++A+WG+E++FG+  GK PLL  L TL+ + RR  +F  +FF  + ++++G ++   
Sbjct: 135 AETIVAVWGVESNFGDISGKYPLLQALGTLSCEGRRQSYFRTEFFATMRILQRGDLTEDQ 194

Query: 189 L-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
           L G+  G  G  QF+P    + A+D D DG+ DLV S  DA+AS A FL K GW
Sbjct: 195 LKGSWAGAFGHTQFMPSTYERLAVDFDGDGRRDLVSSTADALASTANFLNKAGW 248


>gi|58424505|gb|AAW73542.1| transglycolase; epimerase [Xanthomonas oryzae pv. oryzae KACC10331]
          Length = 772

 Score =  119 bits (299), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 60/153 (39%), Positives = 91/153 (59%), Gaps = 1/153 (0%)

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
           DYL  L  ++ +  G A+   +  LL  L ++ GV P  ++A+WG+E+ +G   GK PLL
Sbjct: 127 DYLASLVDNQRVTDGQAMLVTHRALLTRLSEQTGVDPATIVAVWGVESDYGRVTGKRPLL 186

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAI 211
            +LATL+   RR  FF ++F   L L+++G +++  L G+  G  GQ QF+P    + A+
Sbjct: 187 VSLATLSCAGRRQPFFRDEFLALLSLLQRGDLAADGLTGSWAGAFGQTQFMPSTYTRIAV 246

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGWTKC 244
           D D DG+ DLV S  DA+AS A +L K GW + 
Sbjct: 247 DGDGDGRRDLVASIPDALASTANYLVKAGWERA 279


>gi|289662030|ref|ZP_06483611.1| epimerase [Xanthomonas campestris pv. vasculorum NCPPB702]
          Length = 713

 Score =  119 bits (299), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 62/153 (40%), Positives = 90/153 (58%), Gaps = 1/153 (0%)

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
           DYL  L  S+ +  G A+   +  LL  L ++ GV P  ++A+WG+E+ +G   GK PLL
Sbjct: 68  DYLASLVDSQRVTDGQAMLVTHRELLSRLSEQTGVDPATVVAVWGVESDYGRVTGKRPLL 127

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAI 211
            +LATL+   RR  FF  +F   L L+++G +S+  L G+  G  GQ QF+P    + A+
Sbjct: 128 VSLATLSCAGRRQPFFRGEFLALLSLLQQGDLSADGLTGSWAGAFGQTQFMPSTYARIAV 187

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGWTKC 244
           D D DG+ DLV S  DA+AS A +L K GW + 
Sbjct: 188 DGDGDGRRDLVASIPDALASTANYLVKAGWERA 220


>gi|118590195|ref|ZP_01547598.1| putative transglycosylase transmembrane protein [Stappia aggregata
           IAM 12614]
 gi|118437167|gb|EAV43805.1| putative transglycosylase transmembrane protein [Stappia aggregata
           IAM 12614]
          Length = 416

 Score =  119 bits (299), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 89/334 (26%), Positives = 135/334 (40%), Gaps = 58/334 (17%)

Query: 6   YLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKH 65
           + + S L     + A A+     AT           F ++ +  +  A+ +G+S   A  
Sbjct: 17  FFMTSRLRFTPKLAATALAGFWLATAPAQAQQCGGDFRQFLAGVKQEALAKGLSANAADQ 76

Query: 66  LFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEY 125
             A  +     ++RDR       ++F D+   + S   +  G A  K  + +  + + EY
Sbjct: 77  TLAGAQVDRKVLSRDRAQGVFK-MTFLDFSQRVISGYRMKNGAANMKKYANVFQHTESEY 135

Query: 126 GVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVIS 185
           GVP  ++ A W LET FG   G    ++ LATLA+DCRR + F  Q   A+++V+ G + 
Sbjct: 136 GVPAPVITAFWALETDFGAVQGDFNTVNALATLAHDCRRPELFRPQLIAAIEMVQHGDLD 195

Query: 186 SH-ALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTK- 243
                GA  GEIG  Q LP +++K+  D D DG + L +S  DAI +A  F+  LGW + 
Sbjct: 196 PRTTTGAWAGEIGMVQMLPEDIIKFGRDGDGDGHVKLKESAADAILTAGAFIQHLGWRRG 255

Query: 244 ------------------------------CAGYQP-----------------GEK---- 252
                                           G QP                 G K    
Sbjct: 256 EPWLQEVKVTQNLNWAESGLDKTKTGAQWAALGVQPRWGQIAGNLPASLLLPQGRKGPAF 315

Query: 253 ----NFAILKHWNASLNYNKTIAYIAAHIDGVPI 282
               N+ I   WN S  Y  T AY A  + G P+
Sbjct: 316 LAYPNYNIYLEWNQSFVYTTTAAYFATRLAGAPV 349


>gi|304391734|ref|ZP_07373676.1| lytic murein transglycosylase [Ahrensia sp. R2A130]
 gi|303295963|gb|EFL90321.1| lytic murein transglycosylase [Ahrensia sp. R2A130]
          Length = 389

 Score =  119 bits (299), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 72/196 (36%), Positives = 111/196 (56%), Gaps = 10/196 (5%)

Query: 51  ARAVREGMS----PKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQ 106
           ARA++ G+S     K  + L AD   +D    +  ++V   P+    Y+    +  ++  
Sbjct: 35  ARAIKAGISKSIVSKATRGLKAD-PSIDRLTKKQPELVK--PIG--GYITSRVNGRLVTT 89

Query: 107 GIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAK 166
           G A  KAN RL  NLKK +GV P I+ A+WG+ET FG  +GK+ +  +LATL++   R  
Sbjct: 90  GRAKAKANRRLAKNLKKTFGVDPNIVFAIWGMETGFGAGIGKSNVPRSLATLSWKQYRGD 149

Query: 167 FFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSN 225
           FFT++F  AL + +   +    + G+  G +GQ QF+P +  K+A+D + +GK DL +  
Sbjct: 150 FFTKEFVDALRIAEAEKLDPRKMVGSWAGAMGQTQFIPSSFRKFAVDMNNNGKRDLWRET 209

Query: 226 IDAIASAAKFLAKLGW 241
            DA+AS A FLA  GW
Sbjct: 210 GDALASTANFLASYGW 225


>gi|66047584|ref|YP_237425.1| hypothetical protein Psyr_4357 [Pseudomonas syringae pv. syringae
           B728a]
 gi|63258291|gb|AAY39387.1| HopAJ2 protein [Pseudomonas syringae pv. syringae B728a]
          Length = 445

 Score =  119 bits (298), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 70/204 (34%), Positives = 113/204 (55%), Gaps = 4/204 (1%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVT-SPPVSFKDYLDGLSS 100
           F EW++  RA+A++ G+        FA +    + +  DR     S PV   +YLDG  S
Sbjct: 70  FSEWQAGFRAQALKAGIRADVFDLAFAGVTPDMSVVKADRSQPEFSRPV--WEYLDGAIS 127

Query: 101 SEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAY 160
           +  + +G AL    +  L  ++++YGV    L+A+WG+E++FG   G   ++ +LATLAY
Sbjct: 128 AARVRKGQALLSQYADDLQKIEQQYGVDRQTLVAVWGMESNFGSLQGTQSVIRSLATLAY 187

Query: 161 DCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKI 219
           + RR  F   Q   AL++++ G I+    LG+  G +GQ QF+P     +A+D D DG+ 
Sbjct: 188 EGRRPGFAQSQLLAALEIIQHGDITPDKMLGSWAGAMGQTQFIPTTYNTHAVDFDGDGRR 247

Query: 220 DLVKSNIDAIASAAKFLAKLGWTK 243
           D+  +  DA+AS A +L   GW +
Sbjct: 248 DIWNTPADALASTAHYLQSSGWQR 271


>gi|77748773|ref|NP_644590.2| epimerase [Xanthomonas axonopodis pv. citri str. 306]
          Length = 720

 Score =  119 bits (298), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 62/153 (40%), Positives = 89/153 (58%), Gaps = 1/153 (0%)

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
           DYL  L  S+ +  G A+   +  LL  L  + GV P  ++A+WG+E+ +G   GK PLL
Sbjct: 75  DYLASLVDSQRVTDGQAMLVTHRELLSRLSDQTGVDPATIVAVWGVESDYGRVTGKRPLL 134

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAI 211
            +LATL+   RR  FF  +F   L L+++G +S+  L G+  G  GQ QF+P    + A+
Sbjct: 135 VSLATLSCAGRRQPFFRGEFLALLSLLQQGDLSADGLTGSWAGAFGQTQFMPSTYARIAV 194

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGWTKC 244
           D D DG+ DLV S  DA+AS A +L K GW + 
Sbjct: 195 DGDGDGRRDLVTSIPDALASTANYLVKAGWERA 227


>gi|330811919|ref|YP_004356381.1| lipoprotein [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
 gi|327380027|gb|AEA71377.1| putative lipoprotein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 427

 Score =  119 bits (298), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 72/227 (31%), Positives = 121/227 (53%), Gaps = 6/227 (2%)

Query: 20  AQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIAR 79
           A A+  P   T + +       F +W++  R  A+  G+        F  +    + I  
Sbjct: 33  APAIVPPLVPTGEDLAIAPTQTFAQWQAGFRKEALAAGIRGDLFDRAFIGVSPDMSVIKA 92

Query: 80  DRKM--VTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWG 137
           DR     T P     +YLDG  S   + +G +L + N+++L ++++ YGV    L+A+WG
Sbjct: 93  DRSQPEFTRP---VWEYLDGALSPLRVNKGKSLIQQNAQILQSIEQRYGVDREALVAVWG 149

Query: 138 LETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHA-LGATFGEI 196
           +E++FG+  G   ++++LATLAY+ RR  F   Q   AL ++++G I+    LG+  G +
Sbjct: 150 MESNFGQFQGSKSVINSLATLAYEGRRPGFAHAQLIAALQILQQGDITPEKMLGSWAGAM 209

Query: 197 GQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTK 243
           GQ QF+P     +A+D D DG+ D+  S+ DA+AS A +L   GW +
Sbjct: 210 GQTQFIPTTYNTHAVDFDGDGRRDIWGSSTDALASTAHYLQSSGWQR 256


>gi|84621918|ref|YP_449290.1| transglycolase [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|122879006|ref|YP_198927.6| transglycolase; epimerase [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|188579109|ref|YP_001916038.1| transglycolase [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|84365858|dbj|BAE67016.1| transglycolase [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|188523561|gb|ACD61506.1| transglycolase [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 720

 Score =  119 bits (298), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 60/153 (39%), Positives = 91/153 (59%), Gaps = 1/153 (0%)

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
           DYL  L  ++ +  G A+   +  LL  L ++ GV P  ++A+WG+E+ +G   GK PLL
Sbjct: 75  DYLASLVDNQRVTDGQAMLVTHRALLTRLSEQTGVDPATIVAVWGVESDYGRVTGKRPLL 134

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAI 211
            +LATL+   RR  FF ++F   L L+++G +++  L G+  G  GQ QF+P    + A+
Sbjct: 135 VSLATLSCAGRRQPFFRDEFLALLSLLQRGDLAADGLTGSWAGAFGQTQFMPSTYTRIAV 194

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGWTKC 244
           D D DG+ DLV S  DA+AS A +L K GW + 
Sbjct: 195 DGDGDGRRDLVASIPDALASTANYLVKAGWERA 227


>gi|330969444|gb|EGH69510.1| hypothetical protein PSYAR_02994 [Pseudomonas syringae pv. aceris
           str. M302273PT]
          Length = 445

 Score =  119 bits (298), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 70/204 (34%), Positives = 113/204 (55%), Gaps = 4/204 (1%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVT-SPPVSFKDYLDGLSS 100
           F EW++  RA+A++ G+        FA +    + +  DR     S PV   +YLDG  S
Sbjct: 70  FSEWQAGFRAQALKAGIRADVFDLAFAGVTPDMSVVKADRSQPEFSRPV--WEYLDGAIS 127

Query: 101 SEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAY 160
           +  + +G AL    +  L  ++++YGV    L+A+WG+E++FG   G   ++ +LATLAY
Sbjct: 128 AARVRKGQALLSQYADDLQKIEQQYGVDRQTLVAVWGMESNFGSLQGTQSVIRSLATLAY 187

Query: 161 DCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKI 219
           + RR  F   Q   AL++++ G I+    LG+  G +GQ QF+P     +A+D D DG+ 
Sbjct: 188 EGRRPGFAQSQLLAALEIIQHGDITPDKMLGSWAGAMGQTQFIPTTYNTHAVDFDGDGRR 247

Query: 220 DLVKSNIDAIASAAKFLAKLGWTK 243
           D+  +  DA+AS A +L   GW +
Sbjct: 248 DIWNTPADALASTAHYLQSSGWQR 271


>gi|56551983|ref|YP_162822.1| lytic murein transglycosylase [Zymomonas mobilis subsp. mobilis
           ZM4]
 gi|241761934|ref|ZP_04760019.1| lytic murein transglycosylase [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
 gi|56543557|gb|AAV89711.1| lytic murein transglycosylase [Zymomonas mobilis subsp. mobilis
           ZM4]
 gi|241373614|gb|EER63186.1| lytic murein transglycosylase [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
          Length = 361

 Score =  119 bits (298), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 83/260 (31%), Positives = 134/260 (51%), Gaps = 19/260 (7%)

Query: 3   FKKYLLISLLM---MVYPMLAQAVTQ---P-KKATTQFICSDTADR-FGEWKSAARARAV 54
            + Y LI+ +    M +P L+Q+ +    P ++ T   + +  A+R F  + ++ R +A+
Sbjct: 1   MRLYPLITAIFLSGMTFPALSQSSSDMPVPMQEKTAADLNNQEANRDFRNFLASIRPQAL 60

Query: 55  REGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVS-----FKDYLDGLSSSEIIAQGIA 109
             G++P+T   + +DL      I  DR    SP  +     F  Y      +  IA G  
Sbjct: 61  ASGVNPQTFDRIASDLTPNPRVIQLDRNQPESPTANAVIPPFAPYAASHVDAVRIANGRK 120

Query: 110 LKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFT 169
             +A    L  ++KE GVP GI+++++G E+ +G+  G   LL +LATLAYD RR   F 
Sbjct: 121 KYQALQNNLAEIEKETGVPAGIMLSIYGHESGYGQFSGNFDLLRSLATLAYDGRRRDLFV 180

Query: 170 EQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAI 229
           +++  AL ++  G+  S   G+  G  G  QFLP   ++ A+D D DGK ++  S IDA+
Sbjct: 181 QEYIAALKILDSGIDRSLLKGSWAGATGSPQFLPSVYLRVAVDGDHDGKKNIWSSEIDAL 240

Query: 230 ASAAKFLAKLGWTKCAGYQP 249
           AS   +L      K AG+QP
Sbjct: 241 ASIGNYL------KTAGWQP 254


>gi|254504789|ref|ZP_05116940.1| lytic murein transglycosylase subfamily [Labrenzia alexandrii
           DFL-11]
 gi|222440860|gb|EEE47539.1| lytic murein transglycosylase subfamily [Labrenzia alexandrii
           DFL-11]
          Length = 398

 Score =  119 bits (298), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 78/251 (31%), Positives = 118/251 (47%), Gaps = 23/251 (9%)

Query: 2   SFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPK 61
           +F    L  L +M  P +AQ                    F  + +  +  AV +G+S  
Sbjct: 10  TFTVAALTGLALMTAPAVAQ---------------QCGGDFQTFLAGVKQEAVAKGLSAS 54

Query: 62  TAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINL 121
            A    +  +     ++RDR       ++F D+   + SS  +  G A     + +   +
Sbjct: 55  AADQTLSGAQIDRKVLSRDRAQGVFK-MTFLDFSKRVISSYRMKNGAANMVKYASVFDRV 113

Query: 122 KKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKK 181
           + EYGVP  ++ A W LET FG   G    ++ LATLA+DCRR + F  Q   A+++V+ 
Sbjct: 114 ESEYGVPAPVITAFWALETDFGAVQGDFNTVNALATLAHDCRRPELFRPQLIAAIEMVQH 173

Query: 182 GVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLG 240
           G +   +  GA  GEIG  Q LP +++K+  DAD DG + L  S  DAI +A  F+  LG
Sbjct: 174 GDLDPQNTTGAWAGEIGMVQMLPEDIIKFGKDADGDGHVRLKASAPDAILTAGAFIGHLG 233

Query: 241 WTKCAGYQPGE 251
           W      QPGE
Sbjct: 234 W------QPGE 238


>gi|299772105|ref|YP_003734131.1| lytic murein transglycosylase family protein [Acinetobacter sp.
           DR1]
 gi|298702193|gb|ADI92758.1| lytic murein transglycosylase family protein [Acinetobacter sp.
           DR1]
          Length = 430

 Score =  119 bits (297), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 73/200 (36%), Positives = 109/200 (54%), Gaps = 16/200 (8%)

Query: 50  RARAVREGMSPKT----AKHLFADLEYLDTTIARDRKMVTSPPVSFK--DYLDGLSSSEI 103
           R++A+  G+S  T     ++L  D   +D       K+   P  S    DYL GL   E 
Sbjct: 57  RSQAIAAGVSGATYDRYTQNLTPDYSVID-------KLNYQPEFSTPIWDYLSGLVDEER 109

Query: 104 IAQGIALKKANSRLLINLKKE-YGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDC 162
           +  G   K A  R ++N   + YGVPP  ++A+WG+E++FG+  GK PLL  L TL+ + 
Sbjct: 110 VELG-KQKLAQHRDVLNRASQTYGVPPETIVAVWGVESNFGDISGKYPLLQALGTLSCEG 168

Query: 163 RRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDL 221
           RR  +F  +FF  + ++++G ++   L G+  G  G  QF+P    + A+D D DG+ DL
Sbjct: 169 RRQSYFRTEFFATMRILQRGDLTEDQLKGSWAGAFGHTQFMPSTYERLAVDFDGDGRRDL 228

Query: 222 VKSNIDAIASAAKFLAKLGW 241
           V S  DA+AS A FL K GW
Sbjct: 229 VSSTADALASTANFLNKAGW 248


>gi|293611414|ref|ZP_06693710.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292826286|gb|EFF84655.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 430

 Score =  119 bits (297), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 73/200 (36%), Positives = 109/200 (54%), Gaps = 16/200 (8%)

Query: 50  RARAVREGMSPKT----AKHLFADLEYLDTTIARDRKMVTSPPVSFK--DYLDGLSSSEI 103
           R++A+  G+S  T     ++L  D   +D       K+   P  S    DYL GL   E 
Sbjct: 57  RSQAISAGVSGTTYDRYTQNLTPDYSVID-------KLNYQPEFSTPIWDYLSGLVDEER 109

Query: 104 IAQGIALKKANSRLLINLKKE-YGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDC 162
           +  G   K A  R ++N   + YGVPP  ++A+WG+E++FG+  GK PLL  L TL+ + 
Sbjct: 110 VELG-KQKLAQHRDVLNRASQTYGVPPETIVAVWGVESNFGDISGKYPLLQALGTLSCEG 168

Query: 163 RRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDL 221
           RR  +F  +FF  + ++++G ++   L G+  G  G  QF+P    + A+D D DG+ DL
Sbjct: 169 RRQSYFRTEFFATVRILQRGDLTEDQLKGSWAGAFGHTQFMPSTYERLAVDFDGDGRRDL 228

Query: 222 VKSNIDAIASAAKFLAKLGW 241
           V S  DA+AS A FL K GW
Sbjct: 229 VSSTADALASTANFLNKAGW 248


>gi|255264254|ref|ZP_05343596.1| lytic murein transglycosylase [Thalassiobium sp. R2A62]
 gi|255106589|gb|EET49263.1| lytic murein transglycosylase [Thalassiobium sp. R2A62]
          Length = 387

 Score =  119 bits (297), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 74/206 (35%), Positives = 104/206 (50%), Gaps = 12/206 (5%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           FG + +  +A A ++G    T    F+   +  + I  DR    S  V  KD+L    S 
Sbjct: 24  FGNFVAGLKAEATQKGHPKSTVDRFFSSARFEQSVINADR----SQGVFQKDFL--AFSQ 77

Query: 102 EIIAQGIALKKANSRLLIN-----LKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLA 156
            +I+QG     A +    N     ++ EYGVP G+L+A W LET +G   G    L+ L 
Sbjct: 78  AVISQGRLNNGARNSDRFNNTFRRIEAEYGVPRGVLLAFWALETDYGAVQGNFNTLNALV 137

Query: 157 TLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADE 215
           TLA+DCRR + F  Q F AL+L + G    +   GA  GEIG  Q LP +++    D D 
Sbjct: 138 TLAHDCRRPELFRPQIFAALELFENGDFDPARTTGAWAGEIGMVQMLPEDLLTNGRDGDG 197

Query: 216 DGKIDLVKSNIDAIASAAKFLAKLGW 241
           DG++ +  S  DA+ SAA  L  LGW
Sbjct: 198 DGQVSIKTSAPDALTSAASMLRDLGW 223


>gi|188582710|ref|YP_001926155.1| lytic murein transglycosylase [Methylobacterium populi BJ001]
 gi|179346208|gb|ACB81620.1| lytic murein transglycosylase [Methylobacterium populi BJ001]
          Length = 400

 Score =  119 bits (297), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 76/195 (38%), Positives = 109/195 (55%), Gaps = 5/195 (2%)

Query: 50  RARAVREGMSPKTAKHLFADLEYLDT-TIARDRKMVT-SPPVSFKDYLDGLSSSEIIAQG 107
           R+ A+  G+SP T    FA L   D   IAR R+    S PV   DYL G  S   IA+G
Sbjct: 38  RSDAIARGVSPNTFDAAFAGLRGPDPDVIARTRRQGEFSRPVW--DYLVGAVSPGRIARG 95

Query: 108 IALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKF 167
            A  K  +  L  ++ + GVP  I++A WG+E+ FG + G  P +  LA+LAY   R   
Sbjct: 96  QAQGKRLAATLAAIEAKTGVPRAIVLAFWGVESDFGASAGSLPTVRALASLAYVRHRGTL 155

Query: 168 FTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNI 226
           F ++   AL +++KG I  +  +G+  G +GQ QFLP   ++ A+D D DG+ D+ +S  
Sbjct: 156 FRDELLAALQILEKGDIEPARMVGSWAGAMGQVQFLPSVYLREAVDFDGDGRRDIWRSEP 215

Query: 227 DAIASAAKFLAKLGW 241
           DA+AS A +L  LGW
Sbjct: 216 DALASIAHYLRSLGW 230


>gi|260553796|ref|ZP_05826066.1| transglycolase [Acinetobacter sp. RUH2624]
 gi|260405100|gb|EEW98600.1| transglycolase [Acinetobacter sp. RUH2624]
          Length = 432

 Score =  119 bits (297), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 73/200 (36%), Positives = 109/200 (54%), Gaps = 16/200 (8%)

Query: 50  RARAVREGMSPKT----AKHLFADLEYLDTTIARDRKMVTSPPVSFK--DYLDGLSSSEI 103
           R++A+  G+S  T     ++L  D   +D       K+   P  S    DYL GL   E 
Sbjct: 59  RSQAIAAGVSGSTYDRYTQNLTPDYSVID-------KLNYQPEFSTPIWDYLSGLVDEER 111

Query: 104 IAQGIALKKANSRLLINLKKE-YGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDC 162
           +  G   K A  R ++N   + YGVPP  ++A+WG+E++FG+  GK PLL  L TL+ + 
Sbjct: 112 VELG-KQKLAQYRDVLNRASQVYGVPPETIVAVWGVESNFGDISGKYPLLQALGTLSCEG 170

Query: 163 RRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDL 221
           RR  +F  +FF  + ++++G ++   L G+  G  G  QF+P    + A+D D DG+ DL
Sbjct: 171 RRQSYFRTEFFATMRILQRGDLTEDQLKGSWAGAFGHTQFMPSTYERLAVDFDGDGRRDL 230

Query: 222 VKSNIDAIASAAKFLAKLGW 241
           V S  DA+AS A FL K GW
Sbjct: 231 VSSTADALASTANFLNKAGW 250


>gi|71278899|ref|YP_268059.1| putative peptidoglycan-binding protein [Colwellia psychrerythraea
           34H]
 gi|71144639|gb|AAZ25112.1| putative peptidoglycan-binding protein [Colwellia psychrerythraea
           34H]
          Length = 427

 Score =  119 bits (297), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 80/253 (31%), Positives = 129/253 (50%), Gaps = 24/253 (9%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSP 60
           + F+K +++  L   +P+LA A                 + F + K     RA   G S 
Sbjct: 15  VHFRKLIMLCAL---FPLLANATI-------------ADEDFLQCKVNLAKRAETAGFSS 58

Query: 61  KTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLIN 120
              + +  ++  +   IA D+K       +F+ Y+    +   +  G    K N +L   
Sbjct: 59  YITQTVIDNISPIKRVIALDKKQPEFTQ-TFEQYIKARVTDYHVRVGKEKLKKNKKLFDA 117

Query: 121 LKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVK 180
           L+K+YGVP   L++ WGLET FG+  GK  +L++LATLA D RR++FFT +      L++
Sbjct: 118 LEKKYGVPRQYLVSFWGLETVFGKHKGKMSVLNSLATLACDERRSEFFTLELLNLFTLIE 177

Query: 181 KGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKL 239
              ++   L G+  G +G  QF+P   +KYA+D D DGK+D+ KS +DA+ +AA +L K+
Sbjct: 178 TKQVAVEQLQGSWAGAMGHMQFMPTAFLKYAVDGDNDGKVDIWKSEVDALTTAANYLNKI 237

Query: 240 GWTKCAGYQPGEK 252
            W      QP E+
Sbjct: 238 SW------QPKER 244


>gi|149915539|ref|ZP_01904065.1| hypothetical protein RAZWK3B_06277 [Roseobacter sp. AzwK-3b]
 gi|149810431|gb|EDM70274.1| hypothetical protein RAZWK3B_06277 [Roseobacter sp. AzwK-3b]
          Length = 389

 Score =  119 bits (297), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 65/201 (32%), Positives = 104/201 (51%), Gaps = 2/201 (0%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F  +  A +  AV  G +P T +  FA +      +  DR+      + F D+   L S 
Sbjct: 26  FAGFVGAMKQEAVARGHAPATVERFFAGVRQDPAVLQADRRQGVFQ-MPFTDFARRLISQ 84

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             + +G  L + +  +   ++++YG+  G+L+A W  ET +G   G    ++ L TLA+D
Sbjct: 85  NRMTKGRDLAQRHDAIFDRIERDYGIDRGVLLAFWAFETDYGAFQGDYNTVNALVTLAHD 144

Query: 162 CRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
           CRR + F  Q F AL+L + G +  +   GA  GEIG  Q LP +++++  D D DG + 
Sbjct: 145 CRRPELFRPQVFAALELFENGDLDPATTTGAWAGEIGMVQMLPRDIIEHGSDGDGDGHVS 204

Query: 221 LVKSNIDAIASAAKFLAKLGW 241
           L  S  DA+ S A+ L+ LGW
Sbjct: 205 LTSSPEDALLSGARMLSALGW 225


>gi|146279960|ref|YP_001170118.1| hypothetical protein Rsph17025_3959 [Rhodobacter sphaeroides ATCC
           17025]
 gi|145558201|gb|ABP72813.1| hypothetical protein Rsph17025_3959 [Rhodobacter sphaeroides ATCC
           17025]
          Length = 411

 Score =  118 bits (296), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 78/218 (35%), Positives = 118/218 (54%), Gaps = 13/218 (5%)

Query: 45  WKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEII 104
           W +  R RA+  G++P T    F    +L   I RDR   T    + +DYL   +S E I
Sbjct: 45  WVAGFRPRALGAGIAPDTFDRAFRGAGFLPQVIERDRNQ-TEFTRTTEDYLAIAASDERI 103

Query: 105 AQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRR 164
           A G A    ++ +L  ++  YGV   ++ A+WGLE+ +GE  G  P++S L+TLA+D RR
Sbjct: 104 ALGRAALARHAAVLSRIEARYGVEAEVVTAVWGLESRYGERRGDVPVISALSTLAFDGRR 163

Query: 165 AKFFTEQFFYALDLVKKG-VISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVK 223
             FF  Q   AL +V+ G    +H  G+  G +G  QF+P + + YA+D D DG+ D+  
Sbjct: 164 GAFFESQLIAALKIVQAGDTDPAHLTGSWAGAMGHTQFIPTSYLAYAVDFDGDGRRDIWS 223

Query: 224 SN-IDAIASAAKFLAKLGWTKC----------AGYQPG 250
            +  DA+ASAA +L++ GW +           AG+ PG
Sbjct: 224 DDPTDALASAAAYLSRSGWQRGQPWGVEVQLPAGFNPG 261


>gi|302185154|ref|ZP_07261827.1| lytic murein transglycosylase [Pseudomonas syringae pv. syringae
           642]
          Length = 445

 Score =  118 bits (296), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 70/204 (34%), Positives = 113/204 (55%), Gaps = 4/204 (1%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVT-SPPVSFKDYLDGLSS 100
           F EW++  RA+A++ G+        FA +    + +  DR     S PV   +YLDG  S
Sbjct: 70  FSEWQAGFRAQALKAGIRADVFDLAFAGVTPDMSVVKADRSQPEFSRPV--WEYLDGAIS 127

Query: 101 SEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAY 160
           +  + +G AL    +  L  ++++YGV    L+A+WG+E++FG   G   ++ +LATLAY
Sbjct: 128 AARVRKGQALLSQYADDLQKIEQQYGVDRQALVAVWGMESNFGSFQGTQSVIRSLATLAY 187

Query: 161 DCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKI 219
           + RR  F   Q   AL++++ G I+    LG+  G +GQ QF+P     +A+D D DG+ 
Sbjct: 188 EGRRPGFAQSQLLAALEIIQHGDITPDKMLGSWAGAMGQTQFIPTTYNTHAVDFDGDGRR 247

Query: 220 DLVKSNIDAIASAAKFLAKLGWTK 243
           D+  +  DA+AS A +L   GW +
Sbjct: 248 DIWNTPADALASTAHYLQSSGWQR 271


>gi|77461182|ref|YP_350689.1| lytic murein transglycosylase [Pseudomonas fluorescens Pf0-1]
 gi|77385185|gb|ABA76698.1| putative lipoprotein [Pseudomonas fluorescens Pf0-1]
          Length = 440

 Score =  118 bits (296), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 69/204 (33%), Positives = 114/204 (55%), Gaps = 4/204 (1%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVT-SPPVSFKDYLDGLSS 100
           F EW++  R  A+  G+        FA++ +  + I  DR     + PV   +YLDG  S
Sbjct: 68  FAEWQAGFRKEALAAGIRADLFDRAFANVSFDASVIRADRSQPEFARPV--WEYLDGALS 125

Query: 101 SEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAY 160
              + +G AL    + +L ++++ YGV    L+++WG+E++FG+  G   ++++LATLAY
Sbjct: 126 PLRVRKGQALISQYADILQSIEQRYGVDRQALVSVWGMESNFGQFQGSKSVINSLATLAY 185

Query: 161 DCRRAKFFTEQFFYALDLVKKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKI 219
           + RR  F   Q   AL ++++G I+    LG+  G +GQ QF+P     +A+D D DG+ 
Sbjct: 186 EGRRPGFAHAQLIAALQILQQGDITPEKMLGSWAGAMGQTQFIPTTYNTHAVDFDGDGRR 245

Query: 220 DLVKSNIDAIASAAKFLAKLGWTK 243
           D+  S  DA+AS A +L   GW +
Sbjct: 246 DIWGSPADALASTAHYLQSSGWQR 269


>gi|330938270|gb|EGH41933.1| hypothetical protein PSYPI_05703 [Pseudomonas syringae pv. pisi
           str. 1704B]
          Length = 337

 Score =  118 bits (296), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 70/204 (34%), Positives = 113/204 (55%), Gaps = 4/204 (1%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVT-SPPVSFKDYLDGLSS 100
           F EW++  RA+A++ G+        FA +    + +  DR     S PV   +YLDG  S
Sbjct: 70  FSEWQAGFRAQALKAGIRADVFDLAFAGVTPDMSVVKADRSQPEFSRPV--WEYLDGAIS 127

Query: 101 SEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAY 160
           +  + +G AL    +  L  ++++YGV    L+A+WG+E++FG   G   ++ +LATLAY
Sbjct: 128 AARVRKGQALLSQYADDLQKIEQQYGVDRQALVAVWGMESNFGSFQGTQSVIRSLATLAY 187

Query: 161 DCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKI 219
           + RR  F   Q   AL++++ G I+    LG+  G +GQ QF+P     +A+D D DG+ 
Sbjct: 188 EGRRPGFAQSQLLAALEIIQHGDITPDKMLGSWAGAMGQTQFIPTTYNTHAVDFDGDGRR 247

Query: 220 DLVKSNIDAIASAAKFLAKLGWTK 243
           D+  +  DA+AS A +L   GW +
Sbjct: 248 DIWNTPADALASTAHYLQSSGWQR 271


>gi|330895578|gb|EGH27886.1| hypothetical protein PSYJA_02194 [Pseudomonas syringae pv. japonica
           str. M301072PT]
          Length = 445

 Score =  118 bits (296), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 70/204 (34%), Positives = 113/204 (55%), Gaps = 4/204 (1%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVT-SPPVSFKDYLDGLSS 100
           F EW++  RA+A++ G+        FA +    + +  DR     S PV   +YLDG  S
Sbjct: 70  FSEWQAGFRAQALKAGIRADVFDLAFAGVTPDMSVVKADRSQPEFSRPV--WEYLDGAIS 127

Query: 101 SEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAY 160
           +  + +G AL    +  L  ++++YGV    L+A+WG+E++FG   G   ++ +LATLAY
Sbjct: 128 AARVRKGQALLSQYADDLQKIEQQYGVDRQALVAVWGMESNFGSFQGTQSVIRSLATLAY 187

Query: 161 DCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKI 219
           + RR  F   Q   AL++++ G I+    LG+  G +GQ QF+P     +A+D D DG+ 
Sbjct: 188 EGRRPGFAQSQLLAALEIIQHGDITPDKMLGSWAGAMGQTQFIPTTYNTHAVDFDGDGRR 247

Query: 220 DLVKSNIDAIASAAKFLAKLGWTK 243
           D+  +  DA+AS A +L   GW +
Sbjct: 248 DIWNTPADALASTAHYLQSSGWQR 271


>gi|294678909|ref|YP_003579524.1| lytic murein transglycosylase [Rhodobacter capsulatus SB 1003]
 gi|294477729|gb|ADE87117.1| lytic murein transglycosylase [Rhodobacter capsulatus SB 1003]
          Length = 388

 Score =  118 bits (296), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 70/217 (32%), Positives = 107/217 (49%), Gaps = 8/217 (3%)

Query: 36  SDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYL 95
           ++    F  + +  +A   R G+S  TA   FA +      +  DR        SF D+ 
Sbjct: 20  AECGGNFSGFVAGLKAEMQRNGLSAATADSFFAGVRQDGRVLKADRAQGVFRK-SFLDFQ 78

Query: 96  DGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTL 155
             + S   +  G A+ +  + +    +++YGV  G+L+A W LET FG+  G       L
Sbjct: 79  ASVISKNRLQTGAAMAQKYASVFDAAERQYGVSRGVLLAFWALETDFGKVQGDFNTRDAL 138

Query: 156 ATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDAD 214
            TLA+DCRR   F  Q   A +L  +G       +GA  GEIGQ Q LP ++++  +D D
Sbjct: 139 VTLAHDCRRPDLFRPQVLAAAELYARGDFDPQRTIGAWAGEIGQVQMLPADILRNGVDGD 198

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGE 251
            DG ++L  S+ DA+ S AK +A +GW      +PGE
Sbjct: 199 GDGHVNLKGSSADALMSGAKMIASMGW------RPGE 229


>gi|84502809|ref|ZP_01000922.1| Membrane bound lytic murein transglycosylase B [Oceanicola
           batsensis HTCC2597]
 gi|84388792|gb|EAQ01662.1| Membrane bound lytic murein transglycosylase B [Oceanicola
           batsensis HTCC2597]
          Length = 467

 Score =  118 bits (296), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 69/204 (33%), Positives = 108/204 (52%), Gaps = 3/204 (1%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F  W  A R+RA+ +G+   T    FA + YL   I  DRK       +  +YL    S 
Sbjct: 99  FTAWIGAFRSRALAQGIDAATFDRTFARVRYLPDVIRLDRKQSEFTKTT-GEYLASAVSD 157

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             +  G    +A    L  ++  YGV   ++ A+WG+ET++G   G+T + S LATLAYD
Sbjct: 158 TRVETGREKAQAQGATLRAIEARYGVDRNVVAAVWGMETNYGGYRGRTHIPSALATLAYD 217

Query: 162 CRRAKFFTEQFFYALDLVKKG-VISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR  FF +Q   AL +++ G     + +G+  G +G  QF+P +   YA+D   DG+ D
Sbjct: 218 GRRGAFFEKQLIAALRILQNGDTTPENMVGSWAGAMGHTQFMPTSYAAYAVDFTGDGRRD 277

Query: 221 LVKSN-IDAIASAAKFLAKLGWTK 243
           +   +  DA+AS A +L+++GW +
Sbjct: 278 IWAGDPTDALASTAAYLSRMGWQR 301


>gi|192293240|ref|YP_001993845.1| lytic murein transglycosylase [Rhodopseudomonas palustris TIE-1]
 gi|192286989|gb|ACF03370.1| lytic murein transglycosylase [Rhodopseudomonas palustris TIE-1]
          Length = 442

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 77/237 (32%), Positives = 117/237 (49%), Gaps = 4/237 (1%)

Query: 10  SLLMMVYPMLAQAVTQPKKATTQFICS-DTADRFGEWKSAARARAVREGMSPKTAKHLFA 68
           S L ++ P LA A+     A  Q   S      F ++ +  + +AV  G+S         
Sbjct: 8   SKLPLIAPFLALALVAVSPALAQRGASCHGGQSFPQFLAGLKQKAVAAGVSQGAIAEASP 67

Query: 69  DLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVP 128
            L Y    + RDR       + F  +   ++S     +G  L K  ++     +KEYGVP
Sbjct: 68  YLVYDQGIVNRDRGQRVFGQI-FTVFAGRMASEGRRVKGQQLIKQYAQAFARAEKEYGVP 126

Query: 129 PGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKG-VISSH 187
           P ++ A W LE+ FG   G  P L +L +LAYDCRR++ F ++   AL ++ +G +    
Sbjct: 127 PAVIAAFWALESDFGAVQGNLPTLRSLVSLAYDCRRSEMFQDETIAALKIIDRGDLTPGE 186

Query: 188 ALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAK-LGWTK 243
            +G+  GE+GQ QFLP +   YA+D D DG  DL+ S  D I S A ++A  L W +
Sbjct: 187 MIGSWAGELGQTQFLPRHYFDYAVDYDGDGHRDLLHSAPDVIGSTANYIATGLKWRR 243


>gi|95930147|ref|ZP_01312886.1| Lytic murein transglycosylase [Desulfuromonas acetoxidans DSM 684]
 gi|95133841|gb|EAT15501.1| Lytic murein transglycosylase [Desulfuromonas acetoxidans DSM 684]
          Length = 340

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 63/204 (30%), Positives = 106/204 (51%), Gaps = 1/204 (0%)

Query: 39  ADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGL 98
           +++F EW +  R  A+  G+S  T  +  + +      +    +       + + Y+ G 
Sbjct: 39  SNQFTEWLAVLRQDAIAAGISATTVDNALSGIRQPKKKVIHHDRNQPEKKATLQRYMAGK 98

Query: 99  SSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATL 158
            +   I  G  + +     L  +++ YGVP   L+ALWG+ETH+G   G   ++  LATL
Sbjct: 99  INGTRIEHGRTMLERYPTWLTRVEQRYGVPRRYLIALWGIETHYGAYSGNFSVIQALATL 158

Query: 159 AYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDG 217
           AYD RR  +F ++   AL ++ +G +S +   G+  G +GQ QF+P +   YAID ++DG
Sbjct: 159 AYDSRRGDYFRKELLKALQILDEGHVSLARMKGSWAGAMGQCQFMPSSFYHYAIDGNKDG 218

Query: 218 KIDLVKSNIDAIASAAKFLAKLGW 241
           +ID+  +  D  AS A +L K  W
Sbjct: 219 RIDIWATIPDIFASMANYLEKAHW 242


>gi|330976837|gb|EGH76869.1| hypothetical protein PSYAP_09300 [Pseudomonas syringae pv. aptata
           str. DSM 50252]
          Length = 445

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 70/204 (34%), Positives = 113/204 (55%), Gaps = 4/204 (1%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVT-SPPVSFKDYLDGLSS 100
           F EW++  RA+A++ G+        FA +    + +  DR     S PV   +YLDG  S
Sbjct: 70  FSEWQAGFRAQALKAGIRADVFDLAFAGVTPDMSVVKADRSQPEFSRPV--WEYLDGAIS 127

Query: 101 SEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAY 160
           +  + +G AL    +  L  ++++YGV    L+A+WG+E++FG   G   ++ +LATLAY
Sbjct: 128 AARVRKGQALLSQYADDLQKIEQQYGVDRQALVAVWGMESNFGSFQGTQSVIRSLATLAY 187

Query: 161 DCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKI 219
           + RR  F   Q   AL++++ G I+    LG+  G +GQ QF+P     +A+D D DG+ 
Sbjct: 188 EGRRPGFAQSQLLAALEIIQHGDITPDKMLGSWAGAMGQTQFIPTTYNTHAVDFDGDGRR 247

Query: 220 DLVKSNIDAIASAAKFLAKLGWTK 243
           D+  +  DA+AS A +L   GW +
Sbjct: 248 DIWNTPADALASPAHYLQSSGWQR 271


>gi|188584460|ref|YP_001927905.1| lytic murein transglycosylase [Methylobacterium populi BJ001]
 gi|179347958|gb|ACB83370.1| lytic murein transglycosylase [Methylobacterium populi BJ001]
          Length = 398

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 84/256 (32%), Positives = 131/256 (51%), Gaps = 34/256 (13%)

Query: 50  RARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFK----DYLDGLSSSEIIA 105
           +A+A   G+S +T +   A++ Y D  I    ++  + P  FK    DY+  L   E + 
Sbjct: 36  QAQAASAGVSAQTFRAATANIAYDDKVI----ELSQAQP-EFKTPIWDYMSALVDDERVE 90

Query: 106 QGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDC-RR 164
            G A  + +++ L N +  YGV    + A+WG+E++FG+ +GK PL+ +LATLA    RR
Sbjct: 91  DGRAAMRQHAQALANAEARYGVDRYTIAAVWGVESNFGKNLGKMPLVQSLATLACSGHRR 150

Query: 165 AKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVK 223
            +FF  +    L ++++G I +  L G+  G  GQ QF+P    + A+D D DG+ D+V 
Sbjct: 151 REFFRTELIATLKIIERGDIEASRLTGSWAGAFGQTQFMPTTYQRLAVDGDGDGRRDVVD 210

Query: 224 SNIDAIASAAKFLAKLGWTKCA--GYQ-----------PGEKNFAILKHWNASLNYNKTI 270
           S  DA+AS A FL    W+     GY+            G KN   + HW ASL   +  
Sbjct: 211 SVADAVASTANFLRVAKWSNGHPWGYEVRLPRGFNAGAAGRKNKHAVGHW-ASLGVTR-- 267

Query: 271 AYIAAHIDGVPI-GKG 285
                 +DG P+ G+G
Sbjct: 268 ------VDGKPLTGEG 277


>gi|169634920|ref|YP_001708656.1| putative membrane-bound lytic murein transglycosylase
           [Acinetobacter baumannii SDF]
 gi|169153712|emb|CAP02911.1| putative membrane-bound lytic murein transglycosylase
           [Acinetobacter baumannii]
          Length = 430

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 80/235 (34%), Positives = 120/235 (51%), Gaps = 19/235 (8%)

Query: 18  MLAQAVTQPKKATTQFICSDT---ADRFGEWKSAARARAVREGMSPKT----AKHLFADL 70
           ++    T    AT     SDT    + F    +  R++A+  G+S  T     ++L  D 
Sbjct: 22  LVINGSTISSNATVPVTNSDTYTPNNNFQSCLANLRSQAIAAGVSGSTYDRYTQNLTPDY 81

Query: 71  EYLDTTIARDRKMVTSPPVSFK--DYLDGLSSSEIIAQGIALKKANSRLLINLKKE-YGV 127
             +D       K+   P  S    DYL GL   E +A G   K A  R ++N   + YGV
Sbjct: 82  SVID-------KLNYQPEFSTPIWDYLSGLVDEERVALG-KQKLAQHRDVLNRASQVYGV 133

Query: 128 PPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSH 187
           P   ++A+WG+E++FG+  GK PLL  L TL+ + RR  +F  +FF  + ++++G ++  
Sbjct: 134 PAETIVAVWGVESNFGDISGKYPLLQALGTLSCEGRRQSYFRTEFFATMRILRRGDLTED 193

Query: 188 AL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
            L G+  G  G  QF+P    + A+D D DG+ DLV S  DA+AS A FL K GW
Sbjct: 194 QLKGSWAGAFGHTQFMPSTYERLAVDFDGDGRRDLVSSTADALASTANFLNKAGW 248


>gi|28871932|ref|NP_794551.1| HopAJ2 protein [Pseudomonas syringae pv. tomato str. DC3000]
 gi|28855185|gb|AAO58246.1| HopAJ2 protein [Pseudomonas syringae pv. tomato str. DC3000]
 gi|331014747|gb|EGH94803.1| HopAJ2 protein [Pseudomonas syringae pv. lachrymans str. M302278PT]
          Length = 445

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 74/221 (33%), Positives = 118/221 (53%), Gaps = 9/221 (4%)

Query: 30  TTQFICSDT-----ADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMV 84
           T   +  DT     A  F EW++  RA+A++ G+        FA +    + +  DR   
Sbjct: 53  TPALVVDDTLTIQPAVSFSEWQAGFRAQALKAGIRADVFDLAFAGVTPDMSVVKADRSQP 112

Query: 85  T-SPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFG 143
             S PV   +YLDG  S+  + +G AL    +  L  ++++YGV    L+A+WG+E++FG
Sbjct: 113 EFSRPV--WEYLDGAISAVRVRKGQALLSQYADDLQKIEQQYGVDRQALVAVWGMESNFG 170

Query: 144 ETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFL 202
              G   ++ +LATLAY+ RR  F   Q   AL++++ G I+    LG+  G +GQ QF+
Sbjct: 171 SFQGSQSVIRSLATLAYEGRRPGFAQSQLLAALEIIQHGDITPDKMLGSWAGAMGQTQFI 230

Query: 203 PVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTK 243
           P     +A+D D DG+ D+  +  DA+AS A +L   GW +
Sbjct: 231 PTTYNTHAVDFDGDGRRDIWNTPADALASTAHYLQSSGWQR 271


>gi|294625605|ref|ZP_06704229.1| type III secretion system hopAJ-like protein [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 11122]
 gi|292600080|gb|EFF44193.1| type III secretion system hopAJ-like protein [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 11122]
          Length = 709

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 62/153 (40%), Positives = 89/153 (58%), Gaps = 1/153 (0%)

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
           DYL  L  S+ +  G A+   +  LL  L  + GV P  ++A+WG+E+ +G   GK PLL
Sbjct: 75  DYLASLVDSQRVTDGQAMLVTHRELLSRLSDQTGVDPATIVAVWGVESDYGRVTGKRPLL 134

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAI 211
            +LATL+   RR  FF  +F   L L+++G +S+  L G+  G  GQ QF+P    + A+
Sbjct: 135 VSLATLSCAGRRQPFFRGEFLALLSLLQQGDLSADGLTGSWAGAFGQTQFMPSIYARIAV 194

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGWTKC 244
           D D DG+ DLV S  DA+AS A +L K GW + 
Sbjct: 195 DGDGDGRRDLVTSIPDALASTANYLVKAGWERA 227


>gi|71282243|ref|YP_270190.1| putative transglycosylase [Colwellia psychrerythraea 34H]
 gi|71147983|gb|AAZ28456.1| putative transglycosylase [Colwellia psychrerythraea 34H]
          Length = 347

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 69/206 (33%), Positives = 113/206 (54%), Gaps = 2/206 (0%)

Query: 38  TADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDG 97
           T + F E+    +A A+ +G S       FA++++ +  +  DR    +   +   YL  
Sbjct: 30  TEEGFAEYVIKLKAEALAKGFSKALIDESFAEVKFHERAVKADRSQPENVE-TLDTYLPK 88

Query: 98  LSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLAT 157
                 + +  AL K +  LL  + ++Y V P  ++ALWGLET+FG+  G   ++S LAT
Sbjct: 89  RVPKWKVDKARALYKEHQVLLNQIGEKYQVQPRFIVALWGLETNFGKFTGGYNVISALAT 148

Query: 158 LAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADED 216
           LAY+ RR  FF +Q   AL ++ +G I++  + G+  G +GQ QF+P + + YA+D D D
Sbjct: 149 LAYEGRREVFFKKQLMAALTILDEGHITNKNMKGSWAGAMGQNQFMPTSFLSYAVDGDGD 208

Query: 217 GKIDLVKSNIDAIASAAKFLAKLGWT 242
           GK D+ ++  D  +S A +L K GW 
Sbjct: 209 GKKDIWQNQADIFSSMANYLQKEGWN 234


>gi|265984485|ref|ZP_06097220.1| lytic Murein transglycosylase [Brucella sp. 83/13]
 gi|264663077|gb|EEZ33338.1| lytic Murein transglycosylase [Brucella sp. 83/13]
          Length = 399

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 77/239 (32%), Positives = 117/239 (48%), Gaps = 10/239 (4%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLF-ADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSS 100
           FG+W       A   G+  K    L  A ++     + RDRK  T   ++F ++   L S
Sbjct: 37  FGQWMENLTREAREAGVGEKGIAELHKASIDQ--KVLGRDRKQ-TVFNLTFTEFSKRLIS 93

Query: 101 SEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAY 160
              + +G       + +   ++  YGVP  +L A WGLET +G   G    L+ L TL+Y
Sbjct: 94  DARLKKGQENLVKYADVFKKVEDAYGVPGPVLAAFWGLETDYGAIQGDFDTLNALVTLSY 153

Query: 161 DCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
           DCRR   F  Q    L L  +GV+ ++  GA  GEIG  Q LP + ++  +D D DGK+D
Sbjct: 154 DCRRPDLFRPQLIALLKLFDQGVVDANTTGAWAGEIGMMQLLPKDYLERGVDGDGDGKVD 213

Query: 221 LVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKH--WNASLNYN-KTIAYIAAH 276
           L  S  DA+ +A + L++LGW +    QP  +   + K   W  ++  N K  ++ A H
Sbjct: 214 LKNSVPDAMMTAGRMLSELGWKRS---QPWLEEVRLTKDLPWEEAIRTNRKPHSWWAEH 269


>gi|114766698|ref|ZP_01445637.1| Membrane-bound lytic murein transglycosylase B [Pelagibaca
           bermudensis HTCC2601]
 gi|114541088|gb|EAU44143.1| Membrane-bound lytic murein transglycosylase B [Roseovarius sp.
           HTCC2601]
          Length = 415

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 76/245 (31%), Positives = 125/245 (51%), Gaps = 6/245 (2%)

Query: 4   KKYLLIS---LLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSP 60
           +++LL+S   L ++       +V+ P       +       +  W +A R RA   G+S 
Sbjct: 5   RRHLLVSGGALALLSACGGGTSVSAPSGGLDPDLLPQPNPGYDAWVAAFRGRAAARGISA 64

Query: 61  KTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLIN 120
            T    F    YL   + RDR   T    + +DYL   +S + ++ G A  + N  LL  
Sbjct: 65  GTLDAAFRGAGYLPGVVTRDRSQ-TEFTRTLEDYLAIAASEQKVSTGRAELRRNMALLRE 123

Query: 121 LKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVK 180
           ++  YGVPP ++ A+WG+E+++G   G  P++S  +TLAYD RR +FF  Q   AL +++
Sbjct: 124 IEGRYGVPPEVVTAVWGMESNYGTRRGDIPVVSATSTLAYDGRRGEFFEAQLISALRILE 183

Query: 181 KG-VISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSN-IDAIASAAKFLAK 238
           +G    S   G+  G +G  QF+P     YA+D   DG+ D+   +  D +AS A +L++
Sbjct: 184 RGDTTPSRLTGSWAGAMGHTQFIPTTYQDYAVDFRGDGRRDIWSEDPTDGLASTANYLSR 243

Query: 239 LGWTK 243
            GW +
Sbjct: 244 SGWRR 248


>gi|254719477|ref|ZP_05181288.1| Putative peptidoglycan binding domain 1 [Brucella sp. 83/13]
 gi|306839256|ref|ZP_07472073.1| lytic murein transglycosylase [Brucella sp. NF 2653]
 gi|306405803|gb|EFM62065.1| lytic murein transglycosylase [Brucella sp. NF 2653]
          Length = 410

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 77/239 (32%), Positives = 117/239 (48%), Gaps = 10/239 (4%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLF-ADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSS 100
           FG+W       A   G+  K    L  A ++     + RDRK  T   ++F ++   L S
Sbjct: 48  FGQWMENLTREAREAGVGEKGIAELHKASID--QKVLGRDRKQ-TVFNLTFTEFSKRLIS 104

Query: 101 SEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAY 160
              + +G       + +   ++  YGVP  +L A WGLET +G   G    L+ L TL+Y
Sbjct: 105 DARLKKGQENLVKYADVFKKVEDAYGVPGPVLAAFWGLETDYGAIQGDFDTLNALVTLSY 164

Query: 161 DCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
           DCRR   F  Q    L L  +GV+ ++  GA  GEIG  Q LP + ++  +D D DGK+D
Sbjct: 165 DCRRPDLFRPQLIALLKLFDQGVVDANTTGAWAGEIGMMQLLPKDYLERGVDGDGDGKVD 224

Query: 221 LVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKH--WNASLNYN-KTIAYIAAH 276
           L  S  DA+ +A + L++LGW +    QP  +   + K   W  ++  N K  ++ A H
Sbjct: 225 LKNSVPDAMMTAGRMLSELGWKRS---QPWLEEVRLTKDLPWEEAIRTNRKPHSWWAEH 280


>gi|254460392|ref|ZP_05073808.1| lytic murein transglycosylase [Rhodobacterales bacterium HTCC2083]
 gi|206676981|gb|EDZ41468.1| lytic murein transglycosylase [Rhodobacteraceae bacterium HTCC2083]
          Length = 391

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 71/204 (34%), Positives = 102/204 (50%), Gaps = 4/204 (1%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDR-KMVTSPPVSFKDYLDGLSS 100
           F  +    +  AV+ G  P+T    FA+       +  DR + V   P  F D+   L S
Sbjct: 28  FSSFVDGLKNEAVQRGHEPETVDRFFANARKDAAVLKADRAQGVFQLP--FVDFSRRLIS 85

Query: 101 SEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAY 160
              I +G A+ +  + +   ++ +YGV  G+L+A W  ET +G   G     + L TLA+
Sbjct: 86  QNRINKGRAMGQKYASIFAKIENKYGVSRGVLLAFWAFETDYGTFQGDFNTANALMTLAH 145

Query: 161 DCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKI 219
           DCRR + F  Q F AL+L  KG    +   GA  GEIG  Q LP ++++  ID D DG +
Sbjct: 146 DCRRPELFLPQIFAALELFGKGNFDPTRTTGAWAGEIGMVQMLPADILENGIDGDGDGHV 205

Query: 220 DLVKSNIDAIASAAKFLAKLGWTK 243
            L  S  DA+ S  K L+ LGW K
Sbjct: 206 SLKTSAPDALLSGGKMLSALGWRK 229


>gi|330953017|gb|EGH53277.1| hypothetical protein PSYCIT7_16904 [Pseudomonas syringae Cit 7]
          Length = 445

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 70/204 (34%), Positives = 113/204 (55%), Gaps = 4/204 (1%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVT-SPPVSFKDYLDGLSS 100
           F EW++  RA+A++ G+        FA +    + +  DR     S PV   +YLDG  S
Sbjct: 70  FSEWQAGFRAQALKAGIRADVFDLAFAGVTPDMSVVKADRSQPEFSRPV--WEYLDGAIS 127

Query: 101 SEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAY 160
           +  + +G AL    +  L  ++++YGV    L+A+WG+E++FG   G   ++ +LATLAY
Sbjct: 128 AVRVRKGQALLSQYADDLQKIEQQYGVDRQALVAVWGMESNFGSFQGTQSVIRSLATLAY 187

Query: 161 DCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKI 219
           + RR  F   Q   AL++++ G I+    LG+  G +GQ QF+P     +A+D D DG+ 
Sbjct: 188 EGRRPGFAQSQLLAALEIIQHGDITPDKMLGSWAGAMGQTQFIPTTYNTHAVDFDGDGRR 247

Query: 220 DLVKSNIDAIASAAKFLAKLGWTK 243
           D+  +  DA+AS A +L   GW +
Sbjct: 248 DIWNTPADALASTAHYLQSSGWQR 271


>gi|289625785|ref|ZP_06458739.1| lytic murein transglycosylase [Pseudomonas syringae pv. aesculi
           str. NCPPB3681]
 gi|289648429|ref|ZP_06479772.1| lytic murein transglycosylase [Pseudomonas syringae pv. aesculi
           str. 2250]
 gi|330867181|gb|EGH01890.1| hypothetical protein PSYAE_07967 [Pseudomonas syringae pv. aesculi
           str. 0893_23]
 gi|330871069|gb|EGH05778.1| hypothetical protein PSYAE_28208 [Pseudomonas syringae pv. aesculi
           str. 0893_23]
          Length = 445

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 68/205 (33%), Positives = 111/205 (54%), Gaps = 6/205 (2%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKM--VTSPPVSFKDYLDGLS 99
           F EW++  R +A++ G+        FA +    + +  DR     T P     +YLDG  
Sbjct: 70  FSEWQAGFRVQALKAGIRADVFDQAFAGVTPDMSVVKADRSQPEFTRP---IWEYLDGAI 126

Query: 100 SSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLA 159
           S+  + +G AL    +  L  ++++YGV    L+A+WG+E++FG   G   ++ +LATLA
Sbjct: 127 SAARVRKGQALLSQYADDLQKIEQQYGVDRQALVAVWGMESNFGSFQGTQSVIRSLATLA 186

Query: 160 YDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGK 218
           Y+ RR  F   Q   AL++++ G I+    LG+  G +GQ QF+P     +A+D D DG+
Sbjct: 187 YEGRRPGFAQSQLLAALEIIQHGDITPDKMLGSWAGAMGQTQFIPTTYNTHAVDFDGDGR 246

Query: 219 IDLVKSNIDAIASAAKFLAKLGWTK 243
            D+  +  DA+AS A +L   GW +
Sbjct: 247 RDIWNTPADALASTAHYLQSSGWQR 271


>gi|239503932|ref|ZP_04663242.1| lytic murein transglycosylase family protein [Acinetobacter
           baumannii AB900]
          Length = 430

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 80/235 (34%), Positives = 120/235 (51%), Gaps = 19/235 (8%)

Query: 18  MLAQAVTQPKKATTQFICSDT---ADRFGEWKSAARARAVREGMSPKT----AKHLFADL 70
           ++    T    AT     SDT    + F    +  R++A+  G+S  T     ++L  D 
Sbjct: 22  LVINGSTISSNATVPVTNSDTYTPNNNFQSCLANLRSQAIAAGVSGSTYDRYTQNLTPDY 81

Query: 71  EYLDTTIARDRKMVTSPPVSFK--DYLDGLSSSEIIAQGIALKKANSRLLINLKKE-YGV 127
             +D       K+   P  S    DYL GL   E +A G   K A  R ++N   + YGV
Sbjct: 82  SVID-------KLNYQPEFSTPIWDYLSGLVDEERVALG-KQKLAQHRDVLNRASQVYGV 133

Query: 128 PPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSH 187
           P   ++A+WG+E++FG+  GK PLL  L TL+ + RR  +F  +FF  + ++++G ++  
Sbjct: 134 PAETIVAVWGVESNFGDISGKYPLLQALGTLSCEGRRQSYFRTEFFATMRILQRGDLTED 193

Query: 188 AL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
            L G+  G  G  QF+P    + A+D D DG+ DLV S  DA+AS A FL K GW
Sbjct: 194 QLKGSWAGAFGHTQFMPSTYERLAVDFDGDGRRDLVSSTADALASTANFLNKAGW 248


>gi|256263591|ref|ZP_05466123.1| lytic Murein transglycosylase [Brucella melitensis bv. 2 str. 63/9]
 gi|263093640|gb|EEZ17645.1| lytic Murein transglycosylase [Brucella melitensis bv. 2 str. 63/9]
          Length = 410

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 77/239 (32%), Positives = 117/239 (48%), Gaps = 10/239 (4%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLF-ADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSS 100
           FG+W       A   G+  K    L  A ++     + RDRK  T   ++F ++   L S
Sbjct: 48  FGQWMENLTREAREAGVGEKGITELHKASID--QKVLGRDRKQ-TVFNLTFTEFSKRLIS 104

Query: 101 SEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAY 160
              + +G       + +   ++  YGVP  +L A WGLET +G   G    L+ L TL+Y
Sbjct: 105 EARLKKGQENLVKYADVFKKVEDAYGVPGPVLAAFWGLETDYGAIQGDFDTLNALVTLSY 164

Query: 161 DCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
           DCRR   F  Q    L L  +GV+ ++  GA  GEIG  Q LP + ++  +D D DGK+D
Sbjct: 165 DCRRPDLFRPQLIALLKLFDQGVVDANTTGAWAGEIGMMQLLPKDYLERGVDGDGDGKVD 224

Query: 221 LVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKH--WNASLNYN-KTIAYIAAH 276
           L  S  DA+ +A + L++LGW +    QP  +   + K   W  ++  N K  ++ A H
Sbjct: 225 LKNSVPDAMMTAGRMLSELGWKRG---QPWLEEVRLTKDLPWEEAIRTNRKPHSWWAEH 280


>gi|254465328|ref|ZP_05078739.1| lytic murein transglycosylase [Rhodobacterales bacterium Y4I]
 gi|206686236|gb|EDZ46718.1| lytic murein transglycosylase [Rhodobacterales bacterium Y4I]
          Length = 443

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 80/248 (32%), Positives = 124/248 (50%), Gaps = 15/248 (6%)

Query: 19  LAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIA 78
           L QA  QP  A   F           W    R RA+ +G+        FA + Y    I 
Sbjct: 61  LKQAEPQPAAAELNFQG---------WIQGFRDRALAQGIRAPVLDSAFAGVSYDPEVIR 111

Query: 79  RDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGL 138
           RDR   +    +  +YLD  +S   +  G A  + +   L  ++ +YGV   I++A+WGL
Sbjct: 112 RDRNQ-SEFTKTIWEYLDSAASELRVKNGKAAVREHQARLDQIEAKYGVEKEIVVAVWGL 170

Query: 139 ETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIG 197
           E+ +G   GK  ++ +LATLA+D RR  FF  Q   AL +++ G +++  + G+  G +G
Sbjct: 171 ESSYGTFRGKMDVIRSLATLAFDGRRGAFFEGQLVAALKILQAGDVAARKMTGSWAGAMG 230

Query: 198 QFQFLPVNVVKYAIDADEDGKIDLVKSN-IDAIASAAKFLAKLGWTKCAGYQPGEKNFAI 256
             QF+P + + YA+D   DGK D+   N  DA+AS A +L + GW K    QP     A+
Sbjct: 231 HTQFIPTSYLDYAVDFTGDGKRDIWSDNPSDALASTAAYLKQFGWEKG---QPWGVEVAL 287

Query: 257 LKHWNASL 264
            K ++ +L
Sbjct: 288 PKGFDYTL 295


>gi|255320738|ref|ZP_05361914.1| membrane-bound lytic murein transglycosylase B [Acinetobacter
           radioresistens SK82]
 gi|262380641|ref|ZP_06073794.1| lytic murein transglycosylase B [Acinetobacter radioresistens
           SH164]
 gi|255302208|gb|EET81449.1| membrane-bound lytic murein transglycosylase B [Acinetobacter
           radioresistens SK82]
 gi|262297589|gb|EEY85505.1| lytic murein transglycosylase B [Acinetobacter radioresistens
           SH164]
          Length = 427

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 70/207 (33%), Positives = 105/207 (50%), Gaps = 16/207 (7%)

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
           DYL GL   E +  G      ++ +L  ++  YGVP   ++A+WG+E++FG+  G  PLL
Sbjct: 99  DYLSGLVDEERVQAGRTKLAQHAEVLKRVEAAYGVPAETVVAVWGVESNFGDISGSYPLL 158

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAI 211
             L TL+ + RR  +F  +FF A+ ++++G +    L G+  G  G  QF+P    + A+
Sbjct: 159 QALGTLSCEGRRQSYFRGEFFAAMRILQRGDLREEQLKGSWAGAFGHTQFMPSTYEELAV 218

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCA--GYQ-----------PGEKNFAILK 258
           D D DG+ DLV S IDA+AS A FL K GW      G++            G +N   L 
Sbjct: 219 DFDGDGRRDLVSSTIDALASTANFLKKRGWQTGMPWGFEVKLPSGFSAQGEGRRNKKALN 278

Query: 259 HW-NASLNYNKTIAYIAAHIDG-VPIG 283
            W N  L      A +  ++ G  P G
Sbjct: 279 SWVNRGLTRTDGTALVQGNLSGSTPAG 305


>gi|330873578|gb|EGH07727.1| HopAJ2 protein [Pseudomonas syringae pv. morsprunorum str.
           M302280PT]
 gi|330963473|gb|EGH63733.1| HopAJ2 protein [Pseudomonas syringae pv. actinidiae str. M302091]
          Length = 445

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 74/221 (33%), Positives = 118/221 (53%), Gaps = 9/221 (4%)

Query: 30  TTQFICSDT-----ADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMV 84
           T   +  DT     A  F EW++  RA+A++ G+        FA +    + +  DR   
Sbjct: 53  TPALVVDDTLTIQPAVSFSEWQAGFRAQALKAGIRADIFDLAFAGVTPDMSVVKADRSQP 112

Query: 85  T-SPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFG 143
             S PV   +YLDG  S+  + +G AL    +  L  ++++YGV    L+A+WG+E++FG
Sbjct: 113 EFSRPV--WEYLDGAISAVRVRKGQALLSQYADDLQKIEQQYGVDRQALVAVWGMESNFG 170

Query: 144 ETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFL 202
              G   ++ +LATLAY+ RR  F   Q   AL++++ G I+    LG+  G +GQ QF+
Sbjct: 171 SFQGSQSVIRSLATLAYEGRRPGFAQSQLLAALEIIQHGDITPDKMLGSWAGAMGQTQFI 230

Query: 203 PVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTK 243
           P     +A+D D DG+ D+  +  DA+AS A +L   GW +
Sbjct: 231 PTTYNTHAVDFDGDGRRDIWNTPADALASTAHYLQSSGWQR 271


>gi|90408519|ref|ZP_01216677.1| membrane-bound lytic murein transglycosylase B [Psychromonas sp.
           CNPT3]
 gi|90310398|gb|EAS38525.1| membrane-bound lytic murein transglycosylase B [Psychromonas sp.
           CNPT3]
          Length = 339

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 62/201 (30%), Positives = 110/201 (54%), Gaps = 2/201 (0%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F ++ +  +  A+ +G+      + F ++++L  ++  D++      +S  DYL      
Sbjct: 33  FNDYINTLKKEAITKGIDSDIVNNAFHNVKFLKRSVTSDKQQ-PQFKLSLDDYLSKAVPE 91

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             + +     + N  LL  + K+Y V P  +++LWG+E++FG   G+  ++S+L+T+AY+
Sbjct: 92  WKVKRARNAYRDNYTLLNEIGKKYNVQPRFIVSLWGIESNFGRITGRHDVISSLSTMAYE 151

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR   F +Q F AL +++ G I     LG+  G +GQ QF+P + + YA+D D DGK D
Sbjct: 152 GRREALFKKQLFAALSILEAGYIEQENFLGSWAGAMGQVQFMPTSYLHYAVDHDGDGKKD 211

Query: 221 LVKSNIDAIASAAKFLAKLGW 241
           +  +  D  ASAA +L   GW
Sbjct: 212 IWSNLGDVFASAANYLKMEGW 232


>gi|320322695|gb|EFW78788.1| lytic murein transglycosylase [Pseudomonas syringae pv. glycinea
           str. B076]
          Length = 444

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 68/205 (33%), Positives = 111/205 (54%), Gaps = 6/205 (2%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKM--VTSPPVSFKDYLDGLS 99
           F EW++  R +A++ G+        FA +    + +  DR     T P     +YLDG  
Sbjct: 70  FSEWQAGFRVQALKAGIRADVFDQAFAGVTPDMSVVKADRSQPEFTRP---IWEYLDGAI 126

Query: 100 SSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLA 159
           S+  + +G AL    +  L  ++++YGV    L+A+WG+E++FG   G   ++ +LATLA
Sbjct: 127 SAARVRKGQALLSQYADDLQKIEQQYGVDRQALVAVWGMESNFGSFQGTQSVIRSLATLA 186

Query: 160 YDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGK 218
           Y+ RR  F   Q   AL++++ G I+    LG+  G +GQ QF+P     +A+D D DG+
Sbjct: 187 YEGRRPGFAQSQLLAALEIIQHGDITPDKMLGSWAGAMGQTQFIPTTYNTHAVDFDGDGR 246

Query: 219 IDLVKSNIDAIASAAKFLAKLGWTK 243
            D+  +  DA+AS A +L   GW +
Sbjct: 247 RDIWNTPADALASTAHYLQSSGWQR 271


>gi|254697782|ref|ZP_05159610.1| Putative peptidoglycan binding domain 1 [Brucella abortus bv. 2
           str. 86/8/59]
 gi|256257890|ref|ZP_05463426.1| Putative peptidoglycan binding domain 1 [Brucella abortus bv. 9
           str. C68]
          Length = 372

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 77/239 (32%), Positives = 117/239 (48%), Gaps = 10/239 (4%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLF-ADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSS 100
           FG+W       A   G+  K    L  A ++     + RDRK  T   ++F ++   L S
Sbjct: 10  FGQWMENLTREAREAGVGEKGIAELHKASID--QKVLGRDRKQ-TVFNLTFTEFSKRLIS 66

Query: 101 SEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAY 160
              + +G       + +   ++  YGVP  +L A WGLET +G   G    L+ L TL+Y
Sbjct: 67  EARLKKGQENLVKYADVFKKVEDAYGVPGPVLAAFWGLETDYGAIQGDFDTLNALVTLSY 126

Query: 161 DCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
           DCRR   F  Q    L L  +GV+ ++  GA  GEIG  Q LP + ++  +D D DGK+D
Sbjct: 127 DCRRPDLFRPQLIALLKLFDQGVVDANTTGAWAGEIGMMQLLPKDYLERGVDGDGDGKVD 186

Query: 221 LVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKH--WNASLNYN-KTIAYIAAH 276
           L  S  DA+ +A + L++LGW +    QP  +   + K   W  ++  N K  ++ A H
Sbjct: 187 LKNSVPDAMMTAGRMLSELGWKRG---QPWLEEVRLTKDLPWEEAIRTNRKPHSWWAEH 242


>gi|71734872|ref|YP_276514.1| hypothetical protein PSPPH_4398 [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|71555425|gb|AAZ34636.1| HopAJ2 protein [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|320330520|gb|EFW86499.1| lytic murein transglycosylase [Pseudomonas syringae pv. glycinea
           str. race 4]
          Length = 445

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 68/205 (33%), Positives = 111/205 (54%), Gaps = 6/205 (2%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKM--VTSPPVSFKDYLDGLS 99
           F EW++  R +A++ G+        FA +    + +  DR     T P     +YLDG  
Sbjct: 70  FSEWQAGFRVQALKAGIRADVFDQAFAGVTPDMSVVKADRSQPEFTRP---IWEYLDGAI 126

Query: 100 SSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLA 159
           S+  + +G AL    +  L  ++++YGV    L+A+WG+E++FG   G   ++ +LATLA
Sbjct: 127 SAARVRKGQALLSQYADDLQKIEQQYGVDRQALVAVWGMESNFGSFQGTQSVIRSLATLA 186

Query: 160 YDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGK 218
           Y+ RR  F   Q   AL++++ G I+    LG+  G +GQ QF+P     +A+D D DG+
Sbjct: 187 YEGRRPGFAQSQLLAALEIIQHGDITPDKMLGSWAGAMGQTQFIPTTYNTHAVDFDGDGR 246

Query: 219 IDLVKSNIDAIASAAKFLAKLGWTK 243
            D+  +  DA+AS A +L   GW +
Sbjct: 247 RDIWNTPADALASTAHYLQSSGWQR 271


>gi|260558069|ref|ZP_05830280.1| lytic murein transglycosylase B [Acinetobacter baumannii ATCC
           19606]
 gi|260408423|gb|EEX01730.1| lytic murein transglycosylase B [Acinetobacter baumannii ATCC
           19606]
          Length = 430

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 80/235 (34%), Positives = 120/235 (51%), Gaps = 19/235 (8%)

Query: 18  MLAQAVTQPKKATTQFICSDT---ADRFGEWKSAARARAVREGMSPKT----AKHLFADL 70
           ++    T    AT     SDT    + F    +  R++A+  G+S  T     ++L  D 
Sbjct: 22  LVINGSTISSNATVPVTNSDTYTPNNNFQSCLANLRSQAIAAGVSGSTYDRYTQNLTPDY 81

Query: 71  EYLDTTIARDRKMVTSPPVSFK--DYLDGLSSSEIIAQGIALKKANSRLLINLKKE-YGV 127
             +D       K+   P  S    DYL GL   E +A G   K A  R ++N   + YGV
Sbjct: 82  SVID-------KLNYQPEFSTPIWDYLSGLVDEERVALG-KQKLAQHRDVLNRASQVYGV 133

Query: 128 PPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSH 187
           P   ++A+WG+E++FG+  GK PLL  L TL+ + RR  +F  +FF  + ++++G ++  
Sbjct: 134 PAETIVAVWGVESNFGDISGKYPLLQALGTLSCEGRRQSYFRTEFFATMRILQRGDLTED 193

Query: 188 AL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
            L G+  G  G  QF+P    + A+D D DG+ DLV S  DA+AS A FL K GW
Sbjct: 194 QLKGSWAGAFGHTQFMPSTYERLAVDFDGDGRRDLVSSTADALASTANFLNKAGW 248


>gi|330873691|gb|EGH07840.1| hypothetical protein Pgy4_04772 [Pseudomonas syringae pv. glycinea
           str. race 4]
          Length = 445

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 68/205 (33%), Positives = 111/205 (54%), Gaps = 6/205 (2%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKM--VTSPPVSFKDYLDGLS 99
           F EW++  R +A++ G+        FA +    + +  DR     T P     +YLDG  
Sbjct: 70  FSEWQAGFRVQALKAGIRADVFDQAFAGVTPDMSVVKADRSQPEFTRP---IWEYLDGAI 126

Query: 100 SSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLA 159
           S+  + +G AL    +  L  ++++YGV    L+A+WG+E++FG   G   ++ +LATLA
Sbjct: 127 SAARVRKGQALLSQYADDLQKIEQQYGVDRQALVAVWGMESNFGSFQGTQSVIRSLATLA 186

Query: 160 YDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGK 218
           Y+ RR  F   Q   AL++++ G I+    LG+  G +GQ QF+P     +A+D D DG+
Sbjct: 187 YEGRRPGFAQSQLLAALEIIQHGDITPDKMLGSWAGAMGQTQFIPTTYNTHAVDFDGDGR 246

Query: 219 IDLVKSNIDAIASAAKFLAKLGWTK 243
            D+  +  DA+AS A +L   GW +
Sbjct: 247 RDIWNTPADALASTAHYLQSSGWQR 271


>gi|296535555|ref|ZP_06897736.1| membrane-bound lytic murein transglycosylase B [Roseomonas
           cervicalis ATCC 49957]
 gi|296264071|gb|EFH10515.1| membrane-bound lytic murein transglycosylase B [Roseomonas
           cervicalis ATCC 49957]
          Length = 323

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 63/187 (33%), Positives = 103/187 (55%), Gaps = 2/187 (1%)

Query: 56  EGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANS 115
           +G+SP   +  FADL      +  DR+      ++++ Y DG    + I QG  + + ++
Sbjct: 43  QGVSPALLRRAFADLAPNQRVLELDRRQAEFT-LTWERYRDGRLVPQRIGQGRRMAEQHA 101

Query: 116 RLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYA 175
            LL  +   Y V P I++A+WGLET++G   G    +  LATLA+D RR  FF  +   A
Sbjct: 102 ELLQRISARYAVSPRIILAVWGLETNYGGFTGSFSTIQALATLAWDGRRRAFFRRELLAA 161

Query: 176 LDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAK 234
           L ++++G ++   + G+  G +G  QF+P +    A+D D DG+ D+  S  DA+AS A 
Sbjct: 162 LQILEQGDVTPEKMRGSHAGAMGHPQFMPTSFQALAVDFDGDGRRDIWDSRADALASIAH 221

Query: 235 FLAKLGW 241
           +L+  GW
Sbjct: 222 YLSHHGW 228


>gi|254714480|ref|ZP_05176291.1| Putative peptidoglycan binding domain 1 [Brucella ceti M644/93/1]
 gi|254717378|ref|ZP_05179189.1| Putative peptidoglycan binding domain 1 [Brucella ceti M13/05/1]
          Length = 372

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 77/239 (32%), Positives = 117/239 (48%), Gaps = 10/239 (4%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLF-ADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSS 100
           FG+W       A   G+  K    L  A ++     + RDRK  T   ++F ++   L S
Sbjct: 10  FGQWMENLTREAREAGVGEKGIAELHKASID--QKVLGRDRKQ-TVFNLTFTEFSKRLIS 66

Query: 101 SEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAY 160
              + +G       + +   ++  YGVP  +L A WGLET +G   G    L+ L TL+Y
Sbjct: 67  EARLKKGQENLVKYADVFKKVEDAYGVPGPVLAAFWGLETDYGAIQGDFDTLNALVTLSY 126

Query: 161 DCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
           DCRR   F  Q    L L  +GV+ ++  GA  GEIG  Q LP + ++  +D D DGK+D
Sbjct: 127 DCRRPDLFRPQLIALLKLFDQGVVDANTTGAWAGEIGMMQLLPKDYLERGVDGDGDGKVD 186

Query: 221 LVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKH--WNASLNYN-KTIAYIAAH 276
           L  S  DA+ +A + L++LGW +    QP  +   + K   W  ++  N K  ++ A H
Sbjct: 187 LKNSVPDAMMTAGRMLSELGWKRG---QPWLEEVRLTKDLPWEEAIRTNRKPHSWWAEH 242


>gi|237798416|ref|ZP_04586877.1| HopAJ2 protein [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331021268|gb|EGI01325.1| HopAJ2 protein [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 440

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 74/221 (33%), Positives = 118/221 (53%), Gaps = 9/221 (4%)

Query: 30  TTQFICSDT-----ADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMV 84
           T   +  DT     A  F EW++  RA+A++ G+        FA +    + +  DR   
Sbjct: 53  TPALVVDDTLTIQPAVSFSEWQAGFRAQALKAGIRADVFDLAFAGVTPDMSVVKADRSQP 112

Query: 85  T-SPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFG 143
             S PV   +YLDG  S+  + +G AL    +  L  ++++YGV    L+A+WG+E++FG
Sbjct: 113 EFSRPV--WEYLDGAISAVRVRKGQALLSQYADDLQKIEQQYGVDRQALVAVWGMESNFG 170

Query: 144 ETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFL 202
              G   ++ +LATLAY+ RR  F   Q   AL++++ G I+    LG+  G +GQ QF+
Sbjct: 171 SFQGTQSVIRSLATLAYEGRRPGFAQSQLLAALEIIQHGDITPDKMLGSWAGAMGQTQFI 230

Query: 203 PVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTK 243
           P     +A+D D DG+ D+  +  DA+AS A +L   GW +
Sbjct: 231 PTTYNTHAVDFDGDGRRDIWNTPADALASTAHYLQSSGWQR 271


>gi|257482219|ref|ZP_05636260.1| hypothetical protein PsyrptA_03057 [Pseudomonas syringae pv. tabaci
           ATCC 11528]
 gi|298488994|ref|ZP_07007017.1| lytic murein transglycosylase [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|298156492|gb|EFH97589.1| lytic murein transglycosylase [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|330987609|gb|EGH85712.1| hypothetical protein PLA107_21478 [Pseudomonas syringae pv.
           lachrymans str. M301315]
 gi|331011318|gb|EGH91374.1| hypothetical protein PSYTB_16920 [Pseudomonas syringae pv. tabaci
           ATCC 11528]
          Length = 445

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 68/205 (33%), Positives = 111/205 (54%), Gaps = 6/205 (2%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKM--VTSPPVSFKDYLDGLS 99
           F EW++  R +A++ G+        FA +    + +  DR     T P     +YLDG  
Sbjct: 70  FSEWQAGFRVQALKAGIRADVFDQAFAGVTPDMSVVKADRSQPEFTRP---IWEYLDGAI 126

Query: 100 SSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLA 159
           S+  + +G AL    +  L  ++++YGV    L+A+WG+E++FG   G   ++ +LATLA
Sbjct: 127 SAARVRKGQALLSQYADDLQKIEQQYGVDRQALVAVWGMESNFGSFQGTQSVIRSLATLA 186

Query: 160 YDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGK 218
           Y+ RR  F   Q   AL++++ G I+    LG+  G +GQ QF+P     +A+D D DG+
Sbjct: 187 YEGRRPGFAQSQLLAALEIIQHGDITPDKMLGSWAGAMGQTQFIPTTYNTHAVDFDGDGR 246

Query: 219 IDLVKSNIDAIASAAKFLAKLGWTK 243
            D+  +  DA+AS A +L   GW +
Sbjct: 247 RDIWNTPADALASTAHYLQSSGWQR 271


>gi|254708118|ref|ZP_05169946.1| Putative peptidoglycan binding domain 1 [Brucella pinnipedialis
           M163/99/10]
 gi|256031981|ref|ZP_05445595.1| Putative peptidoglycan binding domain 1 [Brucella pinnipedialis
           M292/94/1]
 gi|256061502|ref|ZP_05451646.1| Putative peptidoglycan binding domain 1 [Brucella neotomae 5K33]
          Length = 372

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 77/239 (32%), Positives = 117/239 (48%), Gaps = 10/239 (4%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLF-ADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSS 100
           FG+W       A   G+  K    L  A ++     + RDRK  T   ++F ++   L S
Sbjct: 10  FGQWMENLTREAREAGVGEKGIAELHKASID--QKVLGRDRKQ-TVFNLTFTEFSKRLIS 66

Query: 101 SEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAY 160
              + +G       + +   ++  YGVP  +L A WGLET +G   G    L+ L TL+Y
Sbjct: 67  EARLKKGQENLVKYADVFKKVEDAYGVPGPVLAAFWGLETDYGAIQGDFDTLNALVTLSY 126

Query: 161 DCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
           DCRR   F  Q    L L  +GV+ ++  GA  GEIG  Q LP + ++  +D D DGK+D
Sbjct: 127 DCRRPDLFRPQLIALLKLFDQGVVDANTTGAWAGEIGMMQLLPKDYLERGVDGDGDGKVD 186

Query: 221 LVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKH--WNASLNYN-KTIAYIAAH 276
           L  S  DA+ +A + L++LGW +    QP  +   + K   W  ++  N K  ++ A H
Sbjct: 187 LKNSVPDAMMTAGRMLSELGWKRG---QPWLEEVRLTKDLPWEEAIRTNRKPHSWWAEH 242


>gi|332873283|ref|ZP_08441238.1| lytic murein transglycosylase [Acinetobacter baumannii 6014059]
 gi|322506216|gb|ADX01670.1| membrane-bound lytic murein transglycosylase B [Acinetobacter
           baumannii 1656-2]
 gi|332738489|gb|EGJ69361.1| lytic murein transglycosylase [Acinetobacter baumannii 6014059]
          Length = 416

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 79/225 (35%), Positives = 117/225 (52%), Gaps = 19/225 (8%)

Query: 28  KATTQFICSDT---ADRFGEWKSAARARAVREGMSPKT----AKHLFADLEYLDTTIARD 80
            AT     SDT    + F    +  R++A+  G+S  T     ++L  D   +D      
Sbjct: 18  NATVPVTNSDTYTPNNNFQSCLANLRSQAIAAGVSGSTYDRYTQNLTPDYSVID------ 71

Query: 81  RKMVTSPPVSFK--DYLDGLSSSEIIAQGIALKKANSRLLINLKKE-YGVPPGILMALWG 137
            K+   P  S    DYL GL   E +A G   K A  R ++N   + YGVP   ++A+WG
Sbjct: 72  -KLNYQPEFSTPIWDYLSGLVDEERVALG-KQKLAQHRDVLNRASQVYGVPAETIVAVWG 129

Query: 138 LETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEI 196
           +E++FG+  GK PLL  L TL+ + RR  +F  +FF  + ++++G ++   L G+  G  
Sbjct: 130 VESNFGDISGKYPLLQALGTLSCEGRRQSYFRTEFFATMRILQRGDLTEDQLKGSWAGAF 189

Query: 197 GQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
           G  QF+P    + A+D D DG+ DLV S  DA+AS A FL K GW
Sbjct: 190 GHTQFMPSTYERLAVDFDGDGRRDLVSSTADALASTANFLNKAGW 234


>gi|225852929|ref|YP_002733162.1| lytic murein transglycosylase [Brucella melitensis ATCC 23457]
 gi|225641294|gb|ACO01208.1| lytic murein transglycosylase [Brucella melitensis ATCC 23457]
          Length = 413

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 77/239 (32%), Positives = 117/239 (48%), Gaps = 10/239 (4%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLF-ADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSS 100
           FG+W       A   G+  K    L  A ++     + RDRK  T   ++F ++   L S
Sbjct: 51  FGQWMENLTREAREAGVGEKGITELHKASID--QKVLGRDRKQ-TVFNLTFTEFSKRLIS 107

Query: 101 SEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAY 160
              + +G       + +   ++  YGVP  +L A WGLET +G   G    L+ L TL+Y
Sbjct: 108 EARLKKGQENLVKYADVFKKVEDAYGVPGPVLAAFWGLETDYGAIQGDFDTLNALVTLSY 167

Query: 161 DCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
           DCRR   F  Q    L L  +GV+ ++  GA  GEIG  Q LP + ++  +D D DGK+D
Sbjct: 168 DCRRPDLFRPQLIALLKLFDQGVVDANTTGAWAGEIGMMQLLPKDYLERGVDGDGDGKVD 227

Query: 221 LVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKH--WNASLNYN-KTIAYIAAH 276
           L  S  DA+ +A + L++LGW +    QP  +   + K   W  ++  N K  ++ A H
Sbjct: 228 LKNSVPDAMMTAGRMLSELGWKRG---QPWLEEVRLTKDLPWEEAIRTNRKPHSWWAEH 283


>gi|62290341|ref|YP_222134.1| transglycolase [Brucella abortus bv. 1 str. 9-941]
 gi|82700264|ref|YP_414838.1| peptidoglycan binding domain-containing protein [Brucella
           melitensis biovar Abortus 2308]
 gi|189024572|ref|YP_001935340.1| peptidoglycan binding domain 1 [Brucella abortus S19]
 gi|254689640|ref|ZP_05152894.1| Putative peptidoglycan binding domain 1 [Brucella abortus bv. 6
           str. 870]
 gi|254730671|ref|ZP_05189249.1| Putative peptidoglycan binding domain 1 [Brucella abortus bv. 4
           str. 292]
 gi|256045076|ref|ZP_05447977.1| Putative peptidoglycan binding domain 1 [Brucella melitensis bv. 1
           str. Rev.1]
 gi|256114005|ref|ZP_05454782.1| Putative peptidoglycan binding domain 1 [Brucella melitensis bv. 3
           str. Ether]
 gi|260546881|ref|ZP_05822620.1| lytic murein transglycosylase [Brucella abortus NCTC 8038]
 gi|260565325|ref|ZP_05835809.1| lytic murein transglycosylase [Brucella melitensis bv. 1 str. 16M]
 gi|260884183|ref|ZP_05895797.1| lytic Murein transglycosylase [Brucella abortus bv. 9 str. C68]
 gi|265991505|ref|ZP_06104062.1| lytic Murein transglycosylase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265995343|ref|ZP_06107900.1| lytic Murein transglycosylase [Brucella melitensis bv. 3 str.
           Ether]
 gi|297248727|ref|ZP_06932445.1| peptidoglycan binding domain-containing protein [Brucella abortus
           bv. 5 str. B3196]
 gi|62196473|gb|AAX74773.1| hypothetical transglycolase [Brucella abortus bv. 1 str. 9-941]
 gi|82616365|emb|CAJ11422.1| Putative peptidoglycan binding domain 1 [Brucella melitensis biovar
           Abortus 2308]
 gi|189020144|gb|ACD72866.1| Putative peptidoglycan binding domain 1 [Brucella abortus S19]
 gi|260095931|gb|EEW79808.1| lytic murein transglycosylase [Brucella abortus NCTC 8038]
 gi|260151393|gb|EEW86487.1| lytic murein transglycosylase [Brucella melitensis bv. 1 str. 16M]
 gi|260873711|gb|EEX80780.1| lytic Murein transglycosylase [Brucella abortus bv. 9 str. C68]
 gi|262766456|gb|EEZ12245.1| lytic Murein transglycosylase [Brucella melitensis bv. 3 str.
           Ether]
 gi|263002289|gb|EEZ14864.1| lytic Murein transglycosylase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|297175896|gb|EFH35243.1| peptidoglycan binding domain-containing protein [Brucella abortus
           bv. 5 str. B3196]
 gi|326409471|gb|ADZ66536.1| Putative peptidoglycan binding domain 1 [Brucella melitensis M28]
 gi|326539178|gb|ADZ87393.1| lytic murein transglycosylase [Brucella melitensis M5-90]
          Length = 410

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 77/239 (32%), Positives = 117/239 (48%), Gaps = 10/239 (4%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLF-ADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSS 100
           FG+W       A   G+  K    L  A ++     + RDRK  T   ++F ++   L S
Sbjct: 48  FGQWMENLTREAREAGVGEKGIAELHKASID--QKVLGRDRKQ-TVFNLTFTEFSKRLIS 104

Query: 101 SEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAY 160
              + +G       + +   ++  YGVP  +L A WGLET +G   G    L+ L TL+Y
Sbjct: 105 EARLKKGQENLVKYADVFKKVEDAYGVPGPVLAAFWGLETDYGAIQGDFDTLNALVTLSY 164

Query: 161 DCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
           DCRR   F  Q    L L  +GV+ ++  GA  GEIG  Q LP + ++  +D D DGK+D
Sbjct: 165 DCRRPDLFRPQLIALLKLFDQGVVDANTTGAWAGEIGMMQLLPKDYLERGVDGDGDGKVD 224

Query: 221 LVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKH--WNASLNYN-KTIAYIAAH 276
           L  S  DA+ +A + L++LGW +    QP  +   + K   W  ++  N K  ++ A H
Sbjct: 225 LKNSVPDAMMTAGRMLSELGWKRG---QPWLEEVRLTKDLPWEEAIRTNRKPHSWWAEH 280


>gi|261315622|ref|ZP_05954819.1| lytic Murein transglycosylase [Brucella pinnipedialis M163/99/10]
 gi|261318059|ref|ZP_05957256.1| lytic Murein transglycosylase [Brucella pinnipedialis B2/94]
 gi|261297282|gb|EEY00779.1| lytic Murein transglycosylase [Brucella pinnipedialis B2/94]
 gi|261304648|gb|EEY08145.1| lytic Murein transglycosylase [Brucella pinnipedialis M163/99/10]
          Length = 399

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 77/239 (32%), Positives = 117/239 (48%), Gaps = 10/239 (4%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLF-ADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSS 100
           FG+W       A   G+  K    L  A ++     + RDRK  T   ++F ++   L S
Sbjct: 37  FGQWMENLTREAREAGVGEKGIAELHKASID--QKVLGRDRKQ-TVFNLTFTEFSKRLIS 93

Query: 101 SEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAY 160
              + +G       + +   ++  YGVP  +L A WGLET +G   G    L+ L TL+Y
Sbjct: 94  EARLKKGQENLVKYADVFKKVEDAYGVPGPVLAAFWGLETDYGAIQGDFDTLNALVTLSY 153

Query: 161 DCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
           DCRR   F  Q    L L  +GV+ ++  GA  GEIG  Q LP + ++  +D D DGK+D
Sbjct: 154 DCRRPDLFRPQLIALLKLFDQGVVDANTTGAWAGEIGMMQLLPKDYLERGVDGDGDGKVD 213

Query: 221 LVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKH--WNASLNYN-KTIAYIAAH 276
           L  S  DA+ +A + L++LGW +    QP  +   + K   W  ++  N K  ++ A H
Sbjct: 214 LKNSVPDAMMTAGRMLSELGWKRG---QPWLEEVRLTKDLPWEEAIRTNRKPHSWWAEH 269


>gi|306843207|ref|ZP_07475819.1| lytic murein transglycosylase [Brucella sp. BO2]
 gi|306286597|gb|EFM58172.1| lytic murein transglycosylase [Brucella sp. BO2]
          Length = 410

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 77/239 (32%), Positives = 117/239 (48%), Gaps = 10/239 (4%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLF-ADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSS 100
           FG+W       A   G+  K    L  A ++     + RDRK  T   ++F ++   L S
Sbjct: 48  FGQWMENLTKEAREAGVGEKGIAELHKASID--QKVLGRDRKQ-TVFNLTFTEFSKRLIS 104

Query: 101 SEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAY 160
              + +G       + +   ++  YGVP  +L A WGLET +G   G    L+ L TL+Y
Sbjct: 105 DARLKKGQENLVKYADVFKKVEDAYGVPGPVLAAFWGLETDYGAIQGDFDTLNALVTLSY 164

Query: 161 DCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
           DCRR   F  Q    L L  +GV+ ++  GA  GEIG  Q LP + ++  +D D DGK+D
Sbjct: 165 DCRRPDLFRPQLIALLKLFDQGVVDANTTGAWAGEIGMMQLLPKDYLERGVDGDGDGKVD 224

Query: 221 LVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKH--WNASLNYN-KTIAYIAAH 276
           L  S  DA+ +A + L++LGW +    QP  +   + K   W  ++  N K  ++ A H
Sbjct: 225 LKNSVPDAMMTAGRMLSELGWKRG---QPWLEEVRLTKDLPWEEAIRTNRKPHSWWAEH 280


>gi|258621278|ref|ZP_05716312.1| Membrane-bound lytic murein transglycosylase B [Vibrio mimicus
           VM573]
 gi|258586666|gb|EEW11381.1| Membrane-bound lytic murein transglycosylase B [Vibrio mimicus
           VM573]
          Length = 331

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 63/201 (31%), Positives = 111/201 (55%), Gaps = 2/201 (0%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           FG++    + +A  EG+S +     F D+EY    +  D+       ++  +Y+      
Sbjct: 32  FGQYVERLKQQAREEGISERILSEAFRDVEYKPRAVVADKNQ-PEKKLTLDEYIPRAVPE 90

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             + Q  +L + +   L  + K+YGV P  ++ALWG+E++FG   G   ++  L+TLAY+
Sbjct: 91  WKVKQAQSLYEKHYDELQRIGKQYGVQPRFIVALWGVESNFGALTGNFRVIDALSTLAYE 150

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR +FF ++   AL ++++G I+  A+ G+  G +GQ QF+P + + +A D D DGK D
Sbjct: 151 GRREEFFRKETMAALQILEQGHIAPEAMKGSWAGAMGQCQFMPSSFLNFAADGDGDGKKD 210

Query: 221 LVKSNIDAIASAAKFLAKLGW 241
           +  +  D  AS A +L++ GW
Sbjct: 211 IWGTRSDVFASTANYLSQSGW 231


>gi|254710487|ref|ZP_05172298.1| Putative peptidoglycan binding domain 1 [Brucella pinnipedialis
           B2/94]
 gi|256369864|ref|YP_003107375.1| lytic murein transglycosylase [Brucella microti CCM 4915]
 gi|260169117|ref|ZP_05755928.1| lytic murein transglycosylase [Brucella sp. F5/99]
 gi|261325511|ref|ZP_05964708.1| lytic Murein transglycosylase [Brucella neotomae 5K33]
 gi|261758626|ref|ZP_06002335.1| lytic Murein transglycosylase [Brucella sp. F5/99]
 gi|265989092|ref|ZP_06101649.1| lytic Murein transglycosylase [Brucella pinnipedialis M292/94/1]
 gi|294852773|ref|ZP_06793446.1| peptidoglycan binding domain-containing protein [Brucella sp. NVSL
           07-0026]
 gi|256000027|gb|ACU48426.1| lytic murein transglycosylase [Brucella microti CCM 4915]
 gi|261301491|gb|EEY04988.1| lytic Murein transglycosylase [Brucella neotomae 5K33]
 gi|261738610|gb|EEY26606.1| lytic Murein transglycosylase [Brucella sp. F5/99]
 gi|264661289|gb|EEZ31550.1| lytic Murein transglycosylase [Brucella pinnipedialis M292/94/1]
 gi|294821362|gb|EFG38361.1| peptidoglycan binding domain-containing protein [Brucella sp. NVSL
           07-0026]
          Length = 410

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 77/239 (32%), Positives = 117/239 (48%), Gaps = 10/239 (4%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLF-ADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSS 100
           FG+W       A   G+  K    L  A ++     + RDRK  T   ++F ++   L S
Sbjct: 48  FGQWMENLTREAREAGVGEKGIAELHKASID--QKVLGRDRKQ-TVFNLTFTEFSKRLIS 104

Query: 101 SEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAY 160
              + +G       + +   ++  YGVP  +L A WGLET +G   G    L+ L TL+Y
Sbjct: 105 EARLKKGQENLVKYADVFKKVEDAYGVPGPVLAAFWGLETDYGAIQGDFDTLNALVTLSY 164

Query: 161 DCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
           DCRR   F  Q    L L  +GV+ ++  GA  GEIG  Q LP + ++  +D D DGK+D
Sbjct: 165 DCRRPDLFRPQLIALLKLFDQGVVDANTTGAWAGEIGMMQLLPKDYLERGVDGDGDGKVD 224

Query: 221 LVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKH--WNASLNYN-KTIAYIAAH 276
           L  S  DA+ +A + L++LGW +    QP  +   + K   W  ++  N K  ++ A H
Sbjct: 225 LKNSVPDAMMTAGRMLSELGWKRG---QPWLEEVRLTKDLPWEEAIRTNRKPHSWWAEH 280


>gi|254694130|ref|ZP_05155958.1| Putative peptidoglycan binding domain 1 [Brucella abortus bv. 3
           str. Tulya]
          Length = 410

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 77/239 (32%), Positives = 117/239 (48%), Gaps = 10/239 (4%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLF-ADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSS 100
           FG+W       A   G+  K    L  A ++     + RDRK  T   ++F ++   L S
Sbjct: 48  FGQWMENLTREAREAGVGEKGIAELHKASID--QKVLGRDRKQ-TVFNLTFTEFSKRLIS 104

Query: 101 SEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAY 160
              + +G       + +   ++  YGVP  +L A WGLET +G   G    L+ L TL+Y
Sbjct: 105 EARLKKGQENLVKYADVFKKVEDAYGVPCPVLAAFWGLETDYGAIQGDFDTLNALVTLSY 164

Query: 161 DCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
           DCRR   F  Q    L L  +GV+ ++  GA  GEIG  Q LP + ++  +D D DGK+D
Sbjct: 165 DCRRPDLFRPQLIALLKLFDQGVVDANTTGAWAGEIGMMQLLPKDYLERGVDGDGDGKVD 224

Query: 221 LVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKH--WNASLNYN-KTIAYIAAH 276
           L  S  DA+ +A + L++LGW +    QP  +   + K   W  ++  N K  ++ A H
Sbjct: 225 LKNSVPDAMMTAGRMLSELGWKRG---QPWLEEVRLTKDLPWEEAIRTNRKPHSWWAEH 280


>gi|237815846|ref|ZP_04594843.1| lytic murein transglycosylase [Brucella abortus str. 2308 A]
 gi|237789144|gb|EEP63355.1| lytic murein transglycosylase [Brucella abortus str. 2308 A]
          Length = 413

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 77/239 (32%), Positives = 117/239 (48%), Gaps = 10/239 (4%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLF-ADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSS 100
           FG+W       A   G+  K    L  A ++     + RDRK  T   ++F ++   L S
Sbjct: 51  FGQWMENLTREAREAGVGEKGIAELHKASID--QKVLGRDRKQ-TVFNLTFTEFSKRLIS 107

Query: 101 SEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAY 160
              + +G       + +   ++  YGVP  +L A WGLET +G   G    L+ L TL+Y
Sbjct: 108 EARLKKGQENLVKYADVFKKVEDAYGVPGPVLAAFWGLETDYGAIQGDFDTLNALVTLSY 167

Query: 161 DCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
           DCRR   F  Q    L L  +GV+ ++  GA  GEIG  Q LP + ++  +D D DGK+D
Sbjct: 168 DCRRPDLFRPQLIALLKLFDQGVVDANTTGAWAGEIGMMQLLPKDYLERGVDGDGDGKVD 227

Query: 221 LVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKH--WNASLNYN-KTIAYIAAH 276
           L  S  DA+ +A + L++LGW +    QP  +   + K   W  ++  N K  ++ A H
Sbjct: 228 LKNSVPDAMMTAGRMLSELGWKRG---QPWLEEVRLTKDLPWEEAIRTNRKPHSWWAEH 283


>gi|260755169|ref|ZP_05867517.1| lytic Murein transglycosylase [Brucella abortus bv. 6 str. 870]
 gi|260758388|ref|ZP_05870736.1| lytic Murein transglycosylase [Brucella abortus bv. 4 str. 292]
 gi|260762214|ref|ZP_05874557.1| lytic Murein transglycosylase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260668706|gb|EEX55646.1| lytic Murein transglycosylase [Brucella abortus bv. 4 str. 292]
 gi|260672646|gb|EEX59467.1| lytic Murein transglycosylase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675277|gb|EEX62098.1| lytic Murein transglycosylase [Brucella abortus bv. 6 str. 870]
          Length = 399

 Score =  117 bits (294), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 77/239 (32%), Positives = 117/239 (48%), Gaps = 10/239 (4%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLF-ADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSS 100
           FG+W       A   G+  K    L  A ++     + RDRK  T   ++F ++   L S
Sbjct: 37  FGQWMENLTREAREAGVGEKGIAELHKASID--QKVLGRDRKQ-TVFNLTFTEFSKRLIS 93

Query: 101 SEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAY 160
              + +G       + +   ++  YGVP  +L A WGLET +G   G    L+ L TL+Y
Sbjct: 94  EARLKKGQENLVKYADVFKKVEDAYGVPGPVLAAFWGLETDYGAIQGDFDTLNALVTLSY 153

Query: 161 DCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
           DCRR   F  Q    L L  +GV+ ++  GA  GEIG  Q LP + ++  +D D DGK+D
Sbjct: 154 DCRRPDLFRPQLIALLKLFDQGVVDANTTGAWAGEIGMMQLLPKDYLERGVDGDGDGKVD 213

Query: 221 LVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKH--WNASLNYN-KTIAYIAAH 276
           L  S  DA+ +A + L++LGW +    QP  +   + K   W  ++  N K  ++ A H
Sbjct: 214 LKNSVPDAMMTAGRMLSELGWKRG---QPWLEEVRLTKDLPWEEAIRTNRKPHSWWAEH 269


>gi|261219210|ref|ZP_05933491.1| lytic Murein transglycosylase [Brucella ceti M13/05/1]
 gi|261322271|ref|ZP_05961468.1| lytic Murein transglycosylase [Brucella ceti M644/93/1]
 gi|260924299|gb|EEX90867.1| lytic Murein transglycosylase [Brucella ceti M13/05/1]
 gi|261294961|gb|EEX98457.1| lytic Murein transglycosylase [Brucella ceti M644/93/1]
          Length = 399

 Score =  117 bits (294), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 77/239 (32%), Positives = 117/239 (48%), Gaps = 10/239 (4%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLF-ADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSS 100
           FG+W       A   G+  K    L  A ++     + RDRK  T   ++F ++   L S
Sbjct: 37  FGQWMENLTREAREAGVGEKGIAELHKASID--QKVLGRDRKQ-TVFNLTFTEFSKRLIS 93

Query: 101 SEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAY 160
              + +G       + +   ++  YGVP  +L A WGLET +G   G    L+ L TL+Y
Sbjct: 94  EARLKKGQENLVKYADVFKKVEDAYGVPGPVLAAFWGLETDYGAIQGDFDTLNALVTLSY 153

Query: 161 DCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
           DCRR   F  Q    L L  +GV+ ++  GA  GEIG  Q LP + ++  +D D DGK+D
Sbjct: 154 DCRRPDLFRPQLIALLKLFDQGVVDANTTGAWAGEIGMMQLLPKDYLERGVDGDGDGKVD 213

Query: 221 LVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKH--WNASLNYN-KTIAYIAAH 276
           L  S  DA+ +A + L++LGW +    QP  +   + K   W  ++  N K  ++ A H
Sbjct: 214 LKNSVPDAMMTAGRMLSELGWKRG---QPWLEEVRLTKDLPWEEAIRTNRKPHSWWAEH 269


>gi|212635103|ref|YP_002311628.1| membrane-bound lytic murein transglycosylase [Shewanella
           piezotolerans WP3]
 gi|212556587|gb|ACJ29041.1| Membrane-bound lytic murein transglycosylase [Shewanella
           piezotolerans WP3]
          Length = 333

 Score =  117 bits (294), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 66/207 (31%), Positives = 113/207 (54%), Gaps = 2/207 (0%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F E+ +  +  AV +G+  +T   +F  ++     +A D K      ++ + YL  +   
Sbjct: 33  FSEYVTQLKLEAVEQGVKEQTINDVFPKIKMFKKAVASD-KAQPETKLTLETYLPRVVPD 91

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             + +   L K +   L  + + YGV P  ++ALWG+E++FG+  G  P+LS  A+LAY+
Sbjct: 92  WKVEKARNLFKTHQVELERIGELYGVQPRFIVALWGVESNFGKLTGSYPVLSVTASLAYE 151

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR  FF ++FF AL + ++   +   + G+  G +GQ QF+P + + YA D D DGK D
Sbjct: 152 GRREDFFKKEFFAALKIAEEQQFTFEEMKGSWAGAMGQTQFMPTSFLAYAQDGDGDGKKD 211

Query: 221 LVKSNIDAIASAAKFLAKLGWTKCAGY 247
           +  ++ DA ASAA +L + GW +   +
Sbjct: 212 IWNNSSDAFASAAYYLQQAGWKESETW 238


>gi|225627895|ref|ZP_03785931.1| lytic murein transglycosylase [Brucella ceti str. Cudo]
 gi|225617058|gb|EEH14104.1| lytic murein transglycosylase [Brucella ceti str. Cudo]
          Length = 413

 Score =  117 bits (294), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 77/239 (32%), Positives = 117/239 (48%), Gaps = 10/239 (4%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLF-ADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSS 100
           FG+W       A   G+  K    L  A ++     + RDRK  T   ++F ++   L S
Sbjct: 51  FGQWMENLTREAREAGVGEKGIAELHKASID--QKVLGRDRKQ-TVFNLTFTEFSKRLIS 107

Query: 101 SEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAY 160
              + +G       + +   ++  YGVP  +L A WGLET +G   G    L+ L TL+Y
Sbjct: 108 EARLKKGQENLVKYADVFKKVEDAYGVPGPVLAAFWGLETDYGAIQGDFDTLNALVTLSY 167

Query: 161 DCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
           DCRR   F  Q    L L  +GV+ ++  GA  GEIG  Q LP + ++  +D D DGK+D
Sbjct: 168 DCRRPDLFRPQLIALLKLFDQGVVDANTTGAWAGEIGMMQLLPKDYLERGVDGDGDGKVD 227

Query: 221 LVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKH--WNASLNYN-KTIAYIAAH 276
           L  S  DA+ +A + L++LGW +    QP  +   + K   W  ++  N K  ++ A H
Sbjct: 228 LKNSVPDAMMTAGRMLSELGWKRG---QPWLEEVRLTKDLPWEEAIRTNRKPHSWWAEH 283


>gi|261214431|ref|ZP_05928712.1| lytic Murein transglycosylase [Brucella abortus bv. 3 str. Tulya]
 gi|260916038|gb|EEX82899.1| lytic Murein transglycosylase [Brucella abortus bv. 3 str. Tulya]
          Length = 399

 Score =  117 bits (294), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 77/239 (32%), Positives = 117/239 (48%), Gaps = 10/239 (4%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLF-ADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSS 100
           FG+W       A   G+  K    L  A ++     + RDRK  T   ++F ++   L S
Sbjct: 37  FGQWMENLTREAREAGVGEKGIAELHKASID--QKVLGRDRKQ-TVFNLTFTEFSKRLIS 93

Query: 101 SEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAY 160
              + +G       + +   ++  YGVP  +L A WGLET +G   G    L+ L TL+Y
Sbjct: 94  EARLKKGQENLVKYADVFKKVEDAYGVPCPVLAAFWGLETDYGAIQGDFDTLNALVTLSY 153

Query: 161 DCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
           DCRR   F  Q    L L  +GV+ ++  GA  GEIG  Q LP + ++  +D D DGK+D
Sbjct: 154 DCRRPDLFRPQLIALLKLFDQGVVDANTTGAWAGEIGMMQLLPKDYLERGVDGDGDGKVD 213

Query: 221 LVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKH--WNASLNYN-KTIAYIAAH 276
           L  S  DA+ +A + L++LGW +    QP  +   + K   W  ++  N K  ++ A H
Sbjct: 214 LKNSVPDAMMTAGRMLSELGWKRG---QPWLEEVRLTKDLPWEEAIRTNRKPHSWWAEH 269


>gi|169797788|ref|YP_001715581.1| putative membrane-bound lytic murein transglycosylase
           [Acinetobacter baumannii AYE]
 gi|213155414|ref|YP_002317459.1| transglycolase [Acinetobacter baumannii AB0057]
 gi|215485138|ref|YP_002327379.1| lytic murein transglycosylase family protein [Acinetobacter
           baumannii AB307-0294]
 gi|301347988|ref|ZP_07228729.1| lytic murein transglycosylase family protein [Acinetobacter
           baumannii AB056]
 gi|301512988|ref|ZP_07238225.1| lytic murein transglycosylase family protein [Acinetobacter
           baumannii AB058]
 gi|301596722|ref|ZP_07241730.1| lytic murein transglycosylase family protein [Acinetobacter
           baumannii AB059]
 gi|169150715|emb|CAM88625.1| putative membrane-bound lytic murein transglycosylase
           [Acinetobacter baumannii AYE]
 gi|213054574|gb|ACJ39476.1| transglycolase [Acinetobacter baumannii AB0057]
 gi|213988779|gb|ACJ59078.1| lytic murein transglycosylase family protein [Acinetobacter
           baumannii AB307-0294]
          Length = 430

 Score =  117 bits (294), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 73/200 (36%), Positives = 109/200 (54%), Gaps = 16/200 (8%)

Query: 50  RARAVREGMSPKT----AKHLFADLEYLDTTIARDRKMVTSPPVSFK--DYLDGLSSSEI 103
           R++A+  G+S  T     ++L  D   +D       K+   P  S    DYL GL   E 
Sbjct: 57  RSQAIAAGVSGSTYDRYTQNLTPDYSVID-------KLNYQPEFSTPIWDYLSGLVDEER 109

Query: 104 IAQGIALKKANSRLLINLKKE-YGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDC 162
           +A G   K A  R ++N   + YGVP   ++A+WG+E++FG+  GK PLL  L TL+ + 
Sbjct: 110 VALG-KQKLAQHRDVLNRASQVYGVPAETIVAVWGVESNFGDISGKYPLLQALGTLSCEG 168

Query: 163 RRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDL 221
           RR  +F  +FF  + ++++G ++   L G+  G  G  QF+P    + A+D D DG+ DL
Sbjct: 169 RRQSYFRTEFFATMRILQRGDLTEDQLKGSWAGAFGHTQFMPSTYERLAVDFDGDGRRDL 228

Query: 222 VKSNIDAIASAAKFLAKLGW 241
           V S  DA+AS A FL K GW
Sbjct: 229 VSSTADALASTANFLNKAGW 248


>gi|332854690|ref|ZP_08435477.1| lytic murein transglycosylase [Acinetobacter baumannii 6013150]
 gi|332865570|ref|ZP_08436410.1| lytic murein transglycosylase [Acinetobacter baumannii 6013113]
 gi|332727847|gb|EGJ59249.1| lytic murein transglycosylase [Acinetobacter baumannii 6013150]
 gi|332735222|gb|EGJ66299.1| lytic murein transglycosylase [Acinetobacter baumannii 6013113]
          Length = 416

 Score =  117 bits (293), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 73/200 (36%), Positives = 109/200 (54%), Gaps = 16/200 (8%)

Query: 50  RARAVREGMSPKT----AKHLFADLEYLDTTIARDRKMVTSPPVSFK--DYLDGLSSSEI 103
           R++A+  G+S  T     ++L  D   +D       K+   P  S    DYL GL   E 
Sbjct: 43  RSQAIAAGVSGSTYDRYTQNLTPDYSVID-------KLNYQPEFSTPIWDYLSGLVDEER 95

Query: 104 IAQGIALKKANSRLLINLKKE-YGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDC 162
           +A G   K A  R ++N   + YGVP   ++A+WG+E++FG+  GK PLL  L TL+ + 
Sbjct: 96  VALG-KQKLAQHRDVLNRASQVYGVPAETIVAVWGVESNFGDISGKYPLLQALGTLSCEG 154

Query: 163 RRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDL 221
           RR  +F  +FF  + ++++G ++   L G+  G  G  QF+P    + A+D D DG+ DL
Sbjct: 155 RRQSYFRTEFFATMRILQRGDLTEDQLKGSWAGAFGHTQFMPSTYERLAVDFDGDGRRDL 214

Query: 222 VKSNIDAIASAAKFLAKLGW 241
           V S  DA+AS A FL K GW
Sbjct: 215 VSSTADALASTANFLNKAGW 234


>gi|190576433|ref|YP_001974278.1| putative transglycosylase protein [Stenotrophomonas maltophilia
           K279a]
 gi|190014355|emb|CAQ48002.1| putative transglycosylase protein [Stenotrophomonas maltophilia
           K279a]
          Length = 422

 Score =  117 bits (293), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 70/204 (34%), Positives = 106/204 (51%), Gaps = 8/204 (3%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPP---VSFKDYLDGL 98
           F    S  +A AV +G+SP     + A L    + +     ++ + P       DYL  L
Sbjct: 31  FSRCLSGLQATAVTQGISPDRFNAITAGLTPDPSVLG----LLDAQPEFTTPIWDYLAAL 86

Query: 99  SSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATL 158
              + +A G AL + +  LL  +  +YGV P  ++A+WG+E+ +G   GK PLL +LATL
Sbjct: 87  VDRQRVADGRALLQQHRDLLDRVSAQYGVDPATIVAVWGVESDYGRVFGKRPLLQSLATL 146

Query: 159 AYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDG 217
           +   RR  FF  +    L L+ +G + +  L G+  G  G  QF+P    + A+D D DG
Sbjct: 147 SCAGRRQPFFRGELLALLKLIDRGDLQAQGLTGSWAGAFGHTQFMPSTYARIAVDGDGDG 206

Query: 218 KIDLVKSNIDAIASAAKFLAKLGW 241
           + DLV S  DA+AS A +L + GW
Sbjct: 207 RRDLVGSIPDALASTANYLKRAGW 230


>gi|17986844|ref|NP_539478.1| membrane-bound lytic murein transglycosylase B [Brucella melitensis
           bv. 1 str. 16M]
 gi|17982480|gb|AAL51742.1| membrane-bound lytic murein transglycosylase b [Brucella melitensis
           bv. 1 str. 16M]
          Length = 398

 Score =  117 bits (293), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 77/239 (32%), Positives = 117/239 (48%), Gaps = 10/239 (4%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLF-ADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSS 100
           FG+W       A   G+  K    L  A ++     + RDRK  T   ++F ++   L S
Sbjct: 36  FGQWMENLTREAREAGVGEKGIAELHKASID--QKVLGRDRKQ-TVFNLTFTEFSKRLIS 92

Query: 101 SEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAY 160
              + +G       + +   ++  YGVP  +L A WGLET +G   G    L+ L TL+Y
Sbjct: 93  EARLKKGQENLVKYADVFKKVEDAYGVPGPVLAAFWGLETDYGAIQGDFDTLNALVTLSY 152

Query: 161 DCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
           DCRR   F  Q    L L  +GV+ ++  GA  GEIG  Q LP + ++  +D D DGK+D
Sbjct: 153 DCRRPDLFRPQLIALLKLFDQGVVDANTTGAWAGEIGMMQLLPKDYLERGVDGDGDGKVD 212

Query: 221 LVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKH--WNASLNYN-KTIAYIAAH 276
           L  S  DA+ +A + L++LGW +    QP  +   + K   W  ++  N K  ++ A H
Sbjct: 213 LKNSVPDAMMTAGRMLSELGWKRG---QPWLEEVRLTKDLPWEEAIRTNRKPHSWWAEH 268


>gi|259418047|ref|ZP_05741966.1| lytic murein transglycosylase [Silicibacter sp. TrichCH4B]
 gi|259346953|gb|EEW58767.1| lytic murein transglycosylase [Silicibacter sp. TrichCH4B]
          Length = 455

 Score =  117 bits (293), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 68/202 (33%), Positives = 109/202 (53%), Gaps = 3/202 (1%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F  W    + RA  +G+S  T +  F  + Y  + I RDR   +    +  +YLD  +S 
Sbjct: 87  FPAWIKEFQVRAQAQGISASTLRRAFEGVTYDPSVIKRDRNQ-SEFSKTIWEYLDSAASD 145

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             ++ G    + +   L  ++K YGV   I++A+WGLE+ +G   G   ++ +LATLAYD
Sbjct: 146 SRVSNGNKALRDHLAKLQQIEKHYGVDKEIVVAVWGLESSYGTFRGDMDIIRSLATLAYD 205

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR  FF +Q   AL +++ G +   ++ G+  G +G  QF+P + + YA+D   DGK D
Sbjct: 206 GRRGAFFEQQLIAALKILQAGDVDPRSMTGSWAGAMGHTQFMPTSYLDYAVDFTGDGKRD 265

Query: 221 L-VKSNIDAIASAAKFLAKLGW 241
           +   +  DA+AS A +L K GW
Sbjct: 266 IWSDTPTDALASTAAYLKKFGW 287


>gi|269468192|gb|EEZ79888.1| membrane-bound lytic murein transglycosylase B [uncultured SUP05
           cluster bacterium]
          Length = 191

 Score =  117 bits (293), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 68/176 (38%), Positives = 92/176 (52%), Gaps = 1/176 (0%)

Query: 47  SAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQ 106
           S  R +AV +G+S  T    F  L      I  DR        +F  YLD   S   + +
Sbjct: 16  SNIRTQAVDQGVSKATINQAFKGLVPNPKVIKFDRTQAEFSQ-NFWRYLDSRVSKYRLDK 74

Query: 107 GIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAK 166
           G      + +      K+YGVPP +++A WGLET++G   G   LL +LATL++D RR+ 
Sbjct: 75  GTEKLAQHQQTFQKNYKKYGVPPHVIVAFWGLETNYGTNTGNLNLLRSLATLSFDQRRST 134

Query: 167 FFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLV 222
           FFTEQ    L L+  G I  +A G+  G +G  QF+P NV  Y IDAD+DGK   V
Sbjct: 135 FFTEQLLALLKLIDAGKIPMNAEGSWAGAMGNVQFMPTNVAAYGIDADDDGKPPFV 190


>gi|209694628|ref|YP_002262556.1| hypothetical protein VSAL_I1069 [Aliivibrio salmonicida LFI1238]
 gi|208008579|emb|CAQ78754.1| putative exported protein [Aliivibrio salmonicida LFI1238]
          Length = 324

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 61/193 (31%), Positives = 107/193 (55%), Gaps = 2/193 (1%)

Query: 50  RARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIA 109
           +  A   G+S    +  F ++ + +  +  DR       ++  +Y+        I Q   
Sbjct: 35  KNEARENGISEPILERAFKNVAFKEKAVKSDRNQ-PEKKLTLDEYIPRAVPKWKIKQAND 93

Query: 110 LKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFT 169
           L + +  +L  + KEYGV P  ++ALWG+E++FG+  G   ++  L TLAYD RR  FF 
Sbjct: 94  LYQKHHEVLTRIGKEYGVQPRFIVALWGVESNFGKLTGGYNVIEALTTLAYDGRREAFFR 153

Query: 170 EQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDA 228
           +Q   AL ++++G I+   + G+  G +GQ QF+P + + YA+D ++DG+ D+  ++ D 
Sbjct: 154 KQTMAALTILEQGHITPENMKGSWAGAMGQCQFMPTSFLAYAVDGNDDGRKDIWTTHADV 213

Query: 229 IASAAKFLAKLGW 241
            ASAA +L ++GW
Sbjct: 214 FASAANYLKQVGW 226


>gi|262377636|ref|ZP_06070856.1| lytic murein transglycosylase B [Acinetobacter lwoffii SH145]
 gi|262307395|gb|EEY88538.1| lytic murein transglycosylase B [Acinetobacter lwoffii SH145]
          Length = 430

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 70/194 (36%), Positives = 106/194 (54%), Gaps = 4/194 (2%)

Query: 50  RARAVREGMSPKTAKHLFADLEYLDTTIAR-DRKMVTSPPVSFKDYLDGLSSSEIIAQGI 108
           R++AV  G+S  T      +L    + I R + +   S P+   DYL GL   E +  G 
Sbjct: 57  RSQAVARGVSGSTYDRYTQNLNPDYSVIERLNYQPEFSTPI--WDYLSGLVDEERVQLGR 114

Query: 109 ALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFF 168
              + +  +L  +   YGVP   ++A+WG+E++FG+  GK PLL  L TL+ + RR  +F
Sbjct: 115 QKLQQHREVLNRVAATYGVPAETVVAVWGVESNFGDISGKYPLLQALGTLSCEGRRQSYF 174

Query: 169 TEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNID 227
             +FF  + L+++G +    L G+  G  G  QF+P    + A+D D DG+ DLV S  D
Sbjct: 175 RGEFFTTMKLLQRGDVREEQLKGSWAGAFGHTQFMPSTYDELAVDFDGDGRRDLVSSIPD 234

Query: 228 AIASAAKFLAKLGW 241
           A+AS A FL+K GW
Sbjct: 235 ALASTANFLSKRGW 248


>gi|294675803|ref|YP_003576418.1| membrane-bound lytic murein transglycosylase B [Rhodobacter
           capsulatus SB 1003]
 gi|294474623|gb|ADE84011.1| membrane-bound lytic murein transglycosylase B [Rhodobacter
           capsulatus SB 1003]
          Length = 419

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 70/202 (34%), Positives = 110/202 (54%), Gaps = 5/202 (2%)

Query: 45  WKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDR-KMVTSPPVSFKDYLDGLSSSEI 103
           W +  + RA+  G+S  T      ++ Y    I R + +     P+   DY+D  +S E 
Sbjct: 52  WVAGFKPRAMAAGISEATWNRAMRNVPYNPKVIERQQFQAEFVKPI--WDYMDSAASEER 109

Query: 104 IAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCR 163
           IA G A       +L  ++  YGV   +++A+WG+E+ +G   G T ++  LATLA+D R
Sbjct: 110 IANGRAALAQYDGVLREIEARYGVDKEVVVAVWGMESRYGAKRGNTLIIPALATLAHDGR 169

Query: 164 RAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLV 222
           RA+FF  Q   AL +++ G I   H  G+  G +G  QF+P + + +A+D   DGK D+ 
Sbjct: 170 RAQFFESQLIGALKILQAGDIDPGHMTGSWAGAMGHTQFIPTSYLAFAVDFTGDGKRDIW 229

Query: 223 KSN-IDAIASAAKFLAKLGWTK 243
             N  DA+AS A +LA+ GW+K
Sbjct: 230 SDNPADALASTAAYLARSGWSK 251


>gi|319788601|ref|YP_004148076.1| lytic murein transglycosylase [Pseudoxanthomonas suwonensis 11-1]
 gi|317467113|gb|ADV28845.1| lytic murein transglycosylase [Pseudoxanthomonas suwonensis 11-1]
          Length = 402

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 87/150 (58%), Gaps = 1/150 (0%)

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
           DYL GL   E +A G+A+ + +  LL  +   +GV P  ++A+WG+E+ +G   GK PLL
Sbjct: 75  DYLSGLVDDERVADGLAMLETHRELLAAVSARHGVDPATVVAVWGVESDYGRVSGKRPLL 134

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAI 211
            +L+TL+   RR  FF  +F  AL L+  G +    + G+  G  G  QF+P    + A+
Sbjct: 135 QSLSTLSCFGRRQDFFRGEFLAALQLLHAGDLRDPGITGSWAGAFGHTQFMPSTYARIAV 194

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
           D D DG+ DLV S  DA+AS A +L + GW
Sbjct: 195 DGDGDGRRDLVGSIPDALASTAHYLQRAGW 224


>gi|219870866|ref|YP_002475241.1| membrane-bound lytic murein transglycosylase B [Haemophilus
           parasuis SH0165]
 gi|219691070|gb|ACL32293.1| membrane-bound lytic murein transglycosylase B [Haemophilus
           parasuis SH0165]
          Length = 359

 Score =  117 bits (292), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 77/254 (30%), Positives = 128/254 (50%), Gaps = 15/254 (5%)

Query: 4   KKYLLISLLMMVYPMLAQAVTQ-PKKA-TTQFICSDTADRFGEWKSAARARAVREGMSPK 61
           K YL IS+  +V    A +  + PK A   ++  + +   F ++ S  + +A  EG+S +
Sbjct: 2   KSYLTISMACLVLAGCANSEQEYPKVALEAKYPNTRSLIHFDDYVSFLKKKAANEGVSAE 61

Query: 62  TAKHLFADLEYLDTTIARDRKMVT-----------SPPVSFKDYLDGLSSSEIIAQGIAL 110
                F +++Y+   +  D++                P    +YL+   +   +      
Sbjct: 62  VLNTTF-NIQYVPRAVELDQQQANRRRDPNLPPPQPNPNGVTNYLNKTLTQAKVDTAAQR 120

Query: 111 KKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTE 170
                  L    ++YGV    LMALWG+E+ FG   G   +LS LATLA+D RR K FT+
Sbjct: 121 WWQYQPQLTKASQKYGVQKEYLMALWGMESSFGRYQGNFDVLSVLATLAFDGRREKLFTQ 180

Query: 171 QFFYALDLVKKG-VISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAI 229
           +F  A+ ++++G ++ +   G+  G +GQ QF+P + + YA D D DG+ D+ K+  DA 
Sbjct: 181 EFVNAMKMLQQGTLVRAEMKGSWAGAMGQTQFMPTSYLNYAADGDNDGRKDIWKNQYDAF 240

Query: 230 ASAAKFLAKLGWTK 243
           AS A +LA +GW K
Sbjct: 241 ASIANYLATVGWDK 254


>gi|84500323|ref|ZP_00998589.1| hypothetical protein OB2597_10284 [Oceanicola batsensis HTCC2597]
 gi|84392257|gb|EAQ04525.1| hypothetical protein OB2597_10284 [Oceanicola batsensis HTCC2597]
          Length = 389

 Score =  117 bits (292), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 73/211 (34%), Positives = 101/211 (47%), Gaps = 8/211 (3%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           FG + S  +A AV+ G    T    FA +      I  DR       + F  +   L S 
Sbjct: 26  FGTFVSGLKAEAVQRGHDRATVDRFFASVRQDPKVIRADRAQGVFQ-LDFTTFARRLISQ 84

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             +  G A  +    +   ++ EYGV  G+L+A W  ET +G   G    L+ LATLA+D
Sbjct: 85  HRLNAGAANARKYDSIFDRIEAEYGVNRGVLLAFWAFETDYGAFQGDFNTLNALATLAHD 144

Query: 162 CRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
           CRR   F  Q F AL+L + G    +   GA  GEIG  Q LP ++++  +D D DG + 
Sbjct: 145 CRRPDLFRPQIFSALELYENGDFDPARTTGAWAGEIGMVQMLPGDIIENGVDGDGDGHVT 204

Query: 221 LVKSNIDAIASAAKFLAKLGWTKCAGYQPGE 251
           L  S  DA+ S A+ L  LGW      +PGE
Sbjct: 205 LKTSAPDALMSGARMLRHLGW------RPGE 229


>gi|262371197|ref|ZP_06064518.1| conserved hypothetical protein [Acinetobacter johnsonii SH046]
 gi|262313927|gb|EEY94973.1| conserved hypothetical protein [Acinetobacter johnsonii SH046]
          Length = 427

 Score =  117 bits (292), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 60/150 (40%), Positives = 88/150 (58%), Gaps = 1/150 (0%)

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
           DYL GL   E +A G      +  +L  +   YGVP   ++A+WG+E++FG+  GK PLL
Sbjct: 96  DYLSGLVDDERVAVGRQKLVQHREVLNRVAAAYGVPAETVVAVWGVESNFGDISGKYPLL 155

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAI 211
             L TL+ + RR  +F  +FF A+ ++++G ++   L G+  G  G  QF+P    + A+
Sbjct: 156 QALGTLSCEGRRQSYFRGEFFAAMRILQRGDLTESQLKGSWAGAFGHTQFMPSTYEELAV 215

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
           D D DG+ DLV S  DA+AS A FL K GW
Sbjct: 216 DFDGDGRRDLVSSTTDALASTANFLKKRGW 245


>gi|307945426|ref|ZP_07660762.1| lytic murein transglycosylase [Roseibium sp. TrichSKD4]
 gi|307771299|gb|EFO30524.1| lytic murein transglycosylase [Roseibium sp. TrichSKD4]
          Length = 394

 Score =  116 bits (291), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 67/203 (33%), Positives = 104/203 (51%), Gaps = 2/203 (0%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F ++ +  +  AV +G+S K A    +  +     +ARDR       + F ++   + S 
Sbjct: 31  FRQFLAGVKKEAVAKGLSAKAADATLSGAQIDRKVLARDRSQGVFK-MPFINFSQRVISG 89

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             +  G    K  S +    +KEYGVP  ++ A W LET +G   G    ++ LATLA+D
Sbjct: 90  HRMQHGAKNMKKYSGIFARTEKEYGVPAPVISAFWALETDYGAVQGDFNTVNALATLAHD 149

Query: 162 CRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
           CRR + F  Q   A+++V+ G +      GA  GEIG  Q LP +++K+  D + DG + 
Sbjct: 150 CRRPELFRPQLIAAIEMVQHGDLDPRRTTGAWAGEIGMVQMLPEDIIKFGKDGNGDGHVT 209

Query: 221 LVKSNIDAIASAAKFLAKLGWTK 243
           L KS  DAI +A  F+  LGW +
Sbjct: 210 LKKSAEDAILTAGAFIQNLGWRR 232


>gi|89067326|ref|ZP_01154839.1| hypothetical protein OG2516_10816 [Oceanicola granulosus HTCC2516]
 gi|89046895|gb|EAR52949.1| hypothetical protein OG2516_10816 [Oceanicola granulosus HTCC2516]
          Length = 389

 Score =  116 bits (291), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 69/201 (34%), Positives = 98/201 (48%), Gaps = 2/201 (0%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F  +  A +  AV  G      +  FA +      IA DR+        F D+   L S 
Sbjct: 25  FNAFVDALKTEAVARGHDASATERFFASVRQDPDVIAADRRQGVFQ-RDFIDFSRRLISQ 83

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             I  G  + +        ++ EYGVP G+L+A W  ET +G+  G     + L TLA+D
Sbjct: 84  NRIDNGQIMSERYDATFDRIEAEYGVPRGVLLAFWAFETDYGQVQGDFNTANALVTLAHD 143

Query: 162 CRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
           CRR + F  Q + AL+L ++G +  +   GA  GEIGQ Q LP +++    D D DG++D
Sbjct: 144 CRRPELFLPQVYAALELYERGDLDPATTTGAWAGEIGQVQMLPEDILTNGRDGDGDGRVD 203

Query: 221 LVKSNIDAIASAAKFLAKLGW 241
           L  S  DA+ S    LA LGW
Sbjct: 204 LKGSAEDALMSGGAMLADLGW 224


>gi|153834502|ref|ZP_01987169.1| membrane-bound lytic murein transglycosylase B [Vibrio harveyi
           HY01]
 gi|156973685|ref|YP_001444592.1| membrane-bound lytic murein transglycosylase B [Vibrio harveyi ATCC
           BAA-1116]
 gi|148869088|gb|EDL68127.1| membrane-bound lytic murein transglycosylase B [Vibrio harveyi
           HY01]
 gi|156525279|gb|ABU70365.1| hypothetical protein VIBHAR_01388 [Vibrio harveyi ATCC BAA-1116]
          Length = 323

 Score =  116 bits (291), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 65/205 (31%), Positives = 112/205 (54%), Gaps = 2/205 (0%)

Query: 38  TADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDG 97
           ++D F E+ +  RA A  +G+S +     FAD+EY    +  DR       ++  +Y+  
Sbjct: 20  SSDGFDEYLNKLRAEARDKGISEQVISAAFADVEYKPRAVKADRNQ-PEKKLTLDEYIPR 78

Query: 98  LSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLAT 157
                 + Q   L K +   L  +  E+GV P  ++ALWG+E++FG+  G   ++  L+T
Sbjct: 79  AVPEWKVKQAKQLYKEHYAELKRIGDEFGVQPRFIVALWGVESNFGKFTGNFRVIDALST 138

Query: 158 LAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADED 216
           +A++ RR +FF ++   AL ++ +G I      G+  G +GQ QF+P + +++A D + D
Sbjct: 139 MAFEGRREEFFRKETMAALQILDEGHIELENFKGSWAGAMGQCQFMPSSFLRFAADGNGD 198

Query: 217 GKIDLVKSNIDAIASAAKFLAKLGW 241
           GK D+ +S  D  AS A +L+K GW
Sbjct: 199 GKKDIWQSEADVFASTANYLSKSGW 223


>gi|84499391|ref|ZP_00997679.1| peptidoglycan-binding protein, putative [Oceanicola batsensis
           HTCC2597]
 gi|84392535|gb|EAQ04746.1| peptidoglycan-binding protein, putative [Oceanicola batsensis
           HTCC2597]
          Length = 379

 Score =  116 bits (291), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 86/260 (33%), Positives = 128/260 (49%), Gaps = 26/260 (10%)

Query: 45  WKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEII 104
           W +A R RA   G++  T    F    ++   + RDR    S   S +DYL   +S E +
Sbjct: 48  WVAAFRPRARSAGITSATLDAAFRGAGFIPGVVTRDRSQPESS-YSLEDYLSIAASDERL 106

Query: 105 AQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRR 164
           A+G A        L  L+  YGV   I+ A+WGLE+ +GE  G  P++S  +TLA+D RR
Sbjct: 107 AKGRAAFARQRDTLTALESRYGVDAEIICAIWGLESRYGERRGTVPVISATSTLAFDGRR 166

Query: 165 AKFFTEQFFYALDLVKKG-VISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVK 223
             FF +Q   AL +++ G V  +  +G+  G +G  QF+P + + YA+D D DG+ D+  
Sbjct: 167 GAFFEKQLIAALRILQSGDVTPARMVGSWAGAMGHTQFIPTSYLAYAVDFDGDGRRDIWS 226

Query: 224 SN-IDAIASAAKFLAKLGWTKCAGY-----QPG------------------EKNFAILKH 259
            +  DA+ASAA +LA  GWT+   +      PG                    NF  +K 
Sbjct: 227 EDPTDALASAAAYLANAGWTRGLKWGGETGAPGTPAGTTITPQAGGPSFTVTSNFRAIKR 286

Query: 260 WNASLNYNKTIAYIAAHIDG 279
           +N S  Y   I ++A  I G
Sbjct: 287 YNNSDLYAIGIGHLADRIAG 306


>gi|59712309|ref|YP_205085.1| membrane-bound lytic murein transglycosylase B [Vibrio fischeri
           ES114]
 gi|59480410|gb|AAW86197.1| membrane-bound lytic murein transglycosylase B [Vibrio fischeri
           ES114]
          Length = 325

 Score =  116 bits (291), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 70/240 (29%), Positives = 121/240 (50%), Gaps = 14/240 (5%)

Query: 3   FKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKT 62
            KK LL+ ++ +     A A   P+     +I               +  A   G+S   
Sbjct: 1   MKKKLLLGIVSLFLATSASASATPEGDFQDYIV------------GLKNEAREIGISEPI 48

Query: 63  AKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLK 122
            +  F ++ + +  +  DR       ++  +Y+        I Q   L K + ++L  + 
Sbjct: 49  LERAFKNVAFKEKAVKSDRNQ-PEKKLTLDEYIPRAVPKWKIKQANDLYKKHYKVLNRIG 107

Query: 123 KEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKG 182
           +EYGV P  ++ALWG+E++FG+  G   ++  L TLAYD RR  FF +Q   AL ++++G
Sbjct: 108 EEYGVQPRFIVALWGVESNFGKLTGGYNVIEALTTLAYDGRREAFFKKQTMAALTILQQG 167

Query: 183 VISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
            I+   + G+  G +GQ QF+P + + YA+D + DGK D+  ++ D  ASAA +L ++GW
Sbjct: 168 HITPENMKGSWAGAMGQCQFMPTSFLSYAVDGNGDGKKDIWNTHADVFASAANYLKQVGW 227


>gi|323516092|gb|ADX90473.1| membrane-bound lytic murein transglycosylase B [Acinetobacter
           baumannii TCDC-AB0715]
          Length = 378

 Score =  116 bits (291), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 73/200 (36%), Positives = 109/200 (54%), Gaps = 16/200 (8%)

Query: 50  RARAVREGMSPKT----AKHLFADLEYLDTTIARDRKMVTSPPVSFK--DYLDGLSSSEI 103
           R++A+  G+S  T     ++L  D   +D       K+   P  S    DYL GL   E 
Sbjct: 5   RSQAIAAGVSGSTYDRYTQNLTPDYSVID-------KLNYQPEFSTPIWDYLSGLVDEER 57

Query: 104 IAQGIALKKANSRLLINLKKE-YGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDC 162
           +A G   K A  R ++N   + YGVP   ++A+WG+E++FG+  GK PLL  L TL+ + 
Sbjct: 58  VALG-KQKLAQHRDVLNRASQVYGVPAETIVAVWGVESNFGDISGKYPLLQALGTLSCEG 116

Query: 163 RRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDL 221
           RR  +F  +FF  + ++++G ++   L G+  G  G  QF+P    + A+D D DG+ DL
Sbjct: 117 RRQSYFRTEFFATMRILQRGDLTEDQLKGSWAGAFGHTQFMPSTYERLAVDFDGDGRRDL 176

Query: 222 VKSNIDAIASAAKFLAKLGW 241
           V S  DA+AS A FL K GW
Sbjct: 177 VSSTADALASTANFLNKAGW 196


>gi|70732748|ref|YP_262511.1| lytic murein transglycosylase family protein [Pseudomonas
           fluorescens Pf-5]
 gi|68347047|gb|AAY94653.1| lytic murein transglycosylase family protein [Pseudomonas
           fluorescens Pf-5]
          Length = 430

 Score =  116 bits (291), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 110/204 (53%), Gaps = 4/204 (1%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVT-SPPVSFKDYLDGLSS 100
           F +W +A RA A+  G+  +     FA +    + I  DR     S PV   +YL+G  S
Sbjct: 58  FDQWLNAFRAEALGAGIRAEVFDRAFAGVTPDMSVIKADRSQPEFSRPV--WEYLEGALS 115

Query: 101 SEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAY 160
              + +G AL    S +L  +++ YGV    L+A+WG+E++FG+  G   ++ +LATLAY
Sbjct: 116 PVRVRKGQALLVQYSDILQRIEQRYGVDRQALVAVWGMESNFGDFQGNKSVIRSLATLAY 175

Query: 161 DCRRAKFFTEQFFYALDLVKKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKI 219
           + RR  F   Q   AL +++ G I     LG+  G +GQ QF+P     +A+D D DG+ 
Sbjct: 176 EGRRPAFANSQLIAALQIIQHGDIQPEKMLGSWAGAMGQTQFIPTTYNTHAVDFDGDGRR 235

Query: 220 DLVKSNIDAIASAAKFLAKLGWTK 243
           D+  S  DA+AS A +L   GW +
Sbjct: 236 DIWNSPADALASTAHYLQSSGWQQ 259


>gi|269961087|ref|ZP_06175456.1| Membrane-bound lytic murein transglycosylase B [Vibrio harveyi
           1DA3]
 gi|269834306|gb|EEZ88396.1| Membrane-bound lytic murein transglycosylase B [Vibrio harveyi
           1DA3]
          Length = 323

 Score =  116 bits (291), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 65/205 (31%), Positives = 112/205 (54%), Gaps = 2/205 (0%)

Query: 38  TADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDG 97
           ++D F E+ +  RA A  +G+S +     FAD+EY    +  DR       ++  +Y+  
Sbjct: 20  SSDGFDEYLNKLRAEARDKGISEQVISAAFADVEYKPRAVKADRNQ-PEKKLTLDEYIPR 78

Query: 98  LSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLAT 157
                 + Q   L K +   L  +  E+GV P  ++ALWG+E++FG+  G   ++  L+T
Sbjct: 79  AVPEWKVKQAKQLYKEHYAELKRIGDEFGVQPRFIVALWGVESNFGKFTGNFRVIDALST 138

Query: 158 LAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADED 216
           +A++ RR +FF ++   AL ++ +G I      G+  G +GQ QF+P + +++A D + D
Sbjct: 139 MAFEGRREEFFRKETMAALQILDEGHIELENFKGSWAGAMGQCQFMPSSFLRFAADGNGD 198

Query: 217 GKIDLVKSNIDAIASAAKFLAKLGW 241
           GK D+ +S  D  AS A +L+K GW
Sbjct: 199 GKKDIWQSEADVFASTANYLSKSGW 223


>gi|85712694|ref|ZP_01043740.1| Membrane-bound lytic murein transglycosylase [Idiomarina baltica
           OS145]
 gi|85693544|gb|EAQ31496.1| Membrane-bound lytic murein transglycosylase [Idiomarina baltica
           OS145]
          Length = 343

 Score =  116 bits (291), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 67/205 (32%), Positives = 107/205 (52%), Gaps = 2/205 (0%)

Query: 38  TADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDG 97
           T  +F  +    R+ A+ +G +  T    FA ++Y    +  D        ++   YL  
Sbjct: 41  TEQKFQTYVDKLRSEALEQGYTKDTLDRAFAKVKYYQRAVELDNNQ-PEFKLTLDTYLPR 99

Query: 98  LSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLAT 157
                   + +   + +  LL  + K+YGV P  ++ALWG+ET+FG   G   ++S L T
Sbjct: 100 AVPDWKAQKALEKYQEHKALLDEIGKKYGVQPRFIVALWGIETNFGSYTGGFDVVSALTT 159

Query: 158 LAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADED 216
           LA+D RR  FF +Q + AL +++ G I    + G+  G +GQ QF+P + + YA+D D D
Sbjct: 160 LAFDGRREAFFKKQLWQALTIIQDGHIDPEQMKGSWAGAMGQTQFMPSSFMSYAVDYDGD 219

Query: 217 GKIDLVKSNIDAIASAAKFLAKLGW 241
           GK D+  S  D  ASAA +L+ +GW
Sbjct: 220 GKKDIWNSYGDVFASAANYLSSVGW 244


>gi|288958596|ref|YP_003448937.1| lytic murein transglycosylase [Azospirillum sp. B510]
 gi|288910904|dbj|BAI72393.1| lytic murein transglycosylase [Azospirillum sp. B510]
          Length = 425

 Score =  116 bits (291), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 69/213 (32%), Positives = 111/213 (52%), Gaps = 12/213 (5%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFK--DYLDGLS 99
           F EW +A R  A+ +G+ P+T    F  ++  D  +  D    + P  + +   YLD   
Sbjct: 55  FPEWLAALRVEALGQGIRPQTFDRAFQRVKLSDRVVELD---SSQPEFTRQVWQYLDSAV 111

Query: 100 SSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLA 159
           + + +  G    +    LL  + +  GVP  IL+A WG+E+ FG++ G  P++  L TLA
Sbjct: 112 NEKRVQDGRQKLQEQGALLSRISRRTGVPGEILVAFWGVESDFGKSTGNFPVIDALTTLA 171

Query: 160 YDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGK 218
           ++ RRA +F  +   AL ++  G I+   + G+  G +GQ QF+P   ++ A+D D DG 
Sbjct: 172 FEGRRAAYFRSELLAALRILDSGDIAPERMTGSWAGAMGQTQFMPTVFLRNAVDEDGDGH 231

Query: 219 IDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGE 251
            D+  S  D +AS AKF+   GW      +PGE
Sbjct: 232 RDIWGSMPDVLASTAKFVLANGW------RPGE 258


>gi|254515069|ref|ZP_05127130.1| lytic murein transglycosylase [gamma proteobacterium NOR5-3]
 gi|219677312|gb|EED33677.1| lytic murein transglycosylase [gamma proteobacterium NOR5-3]
          Length = 402

 Score =  116 bits (291), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 79/230 (34%), Positives = 122/230 (53%), Gaps = 19/230 (8%)

Query: 52  RAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPV--SFKDYLDGLSSSEIIAQGIA 109
           RA   G+ P   + + A L  ++  I  DRK    P    +F +Y+    +   + +G  
Sbjct: 40  RARSAGVEPALVEQVLASLAPVERVIELDRKQ---PEFVQTFGEYIARRVTDARVKRGRE 96

Query: 110 LKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFT 169
           L   +   L ++ + YGVPP  L+A WGLET++G  +G  P L  LATLA D RR +FF 
Sbjct: 97  LLGTHGAFLDDVLRRYGVPPRYLIAFWGLETNYGSYLGSVPTLDALATLACDQRRGEFFA 156

Query: 170 EQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDA 228
           ++F  AL LV++  +    L G+  G +G  QF+P + ++YA+D D+DG++DL +S  DA
Sbjct: 157 DEFVDALQLVQREALPLERLRGSWAGAVGHTQFMPSSYLRYAVDGDDDGRVDLWQSEADA 216

Query: 229 IASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAAHID 278
           +AS A FL  LGW       PG++       W   ++  +   Y  A +D
Sbjct: 217 LASGANFLRSLGWV------PGQR-------WGRQVSLPEGFPYEFAGLD 253


>gi|193078394|gb|ABO13365.2| putative membrane-bound lytic murein transglycosylase
           [Acinetobacter baumannii ATCC 17978]
          Length = 430

 Score =  116 bits (291), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 77/234 (32%), Positives = 117/234 (50%), Gaps = 17/234 (7%)

Query: 18  MLAQAVTQPKKATTQFICSDT---ADRFGEWKSAARARAVREGMSPKT----AKHLFADL 70
           ++    T    AT     SDT    + F    +  R++A+  G+S  T     ++L  D 
Sbjct: 22  LVINGSTISSNATVPVTNSDTYTPNNNFQSCLANLRSQAIAAGVSGSTYDRYTQNLTPDY 81

Query: 71  EYLDTTIARDRKMVTSPPVSFK--DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVP 128
             +D       K+   P  S    DYL GL   E +A G      +  +L    + YGVP
Sbjct: 82  SVID-------KLNYQPEFSTPIWDYLSGLVDEERVALGKQKLVQHRDVLNRASQVYGVP 134

Query: 129 PGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHA 188
              ++A+WG+E++FG+  GK PLL  L TL+ + RR  +F  +FF  + ++++G ++   
Sbjct: 135 AETIVAVWGVESNFGDISGKYPLLQALGTLSCEGRRQSYFRTEFFATMRILQRGDLTEDQ 194

Query: 189 L-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
           L G+  G  G  QF+P    + A+D D DG+ DLV S  DA+AS A FL K GW
Sbjct: 195 LKGSWAGAFGHTQFMPSTYERLAVDFDGDGRRDLVSSTADALASTANFLNKAGW 248


>gi|261253479|ref|ZP_05946052.1| membrane-bound lytic murein transglycosylase B [Vibrio orientalis
           CIP 102891]
 gi|260936870|gb|EEX92859.1| membrane-bound lytic murein transglycosylase B [Vibrio orientalis
           CIP 102891]
          Length = 321

 Score =  116 bits (291), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 63/202 (31%), Positives = 107/202 (52%), Gaps = 2/202 (0%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F ++    +  A  +G+S +  K  FA++E+    +  D        ++  +Y+      
Sbjct: 24  FEQYIEGLKKEAREKGISEQVVKQAFANVEHKPRAVKADNNQ-PEKRLTLDEYIPRAVPD 82

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             + Q  +L K +   L  + +EYGV P  ++ALWG+E++FG   G  P++  L+T+AYD
Sbjct: 83  WKVKQAKSLYKEHYAELSKIGEEYGVQPRFIVALWGIESNFGRFTGNYPVIDALSTMAYD 142

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR  FF ++   AL ++ +G I      G+  G +GQ QF+P + + +A D + DGK D
Sbjct: 143 GRREAFFRKETMAALQILDEGHIPYEDFKGSWAGAMGQCQFMPSSFLSFAADGNGDGKKD 202

Query: 221 LVKSNIDAIASAAKFLAKLGWT 242
           +  S  D  ASAA +L++ GW 
Sbjct: 203 IWNSEADVFASAANYLSQYGWN 224


>gi|154252387|ref|YP_001413211.1| lytic murein transglycosylase [Parvibaculum lavamentivorans DS-1]
 gi|154156337|gb|ABS63554.1| lytic murein transglycosylase [Parvibaculum lavamentivorans DS-1]
          Length = 427

 Score =  116 bits (290), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 72/227 (31%), Positives = 119/227 (52%), Gaps = 6/227 (2%)

Query: 26  PKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTI-ARDRKMV 84
           P+        S  A  F +W +A R  A++ G++P T       +   +  I A + +  
Sbjct: 39  PRGVPMAPPVSADAPAFADWLTAFREDALKAGIAPATFDRSMKGVRLDEKVIEANESQPE 98

Query: 85  TSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGE 144
            + PV   +YL+G  S   +A G  L   N  LL  ++  YGV   +L+A+WGLE+++G 
Sbjct: 99  FTRPV--WEYLEGALSDTRVATGKRLLAENKALLDRIEARYGVDRHVLVAIWGLESNYGS 156

Query: 145 TMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLP 203
             G   ++ +LATL ++ RR ++   Q   AL +++ G I+   + G+  G +G  QF+P
Sbjct: 157 FQGTMSVVRSLATLGFEGRRVEYGRSQLIAALQIIQNGDIAPERMTGSWAGAMGHTQFIP 216

Query: 204 VNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCA--GYQ 248
                +A+D D DG+ D+  S+ DA+ASAA +L   GW + A  GY+
Sbjct: 217 TTYNAHAVDFDGDGRRDIWNSHADALASAAHYLGNSGWQRGAVWGYE 263


>gi|187477736|ref|YP_785760.1| lytic murein transglycosylase [Bordetella avium 197N]
 gi|115422322|emb|CAJ48846.1| putative lytic murein transglycosylase [Bordetella avium 197N]
          Length = 405

 Score =  116 bits (290), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 60/153 (39%), Positives = 92/153 (60%), Gaps = 1/153 (0%)

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
           DY+ GL  +E I  G       + +L  ++ EYGV P  ++A+WG+E++FG+ +G  PLL
Sbjct: 84  DYMAGLVDAERIDDGRQGLNQWASVLARVEAEYGVDPATVVAVWGVESNFGKNLGGRPLL 143

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAI 211
           ++L+TL+   RR  +F  +F   L +++   +SS  L G+  G  GQ QF+P   ++ A+
Sbjct: 144 TSLSTLSCFGRRQSYFRGEFLATLRIIQDEHVSSDRLKGSWAGAFGQTQFMPSTYLRLAV 203

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGWTKC 244
           D D DG+ DLV S  DA+AS A FL + GW K 
Sbjct: 204 DFDGDGRRDLVDSVPDALASTANFLKRAGWNKA 236


>gi|296387479|ref|ZP_06876954.1| lytic murein transglycosylase [Pseudomonas aeruginosa PAb1]
          Length = 382

 Score =  116 bits (290), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 69/201 (34%), Positives = 109/201 (54%), Gaps = 2/201 (0%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F +W+ A R +A+  G+  +T    FA +E     +  DR         +K YL+G    
Sbjct: 10  FEQWRDAFRQQALAGGIDAQTFDRAFAGVEPDPAVVEADRSQPEFTRPVWK-YLEGALDP 68

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             + QG A    ++R+L  +   Y V    ++A+WG+E+++G  MG   ++ +LATLAY+
Sbjct: 69  LRVRQGQARLAQHARILGEVDARYAVDADAVVAIWGMESNYGSHMGNKNVIRSLATLAYE 128

Query: 162 CRRAKFFTEQFFYALDLVKKG-VISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR +F   Q   AL +++ G V +S  +G+  G +GQ QF+P    +YA+D D DGK D
Sbjct: 129 GRRPEFAHAQLLAALKILQHGDVPASFMIGSWAGAMGQTQFIPTTYNQYAVDFDGDGKRD 188

Query: 221 LVKSNIDAIASAAKFLAKLGW 241
           +  S  DA+AS A +L   GW
Sbjct: 189 IWGSPGDALASTANYLKASGW 209


>gi|313109433|ref|ZP_07795393.1| hypothetical protein PA39016_001790033 [Pseudomonas aeruginosa
           39016]
 gi|310881895|gb|EFQ40489.1| hypothetical protein PA39016_001790033 [Pseudomonas aeruginosa
           39016]
          Length = 448

 Score =  116 bits (290), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 69/201 (34%), Positives = 109/201 (54%), Gaps = 2/201 (0%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F +W+ A R +A+  G+  +T    FA +E     +  DR         +K YL+G    
Sbjct: 76  FEQWRDAFRQQALAGGIDAQTFDRAFAGVEPDPAVVEADRSQPEFTRPVWK-YLEGALDP 134

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             + QG A    ++R+L  +   Y V    ++A+WG+E+++G  MG   ++ +LATLAY+
Sbjct: 135 LRVRQGQARLAQHARILGEVDARYAVDADAVVAIWGMESNYGSHMGNKNVIRSLATLAYE 194

Query: 162 CRRAKFFTEQFFYALDLVKKG-VISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR +F   Q   AL +++ G V +S  +G+  G +GQ QF+P    +YA+D D DGK D
Sbjct: 195 GRRPEFAHAQLLAALKILQHGDVPASFMIGSWAGAMGQTQFIPTTYNQYAVDFDGDGKRD 254

Query: 221 LVKSNIDAIASAAKFLAKLGW 241
           +  S  DA+AS A +L   GW
Sbjct: 255 IWGSPGDALASTANYLKASGW 275


>gi|126728532|ref|ZP_01744348.1| hypothetical protein SSE37_21117 [Sagittula stellata E-37]
 gi|126711497|gb|EBA10547.1| hypothetical protein SSE37_21117 [Sagittula stellata E-37]
          Length = 395

 Score =  115 bits (289), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 70/208 (33%), Positives = 105/208 (50%), Gaps = 16/208 (7%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRK--MVTSPPVSFKDYLDGLS 99
           F  +    + +AV EG  P T    F+ +    + +  DR+  +   P ++F        
Sbjct: 31  FSSFVQGLKDQAVAEGHDPATVNRFFSGISQSQSVLKADRRQGIFQDPFITF-------- 82

Query: 100 SSEIIAQG---IALKKAN--SRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLST 154
           S ++I+Q      L+KA   S +   ++ EYG+ PG+L+A W  ET +G   G     + 
Sbjct: 83  SRKLISQNRLDTGLRKAREWSGVFDRIQSEYGISPGVLLAFWAFETDYGGYQGDFNTANA 142

Query: 155 LATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDA 213
           L TLA+DCRR + F  Q F AL L + G    +   GA  GEIG  Q LP ++++  +D 
Sbjct: 143 LVTLAHDCRRPEIFRPQVFSALTLFEHGDFDPATTTGAWAGEIGMVQMLPKDILENGVDG 202

Query: 214 DEDGKIDLVKSNIDAIASAAKFLAKLGW 241
           D DG + L  S  DA+ S AK L+ LGW
Sbjct: 203 DGDGHVSLKTSPPDALLSGAKMLSHLGW 230


>gi|50086598|ref|YP_048108.1| putative membrane-bound lytic murein transglycosylase
           [Acinetobacter sp. ADP1]
 gi|49532572|emb|CAG70286.1| putative membrane-bound lytic murein transglycosylase
           [Acinetobacter sp. ADP1]
          Length = 431

 Score =  115 bits (289), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 82/257 (31%), Positives = 128/257 (49%), Gaps = 24/257 (9%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKA-----TTQFICSDTA---DRFGEWKSAARAR 52
           M    +LL S    + P  A+ +   K +     TT  I S+ +   D F    +  R++
Sbjct: 1   MRHVPFLLGSYFFFIVPAHAELILNEKTSNGTPMTTPAITSNISPQNDNFQRCIANLRSQ 60

Query: 53  AVREGMSPKT----AKHLFADLEYLDTTIARDRKMVTSPPVSFK--DYLDGLSSSEIIAQ 106
           A+  G++  T     ++L  D   +D       K+   P  S    DYL GL   E +  
Sbjct: 61  AISSGVNESTYDRYTQNLTPDYSVID-------KLNYQPEFSTPIWDYLSGLVDEERVQA 113

Query: 107 GIALKKANSRLLINLKKE-YGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRA 165
           G   K A  R ++N   + YGVP   ++A+WG+E+++G+  GK PLL  L TL+ + RR 
Sbjct: 114 G-RQKMAQYRDVLNRASQAYGVPVETIVAVWGVESNYGDISGKYPLLQALGTLSCEGRRQ 172

Query: 166 KFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKS 224
            +F  +FF  + ++++G +    L G+  G  G  QF+P    + A+D D DG+ DLV S
Sbjct: 173 SYFRGEFFATMRILQRGDLHEDQLKGSWAGAFGHTQFMPSTYERLAVDFDGDGRRDLVSS 232

Query: 225 NIDAIASAAKFLAKLGW 241
             DA+AS A FL + GW
Sbjct: 233 VPDALASTANFLKQAGW 249


>gi|260768982|ref|ZP_05877916.1| membrane-bound lytic murein transglycosylase B [Vibrio furnissii
           CIP 102972]
 gi|260617012|gb|EEX42197.1| membrane-bound lytic murein transglycosylase B [Vibrio furnissii
           CIP 102972]
          Length = 323

 Score =  115 bits (289), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 62/201 (30%), Positives = 113/201 (56%), Gaps = 2/201 (0%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F ++    + +A +EG+S +     F D+++    +  DR       ++  +Y+     +
Sbjct: 24  FEQYVEGLKQQARQEGISEQILSDAFHDVQFKPRAVVADRNQ-PEKKLTLDEYIPRAVPA 82

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             + Q  AL + +   L  + K YGV P  ++ALWG+E++FG  MG+  ++  L+T+AY+
Sbjct: 83  WKVNQAQALYEKHYDELQRIGKAYGVQPRFIVALWGVESNFGAHMGRYKVIDALSTMAYE 142

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR +FF ++   AL ++++G I++  + G+  G +GQ QF+P + + +A D D DGK D
Sbjct: 143 GRREEFFRKETMAALQILQQGHINAEDMKGSWAGAMGQCQFMPSSFLAFAADGDGDGKKD 202

Query: 221 LVKSNIDAIASAAKFLAKLGW 241
           +  S  D  AS A +L++ GW
Sbjct: 203 IWGSKEDVFASTANYLSQSGW 223


>gi|146308805|ref|YP_001189270.1| lytic murein transglycosylase [Pseudomonas mendocina ymp]
 gi|145577006|gb|ABP86538.1| lytic murein transglycosylase [Pseudomonas mendocina ymp]
          Length = 418

 Score =  115 bits (289), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 75/215 (34%), Positives = 119/215 (55%), Gaps = 6/215 (2%)

Query: 32  QFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARD--RKMVTSPPV 89
           Q      A  F +W+ A R+ AV  G+       +FA +    + I  D  +   T P  
Sbjct: 39  QVTAEKPAPSFADWRQALRSEAVAAGIDAALFDRVFAGITPDPSVIKADSSQPEFTRP-- 96

Query: 90  SFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKT 149
              +YLDG  S+  I +G  L   ++ +L  +++ YGV   +L+A+WGLE++FG  +G  
Sbjct: 97  -VWEYLDGAVSASRIGRGRVLLAQHNAVLQRIEQRYGVEAPVLVAIWGLESNFGSNIGGH 155

Query: 150 PLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVK 208
            ++ +L+TLA++ RR  F+  Q   AL +++ G ISS  + G+  G +GQ QF+P    +
Sbjct: 156 SVIRSLSTLAFEGRRQAFWRTQLLAALQILQNGDISSERMIGSWAGAMGQTQFMPTTYNQ 215

Query: 209 YAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTK 243
           +A+D D DGK DL  S+ DA+ASAA +L   GW +
Sbjct: 216 HAVDFDGDGKRDLWNSSSDALASAAHYLQASGWQR 250


>gi|119897628|ref|YP_932841.1| peptidoglycan-binding protein [Azoarcus sp. BH72]
 gi|119670041|emb|CAL93954.1| conserved hypothetical peptidoglycan-binding protein [Azoarcus sp.
           BH72]
          Length = 404

 Score =  115 bits (289), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 61/161 (37%), Positives = 94/161 (58%), Gaps = 3/161 (1%)

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
           DY+  L   E IA G A+ +  S +L  ++ EYGV    ++A+WG+E+++G   G   LL
Sbjct: 83  DYMAALVDDERIADGRAMLEQWSAVLARVEAEYGVDAATVVAVWGVESNYGRNFGSRALL 142

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATF-GEIGQFQFLPVNVVKYAI 211
            +LATLA + RR  FF ++ F  + +V+ G ++   L  ++ G  G  QF+P   ++ A+
Sbjct: 143 PSLATLACNGRRQSFFRQELFATMKIVEDGHVAPERLNGSWAGAFGHTQFMPSTYLRLAV 202

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGWTK--CAGYQPG 250
           D D DG+ DLV S  DA+AS A FL + GW +    GY+ G
Sbjct: 203 DFDGDGRRDLVDSIADALASTANFLRQAGWQRGLAWGYEVG 243


>gi|315180679|gb|ADT87593.1| lytic murein transglycosylase, hypothetical [Vibrio furnissii NCTC
           11218]
          Length = 323

 Score =  115 bits (289), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 62/201 (30%), Positives = 113/201 (56%), Gaps = 2/201 (0%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F ++    + +A +EG+S +     F D+++    +  DR       ++  +Y+     +
Sbjct: 24  FEQYVEGLKQQARQEGISEQILSDAFHDVQFKPRAVVADRNQ-PEKKLTLDEYIPRAVPA 82

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             + Q  AL + +   L  + K YGV P  ++ALWG+E++FG  MG+  ++  L+T+AY+
Sbjct: 83  WKVNQAQALYEKHYDELQRIGKAYGVQPRFIVALWGVESNFGAHMGRYKVIDALSTMAYE 142

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR +FF ++   AL ++++G I++  + G+  G +GQ QF+P + + +A D D DGK D
Sbjct: 143 GRREEFFRKETMAALQILQQGHINAEDMKGSWAGAMGQCQFMPSSFLAFAADGDGDGKKD 202

Query: 221 LVKSNIDAIASAAKFLAKLGW 241
           +  S  D  AS A +L++ GW
Sbjct: 203 IWGSKEDVFASTANYLSQSGW 223


>gi|254229937|ref|ZP_04923340.1| Membrane-bound lytic murein transglycosylase B [Vibrio sp. Ex25]
 gi|262394855|ref|YP_003286709.1| membrane-bound lytic murein transglycosylase B [Vibrio sp. Ex25]
 gi|151937573|gb|EDN56428.1| Membrane-bound lytic murein transglycosylase B [Vibrio sp. Ex25]
 gi|262338449|gb|ACY52244.1| membrane-bound lytic murein transglycosylase B [Vibrio sp. Ex25]
          Length = 323

 Score =  115 bits (289), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 65/212 (30%), Positives = 115/212 (54%), Gaps = 5/212 (2%)

Query: 34  ICSD---TADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVS 90
           +C+    +++ F E+ +  RA A  +G+S +     FA++EY    +  DR       ++
Sbjct: 13  VCTSAFASSEGFDEYLNKLRAEARDKGISEQVISAAFANVEYKPRAVKADRNQ-PEKKLT 71

Query: 91  FKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTP 150
             +Y+        + Q   L K +   L  +  EYGV P  ++ALWG+E++FG+  G   
Sbjct: 72  LDEYIPRAVPEWKVKQARQLYKEHYTELKRIGDEYGVQPRFIVALWGVESNFGKFTGNFK 131

Query: 151 LLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKY 209
           ++  L+T+A++ RR +FF ++   AL ++ +G I      G+  G +GQ QF+P + +++
Sbjct: 132 VIDALSTMAFEGRREEFFRKETMSALQILDQGHIELENFKGSWAGAMGQCQFMPSSFLRF 191

Query: 210 AIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
           A D + DGK D+ +S  D  AS A +L+K GW
Sbjct: 192 AADGNGDGKKDIWQSEADVFASTANYLSKSGW 223


>gi|306844345|ref|ZP_07476937.1| lytic murein transglycosylase [Brucella sp. BO1]
 gi|306275417|gb|EFM57158.1| lytic murein transglycosylase [Brucella sp. BO1]
          Length = 410

 Score =  115 bits (289), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 76/239 (31%), Positives = 117/239 (48%), Gaps = 10/239 (4%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLF-ADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSS 100
           FG+W       A   G+  K    L  A ++     + RDRK  T   ++F ++   L S
Sbjct: 48  FGQWMENLTKEAREAGVGEKGIAELHKASID--QKVLGRDRKQ-TVFNLTFTEFSKRLIS 104

Query: 101 SEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAY 160
              + +G       + +   ++  YGVP  +L A WGLET +G   G    L+ L TL+Y
Sbjct: 105 EARLKKGQENLVKYADVFKKVEDAYGVPGPVLAAFWGLETDYGAIQGDFDTLNALVTLSY 164

Query: 161 DCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
           DCRR   F  Q    L L  +GV+ ++  GA  GEIG  Q LP + ++  +D + DGK+D
Sbjct: 165 DCRRPDLFRPQLIALLKLFDQGVVDANTTGAWAGEIGMMQLLPKDYLERGVDGNGDGKVD 224

Query: 221 LVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKH--WNASLNYN-KTIAYIAAH 276
           L  S  DA+ +A + L++LGW +    QP  +   + K   W  ++  N K  ++ A H
Sbjct: 225 LKNSVPDAMMTAGRMLSELGWKRG---QPWLEEVRLTKDLPWEEAIRTNRKPHSWWAEH 280


>gi|241764631|ref|ZP_04762645.1| lytic murein transglycosylase [Acidovorax delafieldii 2AN]
 gi|241365902|gb|EER60539.1| lytic murein transglycosylase [Acidovorax delafieldii 2AN]
          Length = 387

 Score =  115 bits (289), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 67/204 (32%), Positives = 108/204 (52%), Gaps = 2/204 (0%)

Query: 39  ADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGL 98
           + RF  W +     A   G+   T +  F D+ ++   I  DR         + DYLD  
Sbjct: 17  SQRFARWVADFSTDARAAGIDEATLQSAFHDVRFIARVIELDRAQPEFTRTVW-DYLDRA 75

Query: 99  SSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATL 158
            S++ IA+G          +  +   YGVP  +L+A+WG+E+++G  +G  P +  LATL
Sbjct: 76  LSAQRIARGQDKLLELGPAVDTIAVRYGVPTEVLVAIWGMESNYGSNVGDIPTIDALATL 135

Query: 159 AYDCRRAKFFTEQFFYALDLVK-KGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDG 217
            ++ RR ++   Q   AL +++ + +  +  +G+  G +GQ QFLP N + YA+DAD DG
Sbjct: 136 GFEGRREEWARGQLLAALKILQNRDIDRAQMIGSWAGAMGQTQFLPSNFLAYAVDADGDG 195

Query: 218 KIDLVKSNIDAIASAAKFLAKLGW 241
           + D+  S  D +AS A FLA+ GW
Sbjct: 196 RRDIWGSVPDVMASTANFLARSGW 219


>gi|218531528|ref|YP_002422344.1| lytic murein transglycosylase [Methylobacterium chloromethanicum
           CM4]
 gi|218523831|gb|ACK84416.1| lytic murein transglycosylase [Methylobacterium chloromethanicum
           CM4]
          Length = 393

 Score =  115 bits (289), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 72/195 (36%), Positives = 107/195 (54%), Gaps = 5/195 (2%)

Query: 50  RARAVREGMSPKTAKHLFADLEYLDT-TIARDRKMVT-SPPVSFKDYLDGLSSSEIIAQG 107
           R  A   G+SPKT    FA ++  D   +AR R+    S PV   DYL G  S   I +G
Sbjct: 34  RPDATARGISPKTFDAAFAGVQGPDPDVVARTRRQSEFSRPV--WDYLVGAVSGARITRG 91

Query: 108 IALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKF 167
            A  K  +  L  ++ + GVP  +++A WG+E+ FG + G  P +  LA+LAY   R   
Sbjct: 92  QAQGKRLAASLAAIEAKTGVPRSVVLAFWGVESDFGASAGSLPTVRALASLAYARHRGTL 151

Query: 168 FTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNI 226
           F ++   AL +++ G I  +  +G+  G +GQ QFLP   ++ A+D D DG+ D+ +S  
Sbjct: 152 FRDELLAALQILENGDIEPARMVGSWAGAMGQVQFLPSVYLREAVDFDGDGRRDIWRSEA 211

Query: 227 DAIASAAKFLAKLGW 241
           DA+AS A +L  LGW
Sbjct: 212 DALASIAHYLQSLGW 226


>gi|332307208|ref|YP_004435059.1| lytic murein transglycosylase [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332174537|gb|AEE23791.1| lytic murein transglycosylase [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 331

 Score =  115 bits (288), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 69/248 (27%), Positives = 126/248 (50%), Gaps = 15/248 (6%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSP 60
           ++F   ++ S+L+++ P  AQA               + + F  +  + +  A+ +G   
Sbjct: 4   LAFFILIITSVLLLLEPANAQA-------------DKSQEGFERYIQSFKEEAIVKGYDA 50

Query: 61  KTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLIN 120
                +F D  +    +  D+       ++   YL        + Q + L + +  +L  
Sbjct: 51  SFLDRVFTDATFRQRVVTADKNQ-PERKLTLDTYLATRVPDWKVQQAVDLLRKHKDVLDK 109

Query: 121 LKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVK 180
           ++K++GV    ++ALWG E++FG+ MG+ P++S+L T+AY+ RR   F +Q + ALD+++
Sbjct: 110 VEKKFGVQARFIVALWGNESNFGKIMGEYPVISSLTTMAYEGRRESMFKKQLYAALDILQ 169

Query: 181 KGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKL 239
           +G I+    LG+  G +GQ QF+P + + YA D D D K D+  +  D  AS A FL   
Sbjct: 170 QGHINQEQFLGSWAGAMGQSQFMPTSFLHYAYDFDGDDKKDIWNNPADVFASIANFLKTE 229

Query: 240 GWTKCAGY 247
           GW+  A +
Sbjct: 230 GWSDSATW 237


>gi|163803644|ref|ZP_02197508.1| putative lytic murein transglycosylase [Vibrio sp. AND4]
 gi|159172554|gb|EDP57415.1| putative lytic murein transglycosylase [Vibrio sp. AND4]
          Length = 323

 Score =  115 bits (288), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 64/205 (31%), Positives = 113/205 (55%), Gaps = 2/205 (0%)

Query: 38  TADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDG 97
           ++D F E+ +  RA A  +G+S +     FAD++Y    +  DR       ++  +Y+  
Sbjct: 20  SSDGFDEYLNKLRAEARNKGISEQVISAAFADVQYKPHAVKADRNQ-PEKKLTLDEYIPR 78

Query: 98  LSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLAT 157
                 + Q   L K +   L  +  E+GV P  ++ALWG+E++FG+  G   ++  L+T
Sbjct: 79  AVPKWKVKQAKQLYKEHYAELKRIGDEFGVQPRFIVALWGVESNFGKFTGNYRVIDALST 138

Query: 158 LAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADED 216
           +A++ RR +FF ++   AL ++ +G I   +  G+  G +GQ QF+P + +++A D + D
Sbjct: 139 MAFEGRREEFFRKETMAALQILDEGHIELKNFKGSWAGAMGQCQFMPSSFLRFAADGNGD 198

Query: 217 GKIDLVKSNIDAIASAAKFLAKLGW 241
           GK D+ +S  D  AS A +L+K GW
Sbjct: 199 GKKDIWQSEADVFASTANYLSKSGW 223


>gi|157644758|gb|ABV59087.1| HopAJ2 protein [Pseudomonas syringae pv. averrhoi]
          Length = 445

 Score =  115 bits (288), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 68/205 (33%), Positives = 111/205 (54%), Gaps = 6/205 (2%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKM--VTSPPVSFKDYLDGLS 99
           F EW++  R +A++ G+        FA +    + +  DR     T P     +YLDG  
Sbjct: 70  FSEWQAGFRIQALKAGIRADVFDLAFAGVTPDMSVVKADRSQPEFTRP---IWEYLDGAI 126

Query: 100 SSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLA 159
           S+  + +G AL    +  L  ++++YGV    L+A+WG+E++FG   G   ++ +LATLA
Sbjct: 127 SAARVRKGQALLSQYADDLQKIEQQYGVDRQALVAVWGMESNFGSFQGTQSVIRSLATLA 186

Query: 160 YDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGK 218
           Y+ RR  F   Q   AL++++ G I+    LG+  G +GQ QF+P     +A+D D DG+
Sbjct: 187 YEGRRPGFAQSQLLAALEIIQHGDITPDKMLGSWAGAMGQTQFIPTTYNTHAVDFDGDGR 246

Query: 219 IDLVKSNIDAIASAAKFLAKLGWTK 243
            D+  +  DA+AS A +L   GW +
Sbjct: 247 RDIWNTPADALASTAHYLQSSGWQR 271


>gi|262374693|ref|ZP_06067965.1| lytic murein transglycosylase B [Acinetobacter junii SH205]
 gi|262310349|gb|EEY91441.1| lytic murein transglycosylase B [Acinetobacter junii SH205]
          Length = 430

 Score =  115 bits (288), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 67/199 (33%), Positives = 107/199 (53%), Gaps = 14/199 (7%)

Query: 50  RARAVREGMSPKT----AKHLFADLEYLDTTIARDRKMVTSPPVSFK--DYLDGLSSSEI 103
           R++A+  G+S  T     ++L  D   +D       K+   P  S    DYL GL  +E 
Sbjct: 57  RSQAIASGVSASTYDRYTQNLTPDYSVID-------KLNYQPEFSTPIWDYLSGLVDNER 109

Query: 104 IAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCR 163
           +  G      +  +L  +++ YGVP   ++A+WG+E+++G+  GK PLL  L TL+ + R
Sbjct: 110 VQAGQQKLTQHQDVLRRVEQAYGVPAETVVAVWGVESNYGDISGKYPLLQALGTLSCEGR 169

Query: 164 RAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLV 222
           R  +F  +FF  + ++++G ++   L G+  G  G  QF+P      A+D D DG+ DLV
Sbjct: 170 RQGYFRGEFFATMRILQRGDLTQDQLYGSWAGAFGHTQFMPSTYESLAVDFDGDGRRDLV 229

Query: 223 KSNIDAIASAAKFLAKLGW 241
            S  DA+AS A FL + GW
Sbjct: 230 SSTTDALASTANFLKRAGW 248


>gi|226952806|ref|ZP_03823270.1| membrane-bound lytic murein transglycosylase [Acinetobacter sp.
           ATCC 27244]
 gi|226836427|gb|EEH68810.1| membrane-bound lytic murein transglycosylase [Acinetobacter sp.
           ATCC 27244]
          Length = 432

 Score =  115 bits (288), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 77/255 (30%), Positives = 128/255 (50%), Gaps = 24/255 (9%)

Query: 3   FKKYLLISLLMMVYPMLAQAVTQPKKATTQFIC---------SDTADRFGEWKSAARARA 53
           F  +L  +LL + Y   A+ +    K +T             S T D F    +  R++A
Sbjct: 4   FPLFLGTALLTLSYNAHAELIINGAKVSTTTTTPAVSNTSTFSPTRD-FQSCIAGLRSQA 62

Query: 54  VREGMSP----KTAKHLFADLEYLDTTIARDRKMVTSPPVSFK--DYLDGLSSSEIIAQG 107
           +  G+S     +  ++L AD   +D       ++   P  S    DYL GL  +E +  G
Sbjct: 63  IASGVSAASFDRYTQNLSADYSVID-------RLNYQPEFSTPIWDYLSGLVDNERVQAG 115

Query: 108 IALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKF 167
                 +  +L  +++ YGVP   ++A+WG+E+++G+  G+ PLL  L TL+ + RR  +
Sbjct: 116 QQKLAQHRDVLRRVEQAYGVPAETVVAVWGVESNYGDISGRYPLLQALGTLSCEGRRQSY 175

Query: 168 FTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNI 226
           F  +FF  + ++++G ++   L G+  G  G  QF+P    + A+D D DG+ DLV S  
Sbjct: 176 FRGEFFATMRILQRGDVTQDQLYGSWAGAFGHTQFMPSTYERLAVDFDGDGRRDLVSSIP 235

Query: 227 DAIASAAKFLAKLGW 241
           DA+AS A FL + GW
Sbjct: 236 DALASTANFLKRAGW 250


>gi|269967934|ref|ZP_06181974.1| Membrane-bound lytic murein transglycosylase B [Vibrio
           alginolyticus 40B]
 gi|269827457|gb|EEZ81751.1| Membrane-bound lytic murein transglycosylase B [Vibrio
           alginolyticus 40B]
          Length = 323

 Score =  115 bits (288), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 64/205 (31%), Positives = 112/205 (54%), Gaps = 2/205 (0%)

Query: 38  TADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDG 97
           +++ F E+ +  RA A  +G+S +     FA++EY    +  DR       ++  +Y+  
Sbjct: 20  SSEGFDEYLNKLRAEARDKGISEQVISAAFANVEYKPRAVKADRNQ-PEKKLTLDEYIPR 78

Query: 98  LSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLAT 157
                 + Q   L K +   L  +  EYGV P  ++ALWG+E++FG+  G   ++  L+T
Sbjct: 79  AVPEWKVKQARQLYKEHYTELKRIGDEYGVHPRFIVALWGVESNFGKFTGNFKVIDALST 138

Query: 158 LAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADED 216
           +A++ RR +FF ++   AL ++ +G I      G+  G +GQ QF+P + +++A D + D
Sbjct: 139 MAFEGRREEFFRKETMSALQILDQGHIELENFKGSWAGAMGQCQFMPSSFLRFAADGNGD 198

Query: 217 GKIDLVKSNIDAIASAAKFLAKLGW 241
           GK D+ +S  D  AS A +L+K GW
Sbjct: 199 GKKDIWQSEADVFASTANYLSKSGW 223


>gi|260752474|ref|YP_003225367.1| lytic murein transglycosylase [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
 gi|258551837|gb|ACV74783.1| lytic murein transglycosylase [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
          Length = 361

 Score =  115 bits (288), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 82/260 (31%), Positives = 133/260 (51%), Gaps = 19/260 (7%)

Query: 3   FKKYLLISLLM---MVYPMLAQAVTQ---P-KKATTQFICSDTADR-FGEWKSAARARAV 54
            + Y LI+ +    M +P L+Q+ +    P ++ T   + +  A+R F  + ++ R +A+
Sbjct: 1   MRLYPLITAIFLSGMTFPALSQSSSDMPVPMQEKTAADLNNQEANRDFRNFLASIRPQAL 60

Query: 55  REGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVS-----FKDYLDGLSSSEIIAQGIA 109
             G++ +T   + +DL      I  DR    SP  +     F  Y      +  IA G  
Sbjct: 61  ASGVNAQTFDRIASDLTPNPRVIQLDRNQPESPTANAAIPPFAPYAASHVDAVRIANGRK 120

Query: 110 LKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFT 169
             +A    L  ++KE GVP GI+++++G E+ +G+  G   LL +LATLAYD RR   F 
Sbjct: 121 KYQALQNNLAEIEKETGVPAGIMLSIYGHESGYGQFSGNFDLLRSLATLAYDGRRRDLFV 180

Query: 170 EQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAI 229
           +++  AL ++  G+  S   G+  G  G  QFLP   ++ A+D D DGK ++  S IDA+
Sbjct: 181 QEYIAALKILDSGIDRSLLKGSWAGATGSPQFLPSVYLRVAVDGDHDGKKNIWSSEIDAL 240

Query: 230 ASAAKFLAKLGWTKCAGYQP 249
           AS   +L      K AG+QP
Sbjct: 241 ASIGNYL------KTAGWQP 254


>gi|39937456|ref|NP_949732.1| lytic murein transglycosylase [Rhodopseudomonas palustris CGA009]
 gi|39651315|emb|CAE29837.1| possible transglycolase [Rhodopseudomonas palustris CGA009]
          Length = 452

 Score =  115 bits (287), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 68/204 (33%), Positives = 105/204 (51%), Gaps = 3/204 (1%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F ++ +  + +AV  G+S          L Y    + RDR       + F  +   ++S 
Sbjct: 51  FPQFLAGLKQKAVAAGVSQGAIAEASPYLVYDQGIVNRDRGQRVFGQI-FTVFAGRMASE 109

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
               +G  L K  +      +KEYGVPP ++ A W LE+ FG   G  P L +L +LAYD
Sbjct: 110 GRRVKGQQLIKQYANAFARAEKEYGVPPAVITAFWALESDFGAVQGNLPTLRSLVSLAYD 169

Query: 162 CRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
           CRR++ F ++   AL ++ +G ++    +G+  GE+GQ QFLP +   YA+D D DG  D
Sbjct: 170 CRRSEMFQDETIAALKIIDRGDLTPGEMIGSWAGELGQTQFLPRHYFDYAVDYDGDGHRD 229

Query: 221 LVKSNIDAIASAAKFLAK-LGWTK 243
           L+ S  D I S A ++A  L W +
Sbjct: 230 LLHSAPDVIGSTANYIATGLKWRR 253


>gi|84687917|ref|ZP_01015783.1| Membrane-bound lytic murein transglycosylase B [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84664054|gb|EAQ10552.1| Membrane-bound lytic murein transglycosylase B [Rhodobacterales
           bacterium HTCC2654]
          Length = 439

 Score =  115 bits (287), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 75/255 (29%), Positives = 124/255 (48%), Gaps = 20/255 (7%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F +W  + + +A   G+S       F    Y+   I RDR   T    + +DYL   +S 
Sbjct: 66  FDDWVVSFKNQAEGRGISRSVLDTAFRGAGYIPGVIERDRNQ-TEFTRTLEDYLAIAASD 124

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
           E ++ G A  ++ +  L +++  Y V   ++ A+WG+E+ +G   G TP++S +ATL+Y 
Sbjct: 125 ERVSNGRANYRSFASTLNSVESTYEVEGKVVAAVWGMESSYGTRRGDTPIVSAMATLSYA 184

Query: 162 CRRAKFFTEQFFYALDLVKKG-VISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR +FFT+Q +  L ++  G       +G+  G +G  QF+P + + YA+D   DG+ D
Sbjct: 185 GRRQEFFTQQLYAVLKILANGDTTPDRMVGSWAGAMGHTQFMPTSYLSYAVDHTGDGRRD 244

Query: 221 LVKSN-IDAIASAAKFLAKLGWTKCAGY-------------QPGEKNFAILKHWNA---- 262
           +   +  DA+ASAA +L + GW K   +             Q G  N   +  W A    
Sbjct: 245 IWSDDPTDALASAANYLKRHGWQKGQPWGVEVRLPQGFDRAQAGFSNSRSVDSWTAMGVR 304

Query: 263 SLNYNKTIAYIAAHI 277
            +N N    Y AA +
Sbjct: 305 DMNGNAVGNYGAARV 319


>gi|83859898|ref|ZP_00953418.1| membrane-bound lytic murein transglycosylase, putative
           [Oceanicaulis alexandrii HTCC2633]
 gi|83852257|gb|EAP90111.1| membrane-bound lytic murein transglycosylase, putative
           [Oceanicaulis alexandrii HTCC2633]
          Length = 402

 Score =  115 bits (287), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 68/208 (32%), Positives = 104/208 (50%), Gaps = 8/208 (3%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFK---DYLDGL 98
           F +W S  R R    G  P T   +   LE     I RDR    S P   +    YL+G 
Sbjct: 29  FEDWASGFRDRLAEHGAEPATIALMMDGLEPDSRIIDRDR----SQPEFVRPVWQYLEGA 84

Query: 99  SSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATL 158
           +S      G++ +  +   L  ++ ++GV   IL A+WGLE+ +G   G   ++ +LATL
Sbjct: 85  ASDARTQNGLSAQATHGEALETVESQFGVDADILTAIWGLESAYGVIQGDFDIVRSLATL 144

Query: 159 AYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDG 217
           A++ RR +F   Q F   D++++G      L G+  G +GQ QF+P   ++ A+D   DG
Sbjct: 145 AWEGRRRQFAENQLFAVADMIERGYADRDQLKGSWAGAMGQTQFIPTTYMERAVDIHGDG 204

Query: 218 KIDLVKSNIDAIASAAKFLAKLGWTKCA 245
             D+  +  DA+ SAA  LA+ GW   A
Sbjct: 205 HRDIWTTEADALGSAANLLARAGWQTGA 232


>gi|167856178|ref|ZP_02478916.1| membrane-bound lytic murein transglycosylase B [Haemophilus
           parasuis 29755]
 gi|167852700|gb|EDS23976.1| membrane-bound lytic murein transglycosylase B [Haemophilus
           parasuis 29755]
          Length = 351

 Score =  115 bits (287), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 81/127 (63%), Gaps = 1/127 (0%)

Query: 118 LINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALD 177
           L    ++YGV    LMALWG+E+ FG   G   +LS LATLA+D RR K FT++F  A+ 
Sbjct: 120 LTKASQKYGVQKEYLMALWGMESSFGRYQGNFDVLSVLATLAFDGRREKLFTQEFVNAMK 179

Query: 178 LVKKG-VISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFL 236
           ++++G ++ +   G+  G +GQ QF+P + + YA D D DG+ D+ K+  DA AS A +L
Sbjct: 180 MLQQGTLVRAEMKGSWAGAMGQTQFMPTSYLNYAADGDNDGRKDIWKNQYDAFASIANYL 239

Query: 237 AKLGWTK 243
           A +GW K
Sbjct: 240 ATVGWDK 246


>gi|239832326|ref|ZP_04680655.1| lytic murein transglycosylase [Ochrobactrum intermedium LMG 3301]
 gi|239824593|gb|EEQ96161.1| lytic murein transglycosylase [Ochrobactrum intermedium LMG 3301]
          Length = 411

 Score =  115 bits (287), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 78/239 (32%), Positives = 116/239 (48%), Gaps = 10/239 (4%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLF-ADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSS 100
           FG+W       A   G+  K    L  A LE     + RDRK  T   ++F ++   L S
Sbjct: 49  FGQWMDNLTKEARDAGVGEKGIAELHKAMLEQ--KVLDRDRKQ-TVFNLTFTEFSKRLIS 105

Query: 101 SEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAY 160
              + +G       + +   ++  YGVP  +L A WGLET +G   G    L+ L TL+Y
Sbjct: 106 EARLKKGRDNLVKYADVFKKVEDTYGVPGPVLAAFWGLETDYGAIQGDFDTLNALVTLSY 165

Query: 161 DCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
           DCRR   F  Q    L L  +GV+ +   GA  GEIG  Q LP + ++  +D D DGK+D
Sbjct: 166 DCRRPDLFRPQLIALLKLFDQGVVDAATTGAWAGEIGMMQLLPKDYLERGVDGDGDGKVD 225

Query: 221 LVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKH--WNASLNYN-KTIAYIAAH 276
           L  S  DA+ +A + +++LGW +    QP  +   + K   W  ++  N K  ++ A H
Sbjct: 226 LKNSVPDAMMTAGRMISELGWKRG---QPWLEEVRLTKDLPWEEAIRTNRKPHSWWAEH 281


>gi|92116671|ref|YP_576400.1| lytic murein transglycosylase [Nitrobacter hamburgensis X14]
 gi|91799565|gb|ABE61940.1| Lytic murein transglycosylase [Nitrobacter hamburgensis X14]
          Length = 434

 Score =  115 bits (287), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 59/155 (38%), Positives = 90/155 (58%), Gaps = 2/155 (1%)

Query: 91  FKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTP 150
           F  +   ++S     +G  L K +++     +K+YGVP  ++ A W LE+ FG   GK  
Sbjct: 86  FTQFAGRMASEARRVRGQKLIKQHAQAFARAEKQYGVPAAVITAFWALESDFGAVQGKLS 145

Query: 151 LLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKY 209
            L +L +LAYDCRRA+ F ++   AL +V +G ++ S  +G+  GE+GQ QFLP +   Y
Sbjct: 146 TLRSLVSLAYDCRRAEMFHDETIAALKIVDRGDLTPSEMIGSWAGELGQTQFLPRHYYDY 205

Query: 210 AIDADEDGKIDLVKSNIDAIASAAKFLAK-LGWTK 243
           A+D D DG+ DL+ S  D I S A ++A  L W +
Sbjct: 206 AVDYDGDGRRDLIHSAADVIGSTANYIATGLKWKR 240


>gi|91227771|ref|ZP_01261998.1| putative lytic murein transglycosylase [Vibrio alginolyticus 12G01]
 gi|91188418|gb|EAS74713.1| putative lytic murein transglycosylase [Vibrio alginolyticus 12G01]
          Length = 300

 Score =  115 bits (287), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 64/205 (31%), Positives = 112/205 (54%), Gaps = 2/205 (0%)

Query: 38  TADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDG 97
           +++ F E+ +  RA A  +G+S +     FA++EY    +  DR       ++  +Y+  
Sbjct: 20  SSEGFDEYLNKLRAEARDKGISEQVISAAFANVEYKPRAVKADRNQ-PEKKLTLDEYIPR 78

Query: 98  LSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLAT 157
                 + Q   L K +   L  +  EYGV P  ++ALWG+E++FG+  G   ++  L+T
Sbjct: 79  AVPEWKVKQARQLYKEHYTELKRIGDEYGVHPRFIVALWGVESNFGKFTGNFKVIDALST 138

Query: 158 LAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADED 216
           +A++ RR +FF ++   AL ++ +G I      G+  G +GQ QF+P + +++A D + D
Sbjct: 139 MAFEGRREEFFRKETMSALQILDQGHIELENFKGSWAGAMGQCQFMPSSFLRFAADGNGD 198

Query: 217 GKIDLVKSNIDAIASAAKFLAKLGW 241
           GK D+ +S  D  AS A +L+K GW
Sbjct: 199 GKKDIWQSEADVFASTANYLSKSGW 223


>gi|254242677|ref|ZP_04935999.1| hypothetical protein PA2G_03440 [Pseudomonas aeruginosa 2192]
 gi|126196055|gb|EAZ60118.1| hypothetical protein PA2G_03440 [Pseudomonas aeruginosa 2192]
          Length = 448

 Score =  115 bits (287), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 68/201 (33%), Positives = 109/201 (54%), Gaps = 2/201 (0%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F +W+ A R +A+  G+  +T    FA ++     +  DR         +K YL+G    
Sbjct: 76  FEQWRDAFRQQALAGGIDAQTFDRAFAGVQPDPAVVEADRSQPEFTRPVWK-YLEGALDP 134

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             + QG A    ++R+L  +   Y V    ++A+WG+E+++G  MG   ++ +LATLAY+
Sbjct: 135 LRVRQGQARLAQHARILGEVDARYAVDADAVVAIWGMESNYGSHMGNKNVIRSLATLAYE 194

Query: 162 CRRAKFFTEQFFYALDLVKKG-VISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR +F   Q   AL +++ G V +S  +G+  G +GQ QF+P    +YA+D D DGK D
Sbjct: 195 GRRPEFAHAQLLAALKILQHGDVPASFMIGSWAGAMGQTQFIPTTYNQYAVDFDGDGKRD 254

Query: 221 LVKSNIDAIASAAKFLAKLGW 241
           +  S  DA+AS A +L   GW
Sbjct: 255 IWGSPGDALASTANYLKASGW 275


>gi|218889726|ref|YP_002438590.1| putative murein transglycosylase [Pseudomonas aeruginosa LESB58]
 gi|218769949|emb|CAW25710.1| putative murein transglycosylase [Pseudomonas aeruginosa LESB58]
          Length = 448

 Score =  115 bits (287), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 68/201 (33%), Positives = 109/201 (54%), Gaps = 2/201 (0%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F +W+ A R +A+  G+  +T    FA ++     +  DR         +K YL+G    
Sbjct: 76  FEQWRDAFRQQALAGGIDAQTFDRAFAGVQPDPAVVEADRSQPEFTRPVWK-YLEGALDP 134

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             + QG A    ++R+L  +   Y V    ++A+WG+E+++G  MG   ++ +LATLAY+
Sbjct: 135 LRVRQGQARLAQHARILGEVDARYAVDADAVVAIWGMESNYGSHMGNKNVIRSLATLAYE 194

Query: 162 CRRAKFFTEQFFYALDLVKKG-VISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR +F   Q   AL +++ G V +S  +G+  G +GQ QF+P    +YA+D D DGK D
Sbjct: 195 GRRPEFAHAQLLAALKILQHGDVPASFMIGSWAGAMGQTQFIPTTYNQYAVDFDGDGKRD 254

Query: 221 LVKSNIDAIASAAKFLAKLGW 241
           +  S  DA+AS A +L   GW
Sbjct: 255 IWGSPGDALASTANYLKASGW 275


>gi|116052030|ref|YP_789126.1| putative murein transglycosylase [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|254236884|ref|ZP_04930207.1| hypothetical protein PACG_02905 [Pseudomonas aeruginosa C3719]
 gi|115587251|gb|ABJ13266.1| putative murein transglycosylase [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|126168815|gb|EAZ54326.1| hypothetical protein PACG_02905 [Pseudomonas aeruginosa C3719]
          Length = 448

 Score =  115 bits (287), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 68/201 (33%), Positives = 109/201 (54%), Gaps = 2/201 (0%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F +W+ A R +A+  G+  +T    FA ++     +  DR         +K YL+G    
Sbjct: 76  FEQWRDAFRQQALAGGIDAQTFDRAFAGVQPDPAVVEADRSQPEFTRPVWK-YLEGALDP 134

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             + QG A    ++R+L  +   Y V    ++A+WG+E+++G  MG   ++ +LATLAY+
Sbjct: 135 LRVRQGQARLAQHARILGEVDARYAVDADAVVAIWGMESNYGSHMGNKNVIRSLATLAYE 194

Query: 162 CRRAKFFTEQFFYALDLVKKG-VISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR +F   Q   AL +++ G V +S  +G+  G +GQ QF+P    +YA+D D DGK D
Sbjct: 195 GRRPEFAHAQLLAALKILQHGDVPASFMIGSWAGAMGQTQFIPTTYNQYAVDFDGDGKRD 254

Query: 221 LVKSNIDAIASAAKFLAKLGW 241
           +  S  DA+AS A +L   GW
Sbjct: 255 IWGSPGDALASTANYLKASGW 275


>gi|15965950|ref|NP_386303.1| putative transglycosylase transmembrane protein [Sinorhizobium
           meliloti 1021]
 gi|307308261|ref|ZP_07587970.1| lytic murein transglycosylase [Sinorhizobium meliloti BL225C]
 gi|15075219|emb|CAC46776.1| Membrane-bound lytic murein transglycosylase B [Sinorhizobium
           meliloti 1021]
 gi|306901259|gb|EFN31865.1| lytic murein transglycosylase [Sinorhizobium meliloti BL225C]
          Length = 405

 Score =  115 bits (287), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 83/299 (27%), Positives = 120/299 (40%), Gaps = 61/299 (20%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
            G +    +A AV +G+    A    A        ++RDR        +F ++     S 
Sbjct: 41  LGSFLEGVKAEAVAKGIPADVADRALAGAAIDQKVLSRDRAQGVFK-QTFTEFSKRTVSK 99

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             +  G    +  + +    ++E+GVP  ++ A W +ET FG   G       L TLA+D
Sbjct: 100 SRLDIGAQKMREYADVFARAEQEFGVPAPVITAFWAMETDFGAVQGDFNTRDALVTLAHD 159

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
           CRR + F  Q   A+++V+ G +   A  GA  GEIGQ Q LP +++ Y +D D DG ++
Sbjct: 160 CRRPEMFRPQLLAAIEMVQHGDLDPAATTGAWAGEIGQVQMLPEDIIAYGVDGDGDGHVN 219

Query: 221 LVKSNIDAIASAAKFLAKLG------------------WTKCAGYQPGE----------- 251
           L KS+ DAI +AAKF+  LG                  W K  G QPG            
Sbjct: 220 LKKSSPDAILTAAKFIQSLGFKPGEPWIQEVRVPEQLPWEKT-GLQPGMTAGDWFALGVA 278

Query: 252 -----------------------------KNFAILKHWNASLNYNKTIAYIAAHIDGVP 281
                                         NF I   WN S  Y  + AY A  + G P
Sbjct: 279 PRDGNTSNSGLEASLVLPQGRKGAAFLTYPNFKIYLEWNQSFIYTTSAAYFATRLAGAP 337


>gi|325123472|gb|ADY82995.1| transglycosylase, putative [Acinetobacter calcoaceticus PHEA-2]
          Length = 393

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 72/200 (36%), Positives = 108/200 (54%), Gaps = 16/200 (8%)

Query: 50  RARAVREGMSPKT----AKHLFADLEYLDTTIARDRKMVTSPPVSFK--DYLDGLSSSEI 103
           R++A+  G+S  T     ++L  D   +D       K+   P  S    DYL GL   E 
Sbjct: 20  RSQAIAAGVSGTTYDRYTQNLTPDYSVID-------KLNYQPEFSTPIWDYLSGLVDEER 72

Query: 104 IAQGIALKKANSRLLINLKKE-YGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDC 162
           +  G   K A  R ++N   + YGVP   ++A+WG+E++FG+  GK PLL  L TL+ + 
Sbjct: 73  VELG-KQKLAQHRDVLNRASQTYGVPLETIVAVWGVESNFGDISGKYPLLQALGTLSCEG 131

Query: 163 RRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDL 221
           RR  +F  +FF  + ++++G ++   L G+  G  G  QF+P    + A+D D DG+ DL
Sbjct: 132 RRQNYFRTEFFATMRILQRGDLTEDQLKGSWAGAFGHTQFMPSTYERLAVDFDGDGRRDL 191

Query: 222 VKSNIDAIASAAKFLAKLGW 241
           V S  DA+AS A FL K GW
Sbjct: 192 VSSTADALASTANFLNKAGW 211


>gi|258626492|ref|ZP_05721332.1| Membrane-bound lytic murein transglycosylase B [Vibrio mimicus
           VM603]
 gi|262165279|ref|ZP_06033016.1| membrane-bound lytic murein transglycosylase B [Vibrio mimicus
           VM223]
 gi|262171055|ref|ZP_06038733.1| membrane-bound lytic murein transglycosylase B [Vibrio mimicus
           MB-451]
 gi|258581203|gb|EEW06112.1| Membrane-bound lytic murein transglycosylase B [Vibrio mimicus
           VM603]
 gi|261892131|gb|EEY38117.1| membrane-bound lytic murein transglycosylase B [Vibrio mimicus
           MB-451]
 gi|262024995|gb|EEY43663.1| membrane-bound lytic murein transglycosylase B [Vibrio mimicus
           VM223]
          Length = 323

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 72/240 (30%), Positives = 123/240 (51%), Gaps = 20/240 (8%)

Query: 4   KKYLLISL-LMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKT 62
           KK L I L L +  P+LA  V+                 F ++    + +A  EG+S + 
Sbjct: 2   KKLLSIVLGLTLSAPVLANEVS-----------------FEQYVERLKQQAREEGISERI 44

Query: 63  AKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLK 122
               F D+EY    +  D+       ++  +Y+        + Q  +L + +   L  + 
Sbjct: 45  LSEAFRDVEYKPRAVVADKNQ-PEKKLTLDEYIPRAVPEWKVKQAQSLYEKHYDELQRIG 103

Query: 123 KEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKG 182
           K+YGV P  ++ALWG+E++FG   G   ++  L+TLAY+ RR +FF ++   AL ++++G
Sbjct: 104 KQYGVQPRFIVALWGVESNFGALTGNFRVIDALSTLAYEGRREEFFRKETMAALQILEQG 163

Query: 183 VISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
            I+  A+ G+  G +GQ QF+P + + +A D D DGK D+  +  D  AS A +L++ GW
Sbjct: 164 HIAPEAMKGSWAGAMGQCQFMPSSFLNFAADGDGDGKKDIWGTRSDVFASTANYLSQSGW 223


>gi|28897650|ref|NP_797255.1| putative lytic murein transglycosylase [Vibrio parahaemolyticus
           RIMD 2210633]
 gi|260364581|ref|ZP_05777190.1| membrane-bound lytic murein transglycosylase B [Vibrio
           parahaemolyticus K5030]
 gi|260876452|ref|ZP_05888807.1| membrane-bound lytic murein transglycosylase B [Vibrio
           parahaemolyticus AN-5034]
 gi|260895876|ref|ZP_05904372.1| membrane-bound lytic murein transglycosylase B [Vibrio
           parahaemolyticus Peru-466]
 gi|260902774|ref|ZP_05911169.1| membrane-bound lytic murein transglycosylase B [Vibrio
           parahaemolyticus AQ4037]
 gi|28805863|dbj|BAC59139.1| putative lytic murein transglycosylase [Vibrio parahaemolyticus
           RIMD 2210633]
 gi|308086781|gb|EFO36476.1| membrane-bound lytic murein transglycosylase B [Vibrio
           parahaemolyticus Peru-466]
 gi|308092793|gb|EFO42488.1| membrane-bound lytic murein transglycosylase B [Vibrio
           parahaemolyticus AN-5034]
 gi|308108635|gb|EFO46175.1| membrane-bound lytic murein transglycosylase B [Vibrio
           parahaemolyticus AQ4037]
 gi|308115359|gb|EFO52899.1| membrane-bound lytic murein transglycosylase B [Vibrio
           parahaemolyticus K5030]
 gi|328473368|gb|EGF44216.1| putative lytic murein transglycosylase [Vibrio parahaemolyticus
           10329]
          Length = 323

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 64/212 (30%), Positives = 116/212 (54%), Gaps = 5/212 (2%)

Query: 34  ICSD---TADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVS 90
           +C+    +++ F E+    RA A  +G+S +     FA++EY    +  DR       ++
Sbjct: 13  VCTSAFASSEGFEEYLDKLRAEARNQGISEQVISAAFANVEYKPRAVTADRNQ-PEKKLT 71

Query: 91  FKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTP 150
             +Y+        + Q  AL K +   L  +  +YGV P  ++ALWG+E++FG+  G   
Sbjct: 72  LDEYIPRAVPEWKVKQAKALYKEHYAELKRIGDQYGVQPRFIVALWGVESNFGKFTGNFR 131

Query: 151 LLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKY 209
           ++  L+T+A++ RR +FF ++   AL ++ +G I   +  G+  G +GQ QF+P + +++
Sbjct: 132 VIDALSTMAFEGRREEFFRKETMAALQILDQGHIELDNFKGSWAGAMGQCQFMPSSFLRF 191

Query: 210 AIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
           A D + DGK D+ +S  D  AS A +L++ GW
Sbjct: 192 AADGNGDGKKDIWQSEADVFASTANYLSESGW 223


>gi|107103508|ref|ZP_01367426.1| hypothetical protein PaerPA_01004578 [Pseudomonas aeruginosa PACS2]
          Length = 448

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 68/201 (33%), Positives = 109/201 (54%), Gaps = 2/201 (0%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F +W+ A R +A+  G+  +T    FA ++     +  DR         +K YL+G    
Sbjct: 76  FEQWRDAFRQQALAGGIDAQTFDRAFAGVQPDPAVVEADRSQPEFTRPVWK-YLEGALDP 134

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             + QG A    ++R+L  +   Y V    ++A+WG+E+++G  MG   ++ +LATLAY+
Sbjct: 135 LRVRQGQARLAQHARILGEVDARYAVDADAVVAIWGMESNYGSHMGNKNVIRSLATLAYE 194

Query: 162 CRRAKFFTEQFFYALDLVKKG-VISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR +F   Q   AL +++ G V +S  +G+  G +GQ QF+P    +YA+D D DGK D
Sbjct: 195 GRRPEFAHAQLLAALKILQHGDVPASFMIGSWAGAMGQTQFIPTTYNQYAVDFDGDGKRD 254

Query: 221 LVKSNIDAIASAAKFLAKLGW 241
           +  S  DA+AS A +L   GW
Sbjct: 255 IWGSPGDALASTASYLKASGW 275


>gi|260464330|ref|ZP_05812522.1| lytic murein transglycosylase [Mesorhizobium opportunistum WSM2075]
 gi|259029954|gb|EEW31238.1| lytic murein transglycosylase [Mesorhizobium opportunistum WSM2075]
          Length = 392

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 68/210 (32%), Positives = 102/210 (48%), Gaps = 2/210 (0%)

Query: 34  ICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKD 93
           +  +    F  WK    A A   G+ P     L  D  + +  +ARDR        +F  
Sbjct: 21  VAQECGGDFETWKQGVAAEAKAAGVGPVGLDAL-EDANFDERALARDRAQGVFT-QTFVQ 78

Query: 94  YLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLS 153
           + + + S+  + QG A  K  + +     +++GV   ++ A W LET FG   G    LS
Sbjct: 79  FSNRMISAYRLKQGAANMKKYADIFARADQQFGVQAPVITAFWALETDFGAVQGDFHTLS 138

Query: 154 TLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDA 213
            L TL++DCRR + F +Q    L+L+ +GV+ +   GA  GEIGQ Q LP + +   +D 
Sbjct: 139 ALVTLSHDCRRPQLFRQQLVPLLELIDRGVLPADVTGAWAGEIGQTQILPSDYLARGVDG 198

Query: 214 DEDGKIDLVKSNIDAIASAAKFLAKLGWTK 243
           D DGKIDL  S  D I + A  +   GW +
Sbjct: 199 DGDGKIDLRGSVPDVIMTTANKVLSRGWKR 228


>gi|86751309|ref|YP_487805.1| lytic murein transglycosylase [Rhodopseudomonas palustris HaA2]
 gi|86574337|gb|ABD08894.1| Lytic murein transglycosylase [Rhodopseudomonas palustris HaA2]
          Length = 458

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 66/204 (32%), Positives = 109/204 (53%), Gaps = 3/204 (1%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F ++ +  + +AV  G+S +        L Y    + RDR       + F  +   ++S 
Sbjct: 52  FDQFLAGLKQQAVAAGVSQRAIAQASPYLVYDQGIVNRDRGQRVFGQI-FTVFAGRMASE 110

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
               +G  + K +++     +KEYGVPP ++ A W LE+ FG   G    L +L +LAYD
Sbjct: 111 GRRVKGQQMIKQHAQAFARAEKEYGVPPAVIAAFWALESDFGAVQGNLSTLRSLVSLAYD 170

Query: 162 CRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
           CRR++ F ++   AL +V +G ++ +  +G+  GE+GQ QFLP +   YA+D D DG  D
Sbjct: 171 CRRSEKFQQETIAALKIVDRGDLAPAEMIGSWAGELGQTQFLPRHYYDYAVDYDGDGHRD 230

Query: 221 LVKSNIDAIASAAKFLAK-LGWTK 243
           +++S  D I S A ++A  L W +
Sbjct: 231 MLRSPADVIGSTAHYIAAGLKWRR 254


>gi|163795503|ref|ZP_02189469.1| Membrane-bound lytic murein transglycosylase B [alpha
           proteobacterium BAL199]
 gi|159179102|gb|EDP63635.1| Membrane-bound lytic murein transglycosylase B [alpha
           proteobacterium BAL199]
          Length = 333

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 65/201 (32%), Positives = 112/201 (55%), Gaps = 2/201 (0%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F +W +  R  A   G+S +T    FA +  +   I  DR       + F +Y+D + + 
Sbjct: 35  FDQWLAGVRTEAKGRGVSDRTLDAAFAGVAPIPRVIELDRNQ-PEFRLKFDEYMDRVVTQ 93

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             I +   L   + +LL  ++ +Y V    ++ALWG+E+ FG   G  P++++LATLAYD
Sbjct: 94  TRIDRARRLLAEHGQLLDEVEAKYRVQKRFIVALWGIESDFGRITGGFPVIASLATLAYD 153

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR+ FF ++   AL+++++G I+   + G+  G +GQ QF+P +  ++A+D + DG  D
Sbjct: 154 GRRSTFFRKELMLALEILEQGHIAPADMKGSWAGAMGQNQFMPSSFHRFAVDHNGDGHKD 213

Query: 221 LVKSNIDAIASAAKFLAKLGW 241
           +  S  D  AS A++L+  GW
Sbjct: 214 IWNSLPDVFASIARYLSGSGW 234


>gi|153837957|ref|ZP_01990624.1| membrane-bound lytic murein transglycosylase B [Vibrio
           parahaemolyticus AQ3810]
 gi|149748648|gb|EDM59507.1| membrane-bound lytic murein transglycosylase B [Vibrio
           parahaemolyticus AQ3810]
          Length = 323

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 64/212 (30%), Positives = 116/212 (54%), Gaps = 5/212 (2%)

Query: 34  ICSD---TADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVS 90
           +C+    +++ F E+    RA A  +G+S +     FA++EY    +  DR       ++
Sbjct: 13  VCTSAFASSEGFEEYLDKLRAEARNQGISEQVISAAFANVEYKPRAVTADRNQ-PEKKLT 71

Query: 91  FKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTP 150
             +Y+        + Q  AL K +   L  +  +YGV P  ++ALWG+E++FG+  G   
Sbjct: 72  LDEYIPRAVPEWKVKQAKALYKEHYAELKRIGDQYGVQPRFIVALWGVESNFGKFTGNFR 131

Query: 151 LLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKY 209
           ++  L+T+A++ RR +FF ++   AL ++ +G I   +  G+  G +GQ QF+P + +++
Sbjct: 132 VIDALSTMAFEGRREEFFRKETMAALQILDQGHIELDNFKGSWAGAMGQCQFMPSSFLRF 191

Query: 210 AIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
           A D + DGK D+ +S  D  AS A +L++ GW
Sbjct: 192 AADGNGDGKKDIWQSEADVFASTANYLSESGW 223


>gi|217970121|ref|YP_002355355.1| lytic murein transglycosylase [Thauera sp. MZ1T]
 gi|217507448|gb|ACK54459.1| lytic murein transglycosylase [Thauera sp. MZ1T]
          Length = 400

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 91/150 (60%), Gaps = 1/150 (0%)

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
           DYL  L   E +A G A+    + +L  +++ YGV    ++A+WG+E+++G   G  PLL
Sbjct: 78  DYLAALVDEERVADGRAMLTQWNEVLAEVERRYGVDAETVVAVWGVESNYGRNFGSRPLL 137

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAI 211
           ++L+TL+   RR  FF  +FF  L ++++G ++   L G+  G  G  QF+P   ++ A+
Sbjct: 138 TSLSTLSCFGRRQAFFRGEFFTTLKILQEGHVAPERLTGSWAGAFGHTQFMPSTFMRLAV 197

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
           D D DG+ DL+ S  DA+AS A FLA+ GW
Sbjct: 198 DFDGDGRRDLIDSVPDALASTANFLARAGW 227


>gi|148559504|ref|YP_001259339.1| putative peptidoglycan-binding protein [Brucella ovis ATCC 25840]
 gi|148370761|gb|ABQ60740.1| putative peptidoglycan-binding protein [Brucella ovis ATCC 25840]
          Length = 372

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 76/239 (31%), Positives = 116/239 (48%), Gaps = 10/239 (4%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLF-ADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSS 100
           FG+W       A   G+  K    L  A ++     + RDRK  T   ++F ++   L S
Sbjct: 10  FGQWMENLTREAREAGVGEKGIAELHKASID--QKVLGRDRKQ-TVFNLTFTEFSKRLIS 66

Query: 101 SEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAY 160
              + +G       + +   ++  YGVP  +L A W LET +G   G    L+ L TL+Y
Sbjct: 67  EARLKKGQENLVKYADVFKKVEDAYGVPGPVLAAFWRLETDYGAIQGDFDTLNALVTLSY 126

Query: 161 DCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
           DCRR   F  Q    L L  +GV+ ++  GA  GEIG  Q LP + ++  +D D DGK+D
Sbjct: 127 DCRRPDLFRPQLIALLKLFDQGVVDANTTGAWAGEIGMMQLLPKDYLERGVDGDGDGKVD 186

Query: 221 LVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKH--WNASLNYN-KTIAYIAAH 276
           L  S  DA+ +A + L++LGW +    QP  +   + K   W  ++  N K  ++ A H
Sbjct: 187 LKNSVPDAMMTAGRMLSELGWKRG---QPWLEEVRLTKDLPWEEAIRTNRKPHSWWAEH 242


>gi|254562448|ref|YP_003069543.1| membrane bound lytic murein transglycosylase B, mltB
           [Methylobacterium extorquens DM4]
 gi|254269726|emb|CAX25698.1| putative membrane bound lytic murein transglycosylase B, mltB
           [Methylobacterium extorquens DM4]
          Length = 393

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 71/195 (36%), Positives = 108/195 (55%), Gaps = 5/195 (2%)

Query: 50  RARAVREGMSPKTAKHLFADLEYLDT-TIARDRKMVT-SPPVSFKDYLDGLSSSEIIAQG 107
           R+ A   G+S KT    FA ++  D+  +AR R+    S PV   DYL G  S   I +G
Sbjct: 34  RSDATARGISQKTFDAAFAGVQAPDSDVVARTRRQSEFSRPV--WDYLVGAVSGPRITRG 91

Query: 108 IALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKF 167
            A  K  +  L  ++ + GVP  +++A WG+E+ FG + G  P +  LA+LAY   R   
Sbjct: 92  QAQGKRLAATLAAIEAKTGVPRSVVLAFWGVESDFGASAGSLPTIRALASLAYARHRGTL 151

Query: 168 FTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNI 226
           F ++   AL +++ G I  +  +G+  G +GQ QFLP   ++ A+D D DG+ D+ +S  
Sbjct: 152 FRDELLAALQILENGDIEPARMVGSWAGAMGQVQFLPSVYLREAVDFDGDGRRDIWRSEA 211

Query: 227 DAIASAAKFLAKLGW 241
           DA+AS A +L  LGW
Sbjct: 212 DALASIAHYLQSLGW 226


>gi|319762822|ref|YP_004126759.1| lytic murein transglycosylase [Alicycliphilus denitrificans BC]
 gi|317117383|gb|ADU99871.1| lytic murein transglycosylase [Alicycliphilus denitrificans BC]
          Length = 442

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 71/210 (33%), Positives = 110/210 (52%), Gaps = 6/210 (2%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKM--VTSPPVSFK 92
            +DT   F  W  A    A+  G+  +T   + A  ++    +  DR     T  P +  
Sbjct: 66  TADTIAGFHAWLEAFAREALAAGIHTQTVDAMLARAQWQPRVVELDRAQPEFTRTPWA-- 123

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
            YLD   S + +AQG   ++ ++  L   ++ YGVP  I+ A+WG+E+++G   G    +
Sbjct: 124 -YLDSAVSPQRVAQGREQRRLHAAALEAAEQRYGVPASIITAIWGMESNYGRNFGSFSTI 182

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAI 211
             LATLAYD RR  +   +   AL +V +G +++ AL G+  G +G  QFLP   +++A+
Sbjct: 183 DALATLAYDGRRRDWARGELLAALRIVDQGDMAADALVGSWAGAMGHTQFLPSVFLRFAV 242

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
           DAD DG+ D+  S  D  AS A FLA  GW
Sbjct: 243 DADGDGRRDIWGSVPDVAASTANFLAHSGW 272


>gi|71066507|ref|YP_265234.1| transglycolase [Psychrobacter arcticus 273-4]
 gi|71039492|gb|AAZ19800.1| probable transglycolase [Psychrobacter arcticus 273-4]
          Length = 491

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 61/150 (40%), Positives = 91/150 (60%), Gaps = 1/150 (0%)

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
           DYL  L  +E +A GI  K+  +  L  ++  YGV    ++ +WG+E++FG+T+GK PL 
Sbjct: 88  DYLSSLVDTERVADGIQAKRQWADTLRKIESRYGVKAEHVLGVWGVESNFGQTLGKKPLF 147

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAI 211
            +LATL+   RR  +F  ++  AL +V+ G I+ S   G+  G  GQ QF+P   ++ A+
Sbjct: 148 ESLATLSCFDRRQSYFQGEYANALKIVQNGDIAPSDMTGSWAGAFGQTQFMPSTFLELAV 207

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
           D D DG+ DLV S  DA+AS A FL K G+
Sbjct: 208 DFDGDGRRDLVNSVPDALASTANFLDKRGY 237


>gi|126642983|ref|YP_001085967.1| putative membrane-bound lytic murein transglycosylase
           [Acinetobacter baumannii ATCC 17978]
          Length = 348

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 87/150 (58%), Gaps = 1/150 (0%)

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
           DYL GL   E +A G      +  +L    + YGVP   ++A+WG+E++FG+  GK PLL
Sbjct: 17  DYLSGLVDEERVALGKQKLVQHRDVLNRASQVYGVPAETIVAVWGVESNFGDISGKYPLL 76

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAI 211
             L TL+ + RR  +F  +FF  + ++++G ++   L G+  G  G  QF+P    + A+
Sbjct: 77  QALGTLSCEGRRQSYFRTEFFATMRILQRGDLTEDQLKGSWAGAFGHTQFMPSTYERLAV 136

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
           D D DG+ DLV S  DA+AS A FL K GW
Sbjct: 137 DFDGDGRRDLVSSTADALASTANFLNKAGW 166


>gi|307319728|ref|ZP_07599153.1| lytic murein transglycosylase [Sinorhizobium meliloti AK83]
 gi|306894659|gb|EFN25420.1| lytic murein transglycosylase [Sinorhizobium meliloti AK83]
          Length = 405

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 83/299 (27%), Positives = 120/299 (40%), Gaps = 61/299 (20%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
            G +    +A AV +G+    A    A        ++RDR        +F ++     S 
Sbjct: 41  LGSFLEGVKAEAVAKGIPADVADRALAGAAIDQKVLSRDRAQGVFK-QTFTEFSKRTVSK 99

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             +  G    +  + +    ++E+GVP  ++ A W +ET FG   G       L TLA+D
Sbjct: 100 SRLDIGAQKMREYADVFARAEQEFGVPAPVITAFWAMETDFGAVQGDFNTRDALVTLAHD 159

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
           CRR + F  Q   A+++V+ G +   A  GA  GEIGQ Q LP +++ Y +D D DG ++
Sbjct: 160 CRRPEMFRPQLLAAIEMVQHGDLDPAATTGAWAGEIGQVQMLPEDIIAYGVDGDGDGHVN 219

Query: 221 LVKSNIDAIASAAKFLAKLG------------------WTKCAGYQPGE----------- 251
           L KS+ DAI +AAKF+  LG                  W K  G QPG            
Sbjct: 220 LKKSSPDAILTAAKFIHSLGFKPGEPWIQEVRVPEQLPWEKT-GLQPGMTAGDWFALGVA 278

Query: 252 -----------------------------KNFAILKHWNASLNYNKTIAYIAAHIDGVP 281
                                         NF I   WN S  Y  + AY A  + G P
Sbjct: 279 PRDGNTSNSGLEASLVLPQGRKGAAFLTYPNFKIYLEWNQSFIYTTSAAYFATRLAGAP 337


>gi|294648728|ref|ZP_06726188.1| lytic murein transglycosylase [Acinetobacter haemolyticus ATCC
           19194]
 gi|292825403|gb|EFF84146.1| lytic murein transglycosylase [Acinetobacter haemolyticus ATCC
           19194]
          Length = 432

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 76/252 (30%), Positives = 127/252 (50%), Gaps = 24/252 (9%)

Query: 6   YLLISLLMMVYPMLAQAVTQPKKATTQFIC---------SDTADRFGEWKSAARARAVRE 56
           +L  +LL + Y   A+ +    K +T             S T D F    +  R++A+  
Sbjct: 7   FLGTALLTLSYNAHAELIINGAKVSTTTTTPAVSNTSTFSPTRD-FQSCIAGLRSQAIAS 65

Query: 57  GMSP----KTAKHLFADLEYLDTTIARDRKMVTSPPVSFK--DYLDGLSSSEIIAQGIAL 110
           G+S     +  ++L AD   +D       ++   P  S    DYL GL  +E +  G   
Sbjct: 66  GVSAASFDRYTQNLSADYSVID-------RLNYQPEFSTPIWDYLSGLVDNERVQAGQQK 118

Query: 111 KKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTE 170
              +  +L  +++ YGVP   ++A+WG+E+++G+  G+ PLL  L TL+ + RR  +F  
Sbjct: 119 LAQHRDVLRRVEQAYGVPAETVVAVWGVESNYGDISGRYPLLQALGTLSCEGRRQSYFRG 178

Query: 171 QFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAI 229
           +FF  + ++++G ++   L G+  G  G  QF+P    + A+D D DG+ DLV S  DA+
Sbjct: 179 EFFATMRILQRGDVTQDQLYGSWAGAFGHTQFMPSTYERLAVDFDGDGRRDLVSSIPDAL 238

Query: 230 ASAAKFLAKLGW 241
           AS A FL + GW
Sbjct: 239 ASTANFLKRAGW 250


>gi|15599187|ref|NP_252681.1| hypothetical protein PA3992 [Pseudomonas aeruginosa PAO1]
 gi|9950184|gb|AAG07379.1|AE004817_3 hypothetical protein PA3992 [Pseudomonas aeruginosa PAO1]
          Length = 448

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 68/201 (33%), Positives = 109/201 (54%), Gaps = 2/201 (0%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F +W+ A R +A+  G+  +T    FA ++     +  DR         +K YL+G    
Sbjct: 76  FEQWRDAFRQQALAGGIDAQTFDRAFAGVQPDPAVVEADRSQPEFTRPVWK-YLEGALDP 134

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             + QG A    ++R+L  +   Y V    ++A+WG+E+++G  MG   ++ +LATLAY+
Sbjct: 135 LRVRQGQARLAQHARILGEVDARYAVDADAVVAIWGMESNYGSHMGNKNVIRSLATLAYE 194

Query: 162 CRRAKFFTEQFFYALDLVKKG-VISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR +F   Q   AL +++ G V +S  +G+  G +GQ QF+P    +YA+D D DGK D
Sbjct: 195 GRRPEFAHAQLLAALKILQHGDVPASFMIGSWAGAMGQTQFIPTTHNQYAVDFDGDGKRD 254

Query: 221 LVKSNIDAIASAAKFLAKLGW 241
           +  S  DA+AS A +L   GW
Sbjct: 255 IWGSPGDALASTANYLKASGW 275


>gi|197336114|ref|YP_002156523.1| membrane-bound lytic murein transglycosylase B [Vibrio fischeri
           MJ11]
 gi|197317604|gb|ACH67051.1| membrane-bound lytic murein transglycosylase B [Vibrio fischeri
           MJ11]
          Length = 323

 Score =  114 bits (285), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 61/186 (32%), Positives = 104/186 (55%), Gaps = 2/186 (1%)

Query: 57  GMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSR 116
           G+S    +  F ++ + +  +  DR       ++  +Y+        I Q   L K + +
Sbjct: 41  GISEPILERAFKNVAFKEKAVKSDRNQ-PEKKLTLDEYIPRAVPKWKIKQANDLYKKHYK 99

Query: 117 LLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYAL 176
            L  + +EYGV P  ++ALWG+E++FG+  G   ++  L TLAYD RR  FF +Q   AL
Sbjct: 100 ELNRIGEEYGVQPRFIVALWGVESNFGKLTGGYNVIEALTTLAYDGRREAFFKKQTMAAL 159

Query: 177 DLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKF 235
            ++++G I+   + G+  G +GQ QF+P + + YA+D + DGK D+  ++ D  ASAA +
Sbjct: 160 TILQQGHITPENMKGSWAGAMGQCQFMPTSFLSYAVDGNGDGKKDIWNTHADVFASAANY 219

Query: 236 LAKLGW 241
           L ++GW
Sbjct: 220 LKQVGW 225


>gi|257093810|ref|YP_003167451.1| lytic murein transglycosylase [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
 gi|257046334|gb|ACV35522.1| lytic murein transglycosylase [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
          Length = 410

 Score =  114 bits (285), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 82/242 (33%), Positives = 117/242 (48%), Gaps = 23/242 (9%)

Query: 39  ADRFGEWKSAARARAVREGMSP----KTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDY 94
           ADRF    S  R  A  +G+S     +  K L  DL  L+     D +     P+   DY
Sbjct: 33  ADRFSSCMSTLRGEAASKGVSAASFDRLTKGLAPDLSVLEFL---DYQPEFRTPI--WDY 87

Query: 95  LDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLST 154
           L GL   E +A  +A+++     L    + Y V    ++A+WG+E++FG   GK PLL++
Sbjct: 88  LAGLVDDERVADALAMREKWLGPLAAAGERYQVDQDTVLAVWGVESNFGRNFGKRPLLTS 147

Query: 155 LATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDA 213
           L TLA   RR  +F  +F  AL ++  G I+   L G+  G  G  QF+P   ++ A+D 
Sbjct: 148 LGTLACFGRRQGYFRGEFLSALKILDTGDIAPERLVGSWAGAFGHTQFMPSTFLRLAVDG 207

Query: 214 DEDGKIDLVKSNIDAIASAAKFLAKLGWTKCA--GYQ-----------PGEKNFAILKHW 260
           D DG+ DL+ S  DA+AS A FL + GW      GY+            G  N   L  W
Sbjct: 208 DGDGRRDLMDSVPDALASTANFLHRAGWRTGEPWGYEVVLPAGFDTSIAGRSNKRPLAQW 267

Query: 261 NA 262
           NA
Sbjct: 268 NA 269


>gi|254464355|ref|ZP_05077766.1| putative transglycolase [Rhodobacterales bacterium Y4I]
 gi|206685263|gb|EDZ45745.1| putative transglycolase [Rhodobacterales bacterium Y4I]
          Length = 389

 Score =  114 bits (285), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 89/162 (54%), Gaps = 7/162 (4%)

Query: 91  FKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTP 150
           F D+   L S + + +G+ + K +      ++  YG+  G+L+A W LET +G   G   
Sbjct: 73  FIDFSRRLISQDRLRRGLQMSKKHDSTFQRIESTYGISRGVLLAFWALETDYGGYQGDFN 132

Query: 151 LLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKY 209
               L TLA+DCRR + F  Q F AL++ ++G        GA  GEIG  Q LP +++++
Sbjct: 133 TRDALVTLAHDCRRPELFRPQVFAALEMYRQGNFDPKRTTGAWAGEIGMVQMLPSDILEH 192

Query: 210 AIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGE 251
            +DAD DGK+ L  S  DA+ S A+ L+ LGW      QPG+
Sbjct: 193 GVDADGDGKVSLKTSAADALMSGARMLSHLGW------QPGQ 228


>gi|260426102|ref|ZP_05780081.1| lytic murein transglycosylase [Citreicella sp. SE45]
 gi|260420594|gb|EEX13845.1| lytic murein transglycosylase [Citreicella sp. SE45]
          Length = 391

 Score =  114 bits (285), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 69/202 (34%), Positives = 102/202 (50%), Gaps = 4/202 (1%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDR-KMVTSPPVSFKDYLDGLSS 100
           F  + S  +  AV  G    T     + +      + RDR + +   P  F D+   L S
Sbjct: 27  FSAFVSGLKDEAVAMGHDAATVDAFLSGVRLDQRVMERDRGQGIFQTP--FIDFSRKLIS 84

Query: 101 SEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAY 160
            + + +G  L +    +   ++ +YG+  G+L+A W  ET +G   G    L+ L TLA+
Sbjct: 85  QDRLDRGRGLAERWDEVFTRIESDYGIARGVLLAFWAFETDYGTFQGDFNTLNALVTLAH 144

Query: 161 DCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKI 219
           DCRR + F  Q F AL+L ++G    S   GA  GEIGQ Q LP ++++  +D D DG +
Sbjct: 145 DCRRPEIFRPQIFAALELYERGDFDPSRTTGAWAGEIGQVQMLPKDILENGMDGDGDGHV 204

Query: 220 DLVKSNIDAIASAAKFLAKLGW 241
            L  S  DA+ S AK LA LGW
Sbjct: 205 LLKTSAPDALVSGAKMLASLGW 226


>gi|153009055|ref|YP_001370270.1| lytic murein transglycosylase [Ochrobactrum anthropi ATCC 49188]
 gi|151560943|gb|ABS14441.1| lytic murein transglycosylase [Ochrobactrum anthropi ATCC 49188]
          Length = 412

 Score =  114 bits (285), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 74/230 (32%), Positives = 112/230 (48%), Gaps = 9/230 (3%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLF-ADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSS 100
           +G+W       A   G+  K    L  A LE     + RDRK  T   ++F ++   L S
Sbjct: 49  YGQWMDNLTKEARDAGVGEKGIAELHKAMLE--QKVLDRDRKQ-TVFNLTFTEFSKRLIS 105

Query: 101 SEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAY 160
              + +G       + +   ++  YGVP  +L A WGLET +G   G    L+ L TL+Y
Sbjct: 106 EARLKKGRENLAKYADVFKKVEDTYGVPGPVLAAFWGLETDYGAIQGDFDTLNALVTLSY 165

Query: 161 DCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
           DCRR   F  Q    L L  +GV+ +   GA  GEIG  Q LP + ++  +D D DGK+D
Sbjct: 166 DCRRPDLFRPQLIALLKLFDQGVVDAATTGAWAGEIGMMQLLPKDYLERGVDGDGDGKVD 225

Query: 221 LVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKH--WNASLNYNK 268
           L  S  DA+ +A + +++LGW +    QP  +   + K   W  ++  N+
Sbjct: 226 LKSSVPDAMMTAGRMISELGWKRG---QPWLEEVRLTKDLPWEEAIRTNR 272


>gi|163744973|ref|ZP_02152333.1| peptidoglycan binding domain protein [Oceanibulbus indolifex
           HEL-45]
 gi|161381791|gb|EDQ06200.1| peptidoglycan binding domain protein [Oceanibulbus indolifex
           HEL-45]
          Length = 432

 Score =  114 bits (285), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 69/201 (34%), Positives = 105/201 (52%), Gaps = 3/201 (1%)

Query: 45  WKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEII 104
           W    R RA+++G+ P         + Y    I RDR   +    +  DYLD  +S   +
Sbjct: 65  WVKEFRPRALQQGIDPDIFDRALDTVSYDPEVIRRDRNQ-SEFTKTIWDYLDTATSELRV 123

Query: 105 AQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRR 164
             G        R L +++ +YGV   I+ A+WGLE+ +G   G   +LS+L TLAYD RR
Sbjct: 124 QNGEKALAQWQRTLEDIEAKYGVEKEIVTAIWGLESAYGSFRGGDSVLSSLTTLAYDARR 183

Query: 165 AKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVK 223
           A+FF  +   AL +++ G   +  L G+  G +G  QF+P +   +A+D D DG+ D+  
Sbjct: 184 AEFFEGELLDALRILQAGDTDAEQLRGSWAGAMGHTQFMPSSFHAHAVDWDGDGRRDIWG 243

Query: 224 SNI-DAIASAAKFLAKLGWTK 243
            N  DA+AS A +L   GWT+
Sbjct: 244 DNPGDALASTAAYLKHFGWTE 264


>gi|240141589|ref|YP_002966069.1| putative membrane-bound lytic murein transglycosylase
           [Methylobacterium extorquens AM1]
 gi|240011566|gb|ACS42792.1| putative membrane-bound lytic murein transglycosylase
           [Methylobacterium extorquens AM1]
          Length = 398

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 76/230 (33%), Positives = 117/230 (50%), Gaps = 25/230 (10%)

Query: 58  MSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFK----DYLDGLSSSEIIAQGIALKKA 113
           +S +T +   A++ Y D  I    ++  + P  FK    DY+  L   E +  G A  + 
Sbjct: 44  VSAQTFRAATANIAYDDKVI----ELSQAQP-EFKTPIWDYMSALVDEERVEDGRAAMRQ 98

Query: 114 NSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDC-RRAKFFTEQF 172
           +++ L N +  YGV    + A+WG+E++FG+ +GK PL+ +LATLA    RR  FF  + 
Sbjct: 99  HAQALANAEARYGVDRHTIAAVWGVESNFGKNLGKMPLVQSLATLACSSNRRRDFFRSEL 158

Query: 173 FYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIAS 231
              L ++++G I +  L G+  G  GQ QF+P    + A+D D DG+ D+V S  DA+AS
Sbjct: 159 IATLKIIERGDIEASRLTGSWAGAFGQTQFMPTTYQRLAVDGDGDGRRDVVDSVADAVAS 218

Query: 232 AAKFLAKLGWTKCA--GYQ-----------PGEKNFAILKHWNASLNYNK 268
            A FL    W+     GY+            G KN   + HW ASL   +
Sbjct: 219 TANFLRVAKWSNGQPWGYEVRLPRGFNVAAAGRKNKHAVGHW-ASLGVTR 267


>gi|254564100|ref|YP_003071195.1| membrane-bound lytic murein transglycosylase [Methylobacterium
           extorquens DM4]
 gi|254271378|emb|CAX27391.1| putative membrane-bound lytic murein transglycosylase
           [Methylobacterium extorquens DM4]
          Length = 398

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 76/230 (33%), Positives = 117/230 (50%), Gaps = 25/230 (10%)

Query: 58  MSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFK----DYLDGLSSSEIIAQGIALKKA 113
           +S +T +   A++ Y D  I    ++  + P  FK    DY+  L   E +  G A  + 
Sbjct: 44  VSAQTFRAATANIAYDDKVI----ELSQAQP-EFKTPIWDYMSALVDEERVEDGRAAMRQ 98

Query: 114 NSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDC-RRAKFFTEQF 172
           +++ L N +  YGV    + A+WG+E++FG+ +GK PL+ +LATLA    RR  FF  + 
Sbjct: 99  HAQALANAEARYGVDRHTIAAVWGVESNFGKNLGKMPLVQSLATLACSSNRRRDFFRTEL 158

Query: 173 FYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIAS 231
              L ++++G I +  L G+  G  GQ QF+P    + A+D D DG+ D+V S  DA+AS
Sbjct: 159 IATLKIIERGDIEASRLTGSWAGAFGQTQFMPTTYQRLAVDGDGDGRRDVVDSVADAVAS 218

Query: 232 AAKFLAKLGWTKCA--GYQ-----------PGEKNFAILKHWNASLNYNK 268
            A FL    W+     GY+            G KN   + HW ASL   +
Sbjct: 219 TANFLRVAKWSNGQPWGYEVRLPRGFNVAAAGRKNKHAVGHW-ASLGVTR 267


>gi|229515338|ref|ZP_04404798.1| membrane-bound lytic murein transglycosylase B [Vibrio cholerae TMA
           21]
 gi|229348043|gb|EEO13002.1| membrane-bound lytic murein transglycosylase B [Vibrio cholerae TMA
           21]
          Length = 323

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 61/202 (30%), Positives = 111/202 (54%), Gaps = 2/202 (0%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F ++    + +A  EG+S +     F D+EY   ++  D+       ++  +Y+      
Sbjct: 24  FEQYVERLKQQAREEGISERILNEAFRDVEYKPRSVVADKNQ-PEKKLTLDEYIPRAVPE 82

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             + Q  +L + +   L  + K+YGV P  ++ALWG+E++FG   G   ++  L+TLAY+
Sbjct: 83  WKVKQAQSLYEKHYTELQRIGKQYGVQPRFIVALWGVESNFGAFTGNFRVIDALSTLAYE 142

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR +FF ++   AL ++++G I+  A+ G+  G +GQ QF+P + + +A D + DGK D
Sbjct: 143 GRREEFFRKETMAALQILEQGHIAPEAMKGSWAGAMGQCQFMPSSFLNFAADGNGDGKKD 202

Query: 221 LVKSNIDAIASAAKFLAKLGWT 242
           +  +  D  AS A +L++ GW 
Sbjct: 203 IWGTRSDVFASTANYLSQSGWN 224


>gi|163733897|ref|ZP_02141339.1| lytic murein transglycosylase, putative [Roseobacter litoralis Och
           149]
 gi|161393008|gb|EDQ17335.1| lytic murein transglycosylase, putative [Roseobacter litoralis Och
           149]
          Length = 390

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 70/212 (33%), Positives = 104/212 (49%), Gaps = 9/212 (4%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIA--RDRKMVTSPPVSFK 92
           C  + D F +     +A AV +G +P +    F+ ++   + +   RD+ M   P   F 
Sbjct: 23  CGGSFDNFVQ---NMKAEAVSKGHAPASVDRFFSGIQQSQSVLRADRDQGMFQRP---FL 76

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
           D+   L S   +++G  L +    +  ++ + YGV  G+L+A W  ET +G   G     
Sbjct: 77  DFSRNLISDARLSKGQRLGREYDAVFDSVDRRYGVSRGVLLAFWAFETAYGTYQGDFNTA 136

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVISSH-ALGATFGEIGQFQFLPVNVVKYAI 211
           + L TLA+DCRR   F  Q F AL+L + G        GA  GEIG  Q LP ++++   
Sbjct: 137 NALVTLAHDCRRPDLFRPQVFAALELYEMGDFDPRTTTGAWAGEIGMVQMLPRDILENGQ 196

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGWTK 243
           DAD DG + L  S  DA+ S A  LA  GW K
Sbjct: 197 DADGDGHVRLKTSAPDALMSGAAMLADFGWRK 228


>gi|218533077|ref|YP_002423893.1| lytic murein transglycosylase [Methylobacterium chloromethanicum
           CM4]
 gi|218525380|gb|ACK85965.1| lytic murein transglycosylase [Methylobacterium chloromethanicum
           CM4]
          Length = 398

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 76/230 (33%), Positives = 117/230 (50%), Gaps = 25/230 (10%)

Query: 58  MSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFK----DYLDGLSSSEIIAQGIALKKA 113
           +S +T +   A++ Y D  I    ++  + P  FK    DY+  L   E +  G A  + 
Sbjct: 44  VSAQTFRAATANIAYDDKVI----ELSQAQP-EFKTPIWDYMSALVDEERVEDGRAAMRQ 98

Query: 114 NSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDC-RRAKFFTEQF 172
           +++ L N +  YGV    + A+WG+E++FG+ +GK PL+ +LATLA    RR  FF  + 
Sbjct: 99  HAQALANAEARYGVDRHTIAAVWGVESNFGKNLGKMPLVQSLATLACSSNRRRDFFRTEL 158

Query: 173 FYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIAS 231
              L ++++G I +  L G+  G  GQ QF+P    + A+D D DG+ D+V S  DA+AS
Sbjct: 159 IATLKIIERGDIEASRLTGSWAGAFGQTQFMPTTYQRLAVDGDGDGRRDVVDSVADAVAS 218

Query: 232 AAKFLAKLGWTKCA--GYQ-----------PGEKNFAILKHWNASLNYNK 268
            A FL    W+     GY+            G KN   + HW ASL   +
Sbjct: 219 TANFLRVAKWSNGQPWGYEVRLPRGFNVAAAGRKNKHAVGHW-ASLGVTR 267


>gi|289669825|ref|ZP_06490900.1| transglycosylase [Xanthomonas campestris pv. musacearum NCPPB4381]
          Length = 425

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 72/232 (31%), Positives = 114/232 (49%), Gaps = 3/232 (1%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F +W +  R RA+  G+   T  + FA +   D ++ +  +          DYLD   + 
Sbjct: 53  FEQWLADFRQRALAAGIEATTLDNAFAGVT-PDPSVQKLDQQQPEFTSYLWDYLDARVTP 111

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             I +G  L  +   L   L++ YGV PGIL A+W +E+ +G  +G   ++ +LATLA++
Sbjct: 112 SAIQEGQQLLISQHALFEKLRQHYGVDPGILTAIWSMESGYGTQIGDFYVIRSLATLAHE 171

Query: 162 CRRAKFFTEQFFYALDLVK--KGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKI 219
            RR  +   Q   AL +++  K +  S  +G+  G +GQ QF+P     YA+D D D K 
Sbjct: 172 GRRTTYGNTQLLAALQILQTEKSIARSQLVGSWAGAMGQTQFIPSTYRDYAVDEDGDQKR 231

Query: 220 DLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIA 271
           D+  S  DA+ SAA +L +  WT    +       A   +  A L   KT+A
Sbjct: 232 DVWNSKADALGSAANYLKQNNWTSAVPWGQEVHLPAGFDYAQADLTIKKTVA 283


>gi|170747392|ref|YP_001753652.1| lytic murein transglycosylase [Methylobacterium radiotolerans JCM
           2831]
 gi|170653914|gb|ACB22969.1| lytic murein transglycosylase [Methylobacterium radiotolerans JCM
           2831]
          Length = 404

 Score =  113 bits (283), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 82/256 (32%), Positives = 128/256 (50%), Gaps = 34/256 (13%)

Query: 50  RARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFK----DYLDGLSSSEIIA 105
           +++A   G+S +T +   + + Y D  I    ++  + P  FK    DY+  L   E + 
Sbjct: 42  QSQAAAAGVSAQTFRSATSGISYDDKVI----ELSQAQP-EFKTPIWDYMAALVDDERVE 96

Query: 106 QGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLA-YDCRR 164
            G A  + N+  L   +  YGV    + A+WG+E++FG+ +GK PL+ +LATLA  + RR
Sbjct: 97  DGRAAMRQNAAALAQAESRYGVDRYTIAAVWGVESNFGKNLGKMPLVQSLATLACSNNRR 156

Query: 165 AKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVK 223
             FF  +    L ++++G I+   L G+  G  GQ QF+P    + A+D D DG+ D+V 
Sbjct: 157 RDFFRGELIATLRIIERGDIAPERLTGSWAGAFGQTQFMPTTYHRLAVDGDGDGRRDVVD 216

Query: 224 SNIDAIASAAKFLAKLGWT--KCAGYQ-----------PGEKNFAILKHWNASLNYNKTI 270
           S  DA+AS A FL    W   +  GY+            G KN   + HW ASL   +  
Sbjct: 217 STADAVASTANFLHVAKWQHGQVWGYEVKLPRGFNVAAAGRKNKKPVAHW-ASLGVTR-- 273

Query: 271 AYIAAHIDGVPI-GKG 285
                 +DG P+ G+G
Sbjct: 274 ------VDGRPLSGEG 283


>gi|15641958|ref|NP_231590.1| lytic murein transglycosylase, putative [Vibrio cholerae O1 biovar
           El Tor str. N16961]
 gi|121590657|ref|ZP_01677991.1| lytic murein transglycosylase, putative [Vibrio cholerae 2740-80]
 gi|121727829|ref|ZP_01680896.1| lytic murein transglycosylase, putative [Vibrio cholerae V52]
 gi|147673674|ref|YP_001217484.1| putative lytic murein transglycosylase [Vibrio cholerae O395]
 gi|153818746|ref|ZP_01971413.1| lytic murein transglycosylase, putative [Vibrio cholerae NCTC 8457]
 gi|153822438|ref|ZP_01975105.1| lytic murein transglycosylase, putative [Vibrio cholerae B33]
 gi|153829241|ref|ZP_01981908.1| putative lytic murein transglycosylase [Vibrio cholerae 623-39]
 gi|227082085|ref|YP_002810636.1| putative lytic murein transglycosylase [Vibrio cholerae M66-2]
 gi|229507952|ref|ZP_04397457.1| membrane-bound lytic murein transglycosylase B [Vibrio cholerae BX
           330286]
 gi|229511812|ref|ZP_04401291.1| membrane-bound lytic murein transglycosylase B [Vibrio cholerae
           B33]
 gi|229518949|ref|ZP_04408392.1| membrane-bound lytic murein transglycosylase B [Vibrio cholerae
           RC9]
 gi|229521870|ref|ZP_04411287.1| membrane-bound lytic murein transglycosylase B [Vibrio cholerae TM
           11079-80]
 gi|229529020|ref|ZP_04418410.1| membrane-bound lytic murein transglycosylase B [Vibrio cholerae
           12129(1)]
 gi|229607497|ref|YP_002878145.1| membrane-bound lytic murein transglycosylase B [Vibrio cholerae
           MJ-1236]
 gi|254286886|ref|ZP_04961838.1| lytic murein transglycosylase, putative [Vibrio cholerae AM-19226]
 gi|254849042|ref|ZP_05238392.1| lytic murein transglycosylase [Vibrio cholerae MO10]
 gi|255745292|ref|ZP_05419241.1| membrane-bound lytic murein transglycosylase B [Vibrio cholera CIRS
           101]
 gi|262156016|ref|ZP_06029136.1| membrane-bound lytic murein transglycosylase B [Vibrio cholerae
           INDRE 91/1]
 gi|298498010|ref|ZP_07007817.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
 gi|9656495|gb|AAF95104.1| lytic murein transglycosylase, putative [Vibrio cholerae O1 biovar
           El Tor str. N16961]
 gi|121547500|gb|EAX57606.1| lytic murein transglycosylase, putative [Vibrio cholerae 2740-80]
 gi|121629865|gb|EAX62279.1| lytic murein transglycosylase, putative [Vibrio cholerae V52]
 gi|126510709|gb|EAZ73303.1| lytic murein transglycosylase, putative [Vibrio cholerae NCTC 8457]
 gi|126520014|gb|EAZ77237.1| lytic murein transglycosylase, putative [Vibrio cholerae B33]
 gi|146315557|gb|ABQ20096.1| putative lytic murein transglycosylase [Vibrio cholerae O395]
 gi|148875279|gb|EDL73414.1| putative lytic murein transglycosylase [Vibrio cholerae 623-39]
 gi|150423036|gb|EDN14985.1| lytic murein transglycosylase, putative [Vibrio cholerae AM-19226]
 gi|227009973|gb|ACP06185.1| putative lytic murein transglycosylase [Vibrio cholerae M66-2]
 gi|227013853|gb|ACP10063.1| putative lytic murein transglycosylase [Vibrio cholerae O395]
 gi|229332794|gb|EEN98280.1| membrane-bound lytic murein transglycosylase B [Vibrio cholerae
           12129(1)]
 gi|229340795|gb|EEO05800.1| membrane-bound lytic murein transglycosylase B [Vibrio cholerae TM
           11079-80]
 gi|229343638|gb|EEO08613.1| membrane-bound lytic murein transglycosylase B [Vibrio cholerae
           RC9]
 gi|229351777|gb|EEO16718.1| membrane-bound lytic murein transglycosylase B [Vibrio cholerae
           B33]
 gi|229355457|gb|EEO20378.1| membrane-bound lytic murein transglycosylase B [Vibrio cholerae BX
           330286]
 gi|229370152|gb|ACQ60575.1| membrane-bound lytic murein transglycosylase B [Vibrio cholerae
           MJ-1236]
 gi|254844747|gb|EET23161.1| lytic murein transglycosylase [Vibrio cholerae MO10]
 gi|255737122|gb|EET92518.1| membrane-bound lytic murein transglycosylase B [Vibrio cholera CIRS
           101]
 gi|262030194|gb|EEY48838.1| membrane-bound lytic murein transglycosylase B [Vibrio cholerae
           INDRE 91/1]
 gi|297542343|gb|EFH78393.1| conserved hypothetical protein [Vibrio cholerae MAK 757]
 gi|327484494|gb|AEA78901.1| Membrane-bound lytic murein transglycosylase B [Vibrio cholerae
           LMA3894-4]
          Length = 323

 Score =  113 bits (283), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 61/201 (30%), Positives = 111/201 (55%), Gaps = 2/201 (0%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F ++    + +A  EG+S +     F D+EY   ++  D+       ++  +Y+      
Sbjct: 24  FEQYVERLKQQAREEGISERILNEAFRDVEYKPRSVVADKNQ-PEKKLTLDEYIPRAVPE 82

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             + Q  +L + +   L  + K+YGV P  ++ALWG+E++FG   G   ++  L+TLAY+
Sbjct: 83  WKVKQAQSLYEKHYTELQRIGKQYGVQPRFIVALWGVESNFGAFTGNFRVIDALSTLAYE 142

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR +FF ++   AL ++++G I+  A+ G+  G +GQ QF+P + + +A D + DGK D
Sbjct: 143 GRREEFFRKETMAALQILEQGHIAPEAMKGSWAGAMGQCQFMPSSFLNFAADGNGDGKKD 202

Query: 221 LVKSNIDAIASAAKFLAKLGW 241
           +  +  D  AS A +L++ GW
Sbjct: 203 IWGTRSDVFASTANYLSQSGW 223


>gi|92113032|ref|YP_572960.1| lytic murein transglycosylase [Chromohalobacter salexigens DSM
           3043]
 gi|91796122|gb|ABE58261.1| Lytic murein transglycosylase [Chromohalobacter salexigens DSM
           3043]
          Length = 430

 Score =  113 bits (283), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 70/213 (32%), Positives = 105/213 (49%), Gaps = 6/213 (2%)

Query: 32  QFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSF 91
           Q    D    F  W +A R +A   G+   T    F  + +    I  DR   + P  S 
Sbjct: 48  QVASRDAHQDFAAWVAAFRQKAASAGIDEVTLAAAFDGVRFQPRIIELDR---SQPEFSK 104

Query: 92  K--DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKT 149
           +   YLD   S + + QG     A+    +  +K Y VP  IL A+WG+E+++G   G  
Sbjct: 105 RVWRYLDTAVSEQRVRQGREKLTAHRAAAMRAEKRYAVPAEILTAIWGVESNYGSHFGSF 164

Query: 150 PLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVK 208
             +  L+TL Y+ RR  F  E+   AL++++ G I   H  G+  G +G  QFLP + + 
Sbjct: 165 STIDALSTLGYEGRRQAFAREELLAALEILQSGDIDRDHMRGSWAGAMGHTQFLPSSFLA 224

Query: 209 YAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
           YA+DAD DG+ D+  S  D +AS A +L + GW
Sbjct: 225 YAVDADGDGRRDIWGSIDDVMASTAHYLEEAGW 257


>gi|153826382|ref|ZP_01979049.1| lytic murein transglycosylase, putative [Vibrio cholerae MZO-2]
 gi|149739860|gb|EDM54051.1| lytic murein transglycosylase, putative [Vibrio cholerae MZO-2]
          Length = 323

 Score =  113 bits (283), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 61/201 (30%), Positives = 111/201 (55%), Gaps = 2/201 (0%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F ++    + +A  EG+S +     F D+EY   ++  D+       ++  +Y+      
Sbjct: 24  FEQYVERLKQQAREEGISERILNEAFRDVEYKPRSVVADKNQ-PEKKLTLDEYIPRAVPE 82

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             + Q  +L + +   L  + K+YGV P  ++ALWG+E++FG   G   ++  L+TLAY+
Sbjct: 83  WKVKQAQSLYEKHYTELQRIGKQYGVQPRFIVALWGVESNFGAFTGNFRVIDALSTLAYE 142

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR +FF ++   AL ++++G I+  A+ G+  G +GQ QF+P + + +A D + DGK D
Sbjct: 143 GRREEFFRKETMAALQILEQGHIAPEAMKGSWAGAMGQCQFMPSSFLNFAADGNGDGKKD 202

Query: 221 LVKSNIDAIASAAKFLAKLGW 241
           +  +  D  AS A +L++ GW
Sbjct: 203 IWGTRSDVFASTANYLSQSGW 223


>gi|262404312|ref|ZP_06080867.1| membrane-bound lytic murein transglycosylase B [Vibrio sp. RC586]
 gi|262349344|gb|EEY98482.1| membrane-bound lytic murein transglycosylase B [Vibrio sp. RC586]
          Length = 325

 Score =  113 bits (283), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 71/240 (29%), Positives = 122/240 (50%), Gaps = 20/240 (8%)

Query: 4   KKYLLISL-LMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKT 62
           KK L I L L +  P+LA  V+                 F E+    + +A  EG+S + 
Sbjct: 2   KKLLSIVLGLTLSAPVLANEVS-----------------FEEYVERLKQQAREEGISERI 44

Query: 63  AKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLK 122
               F D+EY    +  D+       ++  +Y+        + Q  +L + +   L  + 
Sbjct: 45  LNEAFRDVEYKPRAVVADKNQ-PEKKLTLDEYIPRAVPEWKVKQAQSLYEKHYDELQRIG 103

Query: 123 KEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKG 182
           K+YGV P  ++ALWG+E++FG   G   ++  L+TLAY+ RR +FF ++   AL ++++G
Sbjct: 104 KQYGVQPRFIVALWGVESNFGALTGNFSVIDALSTLAYEGRREEFFRKETMAALQILEQG 163

Query: 183 VISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
            I+   + G+  G +GQ QF+P + + +A D + DGK D+  +  D  AS A +L++ GW
Sbjct: 164 HIAPETMKGSWAGAMGQCQFMPSSFLNFAADGNGDGKKDIWGTRSDVFASTANYLSQSGW 223


>gi|163854132|ref|YP_001642175.1| lytic murein transglycosylase [Methylobacterium extorquens PA1]
 gi|163665737|gb|ABY33104.1| lytic murein transglycosylase [Methylobacterium extorquens PA1]
          Length = 398

 Score =  113 bits (282), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 76/229 (33%), Positives = 116/229 (50%), Gaps = 25/229 (10%)

Query: 59  SPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFK----DYLDGLSSSEIIAQGIALKKAN 114
           S +T +   A++ Y D  I    ++  + P  FK    DY+  L   E +  G A  + +
Sbjct: 45  SAQTFRAATANIAYDDKVI----ELSQAQP-EFKTPIWDYMSALVDEERVEDGRAAMRQH 99

Query: 115 SRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDC-RRAKFFTEQFF 173
           ++ L N +  YGV    + A+WG+E++FG+ +GK PL+ +LATLA    RR  FF  +  
Sbjct: 100 AQALANAEARYGVDRHTIAAVWGVESNFGKNLGKMPLVQSLATLACSSNRRRDFFRTELI 159

Query: 174 YALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASA 232
             L ++++G I +  L G+  G  GQ QF+P    + A+D D DG+ D+V S  DA+AS 
Sbjct: 160 ATLKIIERGDIEASRLTGSWAGAFGQTQFMPTTYQRLAVDGDGDGRRDVVDSVADAVAST 219

Query: 233 AKFLAKLGWTKCA--GYQ-----------PGEKNFAILKHWNASLNYNK 268
           A FL    W+     GY+            G KN   + HW ASL   +
Sbjct: 220 ANFLRVAKWSNGQPWGYEVRLPRGFNVAAAGRKNKHAVGHW-ASLGVTR 267


>gi|89899658|ref|YP_522129.1| lytic murein transglycosylase [Rhodoferax ferrireducens T118]
 gi|89344395|gb|ABD68598.1| Lytic murein transglycosylase [Rhodoferax ferrireducens T118]
          Length = 432

 Score =  113 bits (282), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 67/199 (33%), Positives = 106/199 (53%), Gaps = 6/199 (3%)

Query: 44  EWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEI 103
           E+ + ARA  + E     T +  F D+ ++   I  D          + DYLD   S+  
Sbjct: 71  EFSTTARAAGIDEA----TLRSAFDDVHFIPRVIELDSAQPEFTRTVW-DYLDSALSTRR 125

Query: 104 IAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCR 163
           IA+G         ++  +   YGVP  +L+A+WG+E++FG  +G  P +  LATL ++ R
Sbjct: 126 IARGRDKLLQLHPVVEPIAARYGVPAEVLVAIWGMESNFGSNVGDIPTIDALATLGFEGR 185

Query: 164 RAKFFTEQFFYALDLVK-KGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLV 222
           R ++   Q   AL +++ + +  +  +G+  G +GQ QFLP N + YA+DAD DG+ D+ 
Sbjct: 186 REQWARGQLLAALRILQNRDIDRAQMMGSWAGAMGQTQFLPSNFLAYAVDADADGRRDIW 245

Query: 223 KSNIDAIASAAKFLAKLGW 241
            S  D +AS A FLA  GW
Sbjct: 246 NSLADVMASTANFLASSGW 264


>gi|264679926|ref|YP_003279835.1| lytic murein transglycosylase [Comamonas testosteroni CNB-2]
 gi|262210441|gb|ACY34539.1| lytic murein transglycosylase [Comamonas testosteroni CNB-2]
          Length = 444

 Score =  113 bits (282), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 75/234 (32%), Positives = 118/234 (50%), Gaps = 13/234 (5%)

Query: 39  ADRFGEWKS--AARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLD 96
           A  F  WK   A RARA   G+S +T +   A      + +  DR         ++ YLD
Sbjct: 66  ASNFAHWKQEFAPRARAA--GISERTLRSALAGARLQPSIVKLDRSQPEFTRTPWQ-YLD 122

Query: 97  GLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLA 156
              S++ I  G    +  +  L    + YGVP  ++ A+WG+E+++G   G    +  LA
Sbjct: 123 SAVSAQRIRTGKLKMQEYAASLQAASQRYGVPAPVIAAIWGMESNYGSNFGSFSAVDALA 182

Query: 157 TLAYDCRRAKFFTEQFFYALDLVKKGVI-SSHALGATFGEIGQFQFLPVNVVKYAIDADE 215
           TLA+D RRA++  ++   AL ++  G I ++H + +  G +G  QFLP   ++YA+DAD 
Sbjct: 183 TLAFDGRRAEWAQKELIAALRIIDNGDIDAAHMISSWAGAMGNTQFLPSVFLQYAVDADG 242

Query: 216 DGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKT 269
           DG+ D+  S  D  AS A +LA  GW       PGE  + +     A+ +Y +T
Sbjct: 243 DGRRDIWGSMADVAASTANYLASSGWN------PGEP-WGVEVRLPANFDYART 289


>gi|166713682|ref|ZP_02244889.1| transglycosylase [Xanthomonas oryzae pv. oryzicola BLS256]
          Length = 425

 Score =  113 bits (282), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 73/234 (31%), Positives = 116/234 (49%), Gaps = 7/234 (2%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVS--FKDYLDGLS 99
           F +W +  R RA+  G+   T  + FA +    +  A D++    P  +    DYLD   
Sbjct: 53  FEQWLADFRQRALAAGIRATTLDNAFAGVTPDPSVQALDQQQ---PEFTRYLWDYLDARV 109

Query: 100 SSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLA 159
           +   I +G  L  +   L   L+++YGV PGIL A+W +E+ +G  +G   ++ +LATLA
Sbjct: 110 TPSAIQEGQQLLISKHALFQKLRQQYGVDPGILTAIWSMESGYGTQIGDFYVIRSLATLA 169

Query: 160 YDCRRAKFFTEQFFYALDLVK--KGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDG 217
           ++ RR  +   Q   AL +++  K +  S  +G+  G +GQ QF+P     YA+D D D 
Sbjct: 170 HEGRRTTYGNTQLLAALQILQTEKNIDRSQLVGSWAGAMGQTQFVPSTYRDYAVDEDGDQ 229

Query: 218 KIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIA 271
           K D+  S  DA+ SAA +L +  W     +       A   +  A L   KT+A
Sbjct: 230 KRDVWNSKADALGSAANYLKQNNWNSAIPWGQEVHLSASFDYAQADLTIKKTVA 283


>gi|163738128|ref|ZP_02145544.1| Lytic murein transglycosylase [Phaeobacter gallaeciensis BS107]
 gi|161388744|gb|EDQ13097.1| Lytic murein transglycosylase [Phaeobacter gallaeciensis BS107]
          Length = 448

 Score =  113 bits (282), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 68/207 (32%), Positives = 112/207 (54%), Gaps = 9/207 (4%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARD---RKMVTSPPVSFKDYLDGL 98
           F  W +A R RA  EG+S  T     + +E+    + RD    + VT        YL+  
Sbjct: 80  FEGWIAAFRPRARAEGLSQATLDRALSGVEFDPKIVQRDGNQSEFVTP----IWTYLERA 135

Query: 99  SSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATL 158
            S   I  G A  + +++ L  ++ +YGV   ++ A+WG+E+++G   G+  ++ +LATL
Sbjct: 136 VSDARIQNGKAALRDHAQTLARIEAKYGVDREVVAAVWGMESNYGTFRGERDIIRSLATL 195

Query: 159 AYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDG 217
           A+D RR  FF  Q   AL +++ G ++  A+ G+  G +G  QF+P + + YA+D   DG
Sbjct: 196 AFDGRRGAFFESQLIAALQILQAGDVTPEAMTGSWAGAMGHTQFMPTSYLAYAVDFTGDG 255

Query: 218 KIDLVKSN-IDAIASAAKFLAKLGWTK 243
           K D+   +  DA+AS A +L + GW K
Sbjct: 256 KRDIWSDDPADALASTAAYLKRFGWVK 282


>gi|163743754|ref|ZP_02151128.1| peptidoglycan binding domain protein [Phaeobacter gallaeciensis
           2.10]
 gi|161383015|gb|EDQ07410.1| peptidoglycan binding domain protein [Phaeobacter gallaeciensis
           2.10]
          Length = 448

 Score =  113 bits (282), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 68/207 (32%), Positives = 112/207 (54%), Gaps = 9/207 (4%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARD---RKMVTSPPVSFKDYLDGL 98
           F  W +A R RA  EG+S  T     + +E+    + RD    + VT        YL+  
Sbjct: 80  FEGWIAAFRPRARAEGLSQATLDRALSGVEFDPKIVQRDGNQSEFVTP----IWTYLERA 135

Query: 99  SSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATL 158
            S   I  G A  + +++ L  ++ +YGV   ++ A+WG+E+++G   G+  ++ +LATL
Sbjct: 136 VSDARIQNGKAALRDHAQTLARIEAKYGVDREVVAAVWGMESNYGTFRGERDIIRSLATL 195

Query: 159 AYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDG 217
           A+D RR  FF  Q   AL +++ G ++  A+ G+  G +G  QF+P + + YA+D   DG
Sbjct: 196 AFDGRRGAFFESQLIAALQILQAGDVTPEAMTGSWAGAMGHTQFMPTSYLAYAVDFTGDG 255

Query: 218 KIDLVKSN-IDAIASAAKFLAKLGWTK 243
           K D+   +  DA+AS A +L + GW K
Sbjct: 256 KRDIWSDDPADALASTAAYLKRFGWVK 282


>gi|5545316|dbj|BAA82531.1| putative transglycosylase [Actinobacillus actinomycetemcomitans]
          Length = 375

 Score =  113 bits (282), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 71/220 (32%), Positives = 115/220 (52%), Gaps = 16/220 (7%)

Query: 38  TADRFGEWKSAARARAVREGMSPKTAK--------HLFADLEYLDTTIARDRKMVTS-PP 88
           T D F ++ +  +A+A  EG+S                ADL+  D  + R RK   + PP
Sbjct: 52  TLDNFNDYVNFLKAKASAEGVSADVLNAQNNINYIQKSADLD--DRQVGRIRKRDPNVPP 109

Query: 89  V----SFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGE 144
           +       +YL+ + +   +    A        L N  K++GVP   L+ALWG+E+ FG 
Sbjct: 110 IINPNGMTNYLNRVLTKNKVDTAEARYWEQLPQLENASKKFGVPKNYLLALWGMESSFGY 169

Query: 145 TMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHA-LGATFGEIGQFQFLP 203
             G   +LSTLATLA+D RR   F+++F  A+ ++++  I  H  LG+  G +GQ QF+P
Sbjct: 170 YQGNYDVLSTLATLAFDGRREALFSKEFIAAMKMLQRDHIQRHKMLGSWAGAMGQTQFMP 229

Query: 204 VNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTK 243
            + + YA D + DG+ ++  ++ D  AS A +L  +GW +
Sbjct: 230 SSYLSYAADGNNDGEKNIWTNHYDVFASIANYLHTVGWNE 269


>gi|183179548|ref|ZP_02957759.1| lytic murein transglycosylase, putative [Vibrio cholerae MZO-3]
 gi|183012959|gb|EDT88259.1| lytic murein transglycosylase, putative [Vibrio cholerae MZO-3]
          Length = 323

 Score =  113 bits (282), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 61/201 (30%), Positives = 111/201 (55%), Gaps = 2/201 (0%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F ++    + +A  EG+S +     F D+EY   ++  D+       ++  +Y+      
Sbjct: 24  FEQYVERLKQQAREEGISERILNEAFRDVEYKPRSVVADKNQ-PEKKLTLDEYIPRAVPE 82

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             + Q  +L + +   L  + K+YGV P  ++ALWG+E++FG   G   ++  L+TLAY+
Sbjct: 83  WKVKQAQSLYEKHYTELQRIGKQYGVQPRFIVALWGVESNFGAFTGNFRVIDALSTLAYE 142

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR +FF ++   AL ++++G I+  A+ G+  G +GQ QF+P + + +A D + DGK D
Sbjct: 143 GRREEFFRKETMAALQILEQGHIAPDAMKGSWAGAMGQCQFMPSSFLNFAADGNGDGKKD 202

Query: 221 LVKSNIDAIASAAKFLAKLGW 241
           +  +  D  AS A +L++ GW
Sbjct: 203 IWGTRSDVFASTANYLSQSGW 223


>gi|297579466|ref|ZP_06941394.1| conserved hypothetical protein [Vibrio cholerae RC385]
 gi|297537060|gb|EFH75893.1| conserved hypothetical protein [Vibrio cholerae RC385]
          Length = 323

 Score =  113 bits (282), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 61/201 (30%), Positives = 111/201 (55%), Gaps = 2/201 (0%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F ++    + +A  EG+S +     F D+EY   ++  D+       ++  +Y+      
Sbjct: 24  FEQYVERLKQQAREEGISERILNEAFRDVEYKPRSVVADKNQ-PEKKLTLDEYIPRAVPE 82

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             + Q  +L + +   L  + K+YGV P  ++ALWG+E++FG   G   ++  L+TLAY+
Sbjct: 83  WKVKQAQSLYEKHYTELQRIGKQYGVQPRFIVALWGVESNFGAFTGNFRVIDALSTLAYE 142

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR +FF ++   AL ++++G I+  A+ G+  G +GQ QF+P + + +A D + DGK D
Sbjct: 143 GRREEFFRKETMAALQILEQGHIAPDAMKGSWAGAMGQCQFMPSSFLNFAADGNGDGKKD 202

Query: 221 LVKSNIDAIASAAKFLAKLGW 241
           +  +  D  AS A +L++ GW
Sbjct: 203 IWGTRSDVFASTANYLSQSGW 223


>gi|261222590|ref|ZP_05936871.1| LOW QUALITY PROTEIN: transglycolase [Brucella ceti B1/94]
 gi|265998555|ref|ZP_06111112.1| LOW QUALITY PROTEIN: transglycolase [Brucella ceti M490/95/1]
 gi|260921174|gb|EEX87827.1| LOW QUALITY PROTEIN: transglycolase [Brucella ceti B1/94]
 gi|262553179|gb|EEZ09013.1| LOW QUALITY PROTEIN: transglycolase [Brucella ceti M490/95/1]
          Length = 298

 Score =  113 bits (282), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 60/159 (37%), Positives = 87/159 (54%), Gaps = 6/159 (3%)

Query: 121 LKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVK 180
           ++  YGVP  +L A WGLET +G   G    L+ L TL+YDCRR   F  Q    L L  
Sbjct: 13  VEDAYGVPGPVLAAFWGLETDYGAIQGDFDTLNALVTLSYDCRRPDLFRPQLIALLKLFD 72

Query: 181 KGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLG 240
           +GV+ ++  GA  GEIG  Q LP + ++  +D D DGK+DL  S  DA+ +A + L++LG
Sbjct: 73  QGVVDANTTGAWAGEIGMMQLLPKDYLERGVDGDGDGKVDLKNSVPDAMMTAGRMLSELG 132

Query: 241 WTKCAGYQPGEKNFAILKH--WNASLNYN-KTIAYIAAH 276
           W +    QP  +   + K   W  ++  N K  ++ A H
Sbjct: 133 WKRG---QPWLEEVRLTKDLPWEEAIRTNRKPHSWWAEH 168


>gi|254226498|ref|ZP_04920083.1| lytic murein transglycosylase, putative [Vibrio cholerae V51]
 gi|125621004|gb|EAZ49353.1| lytic murein transglycosylase, putative [Vibrio cholerae V51]
          Length = 323

 Score =  113 bits (282), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 62/201 (30%), Positives = 111/201 (55%), Gaps = 2/201 (0%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F ++    + +A  EG+S +     F D+EY   ++A D+       ++  +Y+      
Sbjct: 24  FEQYVERLKQQAREEGISERILNEAFRDVEYKPRSVAADKNQ-PEKKLTLDEYIPRAVPE 82

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             + Q  +L + +   L  + K+YGV P  ++ALWG E++FG   G   ++  L+TLAY+
Sbjct: 83  WKVKQAQSLYEKHYTELQRIGKQYGVQPRFIVALWGGESNFGAFTGNFRVIDALSTLAYE 142

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR +FF ++   AL ++++G I+  A+ G+  G +GQ QF+P + + +A D + DGK D
Sbjct: 143 GRREEFFRKETMAALQILEQGHIAPDAMKGSWAGAMGQCQFMPSSFLNFAADGNGDGKKD 202

Query: 221 LVKSNIDAIASAAKFLAKLGW 241
           +  +  D  AS A +L++ GW
Sbjct: 203 IWGTRSDVFASTANYLSQSGW 223


>gi|254524357|ref|ZP_05136412.1| epimerase [Stenotrophomonas sp. SKA14]
 gi|219721948|gb|EED40473.1| epimerase [Stenotrophomonas sp. SKA14]
          Length = 421

 Score =  112 bits (281), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 85/150 (56%), Gaps = 1/150 (0%)

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
           DYL  L   + +  G A+ + +  LL  +  +YGV P  ++A+WG+E+ +G   GK PLL
Sbjct: 80  DYLAALVDRQRVDDGRAMLQQHRDLLDRVSAQYGVDPATIVAVWGVESDYGRVFGKRPLL 139

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAI 211
            +LATL+   RR  FF  +    L L+ +G + +  L G+  G  G  QF+P    + A+
Sbjct: 140 QSLATLSCAGRRQAFFRGELLALLTLIDRGDLQAQGLTGSWAGAFGHTQFMPSTYARIAV 199

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
           D D DG+ DLV S  DA+AS A +L + GW
Sbjct: 200 DGDGDGRRDLVGSIPDALASTANYLKRAGW 229


>gi|110677589|ref|YP_680596.1| transglycosylase, putative [Roseobacter denitrificans OCh 114]
 gi|109453705|gb|ABG29910.1| transglycosylase, putative [Roseobacter denitrificans OCh 114]
          Length = 451

 Score =  112 bits (281), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 67/216 (31%), Positives = 110/216 (50%), Gaps = 3/216 (1%)

Query: 28  KATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSP 87
           +A      + +A  F  W +  + RA R+G+   T +  F  + +    I RDR      
Sbjct: 69  EAEMALALATSAAEFDAWVAGFKDRAARQGIRSATLESAFQGVRFDSDVIRRDRNQSEFT 128

Query: 88  PVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMG 147
              ++ YL   +S   IA G A    +   L  +++ YGV   +++A+WGLE+ +G   G
Sbjct: 129 KTIWQ-YLASAASDRRIANGKAALAKHRTTLEAIERRYGVEKEVVVAVWGLESGYGAYRG 187

Query: 148 KTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNV 206
              ++ +LATLAY+ RR  FF EQ   AL +++ G  +   + G+  G +G  QF+P + 
Sbjct: 188 SNDVIRSLATLAYEGRRGAFFEEQLIAALKILQNGDTAPRNMTGSWAGAMGHTQFIPTSY 247

Query: 207 VKYAIDADEDGKIDLVKSN-IDAIASAAKFLAKLGW 241
           + YA+D   DG+ D+   +  DA+AS A +L   GW
Sbjct: 248 LAYAVDFTGDGRRDIWSEDPTDALASTAAYLKNAGW 283


>gi|325918692|ref|ZP_08180790.1| lytic murein transglycosylase [Xanthomonas vesicatoria ATCC 35937]
 gi|325535084|gb|EGD06982.1| lytic murein transglycosylase [Xanthomonas vesicatoria ATCC 35937]
          Length = 423

 Score =  112 bits (281), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 82/275 (29%), Positives = 130/275 (47%), Gaps = 10/275 (3%)

Query: 3   FKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTA--DRFGEWKSAARARAVREGMSP 60
            + +LL    +      AQ VT P  A       + A  + F +W    R RA+  G+  
Sbjct: 10  LRVWLLAGACVTATHAFAQ-VTAPSSAPPDAAEQNPAATESFEQWLVDFRQRALAAGIET 68

Query: 61  KTAKHLFADLEYLDTTIARDRKMVTSPPVS--FKDYLDGLSSSEIIAQGIALKKANSRLL 118
            T    FA +    +  A D++    P  +    +YLD   +   I QG  L  +   L 
Sbjct: 69  TTLDTAFAGVTADPSVHALDQQQ---PEFTRYLWEYLDDRVTPSSIQQGQQLLVSKRTLF 125

Query: 119 INLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDL 178
             L+++YGV P IL A+W +E+ +G  +G   ++ +LATLA+  RR ++   Q   AL +
Sbjct: 126 EQLQRQYGVDPRILTAIWSMESQYGAQIGDRYVIRSLATLAHSGRRTRYGNTQLLAALQI 185

Query: 179 VK--KGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFL 236
           ++  KGV  S  +G+  G +GQ QF+P     YA+DAD D   D+  S+ D++ SAA +L
Sbjct: 186 LQTEKGVDRSQLVGSWAGAMGQTQFIPSTYRDYAVDADGDHTRDVWHSSADSLGSAANYL 245

Query: 237 AKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIA 271
            K  W     +    +  A   +  A +   KT+A
Sbjct: 246 NKSNWNSRLPWGQEVRLAADFDYAQADMTIKKTVA 280


>gi|148652098|ref|YP_001279191.1| lytic murein transglycosylase [Psychrobacter sp. PRwf-1]
 gi|148571182|gb|ABQ93241.1| lytic murein transglycosylase [Psychrobacter sp. PRwf-1]
          Length = 474

 Score =  112 bits (281), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 60/150 (40%), Positives = 88/150 (58%), Gaps = 1/150 (0%)

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
           DYL  L   E +  GI  K   +  L  ++  YGV P  ++ +WG+E++FG+T+GK  L 
Sbjct: 87  DYLSSLVDKERVEDGIRAKHEMADTLRRIEARYGVTPEHVLGVWGVESNFGQTLGKKDLF 146

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAI 211
            +LATL+   RR  +F  ++  AL +V++G I    + G+  G  GQ QF+P   +  A+
Sbjct: 147 QSLATLSCFDRRQSYFRGEYANALKIVQQGDIRPQDMTGSWAGAFGQTQFMPGTFLDLAV 206

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
           D D DG+ DLV S  DA+AS A FLAK G+
Sbjct: 207 DFDGDGRRDLVNSKADALASTANFLAKRGY 236


>gi|330824901|ref|YP_004388204.1| lytic murein transglycosylase [Alicycliphilus denitrificans K601]
 gi|329310273|gb|AEB84688.1| lytic murein transglycosylase [Alicycliphilus denitrificans K601]
          Length = 442

 Score =  112 bits (281), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 70/210 (33%), Positives = 109/210 (51%), Gaps = 6/210 (2%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKM--VTSPPVSFK 92
            +DT   F  W  A    A+  G+  +T   + A  ++    +  DR     T  P +  
Sbjct: 66  TADTIAGFHAWLEAFAREALAAGIHTQTVDAMLARAQWQPRVVELDRAQPEFTRTPWA-- 123

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
            YLD   S + +AQG   ++ ++  L   ++ YGVP  I+ A+WG+E+++G   G    +
Sbjct: 124 -YLDSAVSPQRVAQGREQRRLHAAALEAAEQRYGVPASIITAIWGMESNYGRNFGSFSTI 182

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAI 211
             LATLAYD RR  +   +    L +V +G +++ AL G+  G +G  QFLP   +++A+
Sbjct: 183 DALATLAYDGRRRDWARGELLATLRIVDQGDMAADALVGSWAGAMGHTQFLPSVFLRFAV 242

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
           DAD DG+ D+  S  D  AS A FLA  GW
Sbjct: 243 DADGDGRRDIWGSVPDVAASTANFLAHSGW 272


>gi|91978516|ref|YP_571175.1| lytic murein transglycosylase [Rhodopseudomonas palustris BisB5]
 gi|91684972|gb|ABE41274.1| Lytic murein transglycosylase [Rhodopseudomonas palustris BisB5]
          Length = 462

 Score =  112 bits (281), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 64/204 (31%), Positives = 109/204 (53%), Gaps = 3/204 (1%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F ++ +  + +AV  G+S +        L Y    + RDR       + F  +   ++S 
Sbjct: 56  FDQFLAGLKQQAVAAGVSQRALSAAGPYLVYDQGIVNRDRGQRVFGQI-FTVFAGRMASE 114

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
               +G  + + +++     +K+YGVPP ++ A W LE+ FG   G    L +L +LAYD
Sbjct: 115 GRRVKGQQMIRQHAQAFARAEKDYGVPPAVIAAFWALESDFGAVQGNLSTLRSLVSLAYD 174

Query: 162 CRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
           CRR++ F ++   AL +V +G ++ +  +G+  GE+GQ QFLP +   YA+D D DG  D
Sbjct: 175 CRRSEMFQQETIAALKIVDRGDLAPAEMIGSWAGELGQTQFLPRHYYDYAVDYDGDGHRD 234

Query: 221 LVKSNIDAIASAAKFLAK-LGWTK 243
           +++S  D I S A ++A  L W +
Sbjct: 235 MLRSPADVIGSTAHYIATGLKWRR 258


>gi|294664919|ref|ZP_06730235.1| type III secretion system hopAJ-like protein [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 10535]
 gi|292605319|gb|EFF48654.1| type III secretion system hopAJ-like protein [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 10535]
          Length = 425

 Score =  112 bits (281), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 72/234 (30%), Positives = 116/234 (49%), Gaps = 7/234 (2%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVS--FKDYLDGLS 99
           F +W +  R RA+  G+   T  +  A +    +    D++    P  +    DYLD   
Sbjct: 53  FEQWLADFRQRALAAGIEATTLDNALAGVTPDPSVHELDQQQ---PEFTQYLWDYLDARV 109

Query: 100 SSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLA 159
           +   I +G  L  +   L   L++ YGV PGIL A+W +E+ +G+ +G   ++ +LATLA
Sbjct: 110 TPSAIQEGQQLLISQHALFQKLRQHYGVDPGILTAIWSMESGYGKQIGDFYVIRSLATLA 169

Query: 160 YDCRRAKFFTEQFFYALDLVK--KGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDG 217
           ++ RR  +   Q   AL +++  K +  S  +G+  G +GQ QF+P     YA+D D D 
Sbjct: 170 HEGRRTTYGNTQLLAALQILRTEKNIDRSQLVGSWAGAMGQTQFIPSTYRDYAVDEDGDQ 229

Query: 218 KIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIA 271
           K D+  S  DA+ SAA +L +  WT    +    +  A   +  A L   KT+A
Sbjct: 230 KRDVWNSKADALGSAANYLKQSNWTSAVPWGQEVQLSAGFDYAQADLTIKKTVA 283


>gi|326387761|ref|ZP_08209367.1| lytic murein transglycosylase [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326207807|gb|EGD58618.1| lytic murein transglycosylase [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 351

 Score =  112 bits (281), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 65/199 (32%), Positives = 103/199 (51%), Gaps = 5/199 (2%)

Query: 48  AARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVS---FKDYLDGLSSSEII 104
           AARAR   EG+  +T + + + + +    +  DR     PP S   F+ Y      +  I
Sbjct: 48  AARARG--EGVREQTIRDVISGMTFDPDVVRHDRSQPGGPPSSIPRFEPYRRTHVDAGRI 105

Query: 105 AQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRR 164
            +G A+  +   L   ++  YGVP  +++A+WG ET++G   G   L  ++A+LAY+ RR
Sbjct: 106 DRGRAMLASVGPLATTVETRYGVPASVVLAIWGHETNYGRFTGTYDLPRSIASLAYEGRR 165

Query: 165 AKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKS 224
            + F+ +F   L ++ +GV  S  LG+  G  G  QFLP   ++ A DAD DG  D+  S
Sbjct: 166 RELFSAEFVALLKMIDRGVPRSRLLGSWAGAFGNPQFLPSVYLRVAQDADGDGIADIWTS 225

Query: 225 NIDAIASAAKFLAKLGWTK 243
             D +AS A +    GW +
Sbjct: 226 RPDTLASIANYFRDAGWRR 244


>gi|332288373|ref|YP_004419225.1| murein hydrolase B [Gallibacterium anatis UMN179]
 gi|330431269|gb|AEC16328.1| murein hydrolase B [Gallibacterium anatis UMN179]
          Length = 354

 Score =  112 bits (281), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 66/211 (31%), Positives = 110/211 (52%), Gaps = 11/211 (5%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARD-----RKMVTSP----PVSFK 92
           F ++    R +AV++G+    A +   ++ +++ +I  D     RK    P    P    
Sbjct: 39  FDQYVDYLRQQAVKQGVDANVA-YSQQNIHFIERSIELDQQQAGRKRTAKPNQPNPNGVT 97

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
           +YL+ + +   IA  +      ++ ++     +GV P  L+ALWG+E+ FG   G   +L
Sbjct: 98  NYLNKVLTMNKIALAVRYFSEQNQEIMTASHRFGVQPQYLVALWGMESSFGRYQGNFDVL 157

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAI 211
           S LATLA++ RR   F  +F  AL+++ +G I    + G+  G +GQ QF+P + + YA 
Sbjct: 158 SVLATLAFEGRRESLFAPEFIKALEIIDRGHIEREQMKGSWAGAMGQTQFMPSSYLSYAK 217

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGWT 242
           D D DG  D+  +  DA AS A +LA +GW 
Sbjct: 218 DGDGDGIADIWTNYYDAFASIANYLATVGWN 248


>gi|260779237|ref|ZP_05888129.1| membrane-bound lytic murein transglycosylase B [Vibrio
           coralliilyticus ATCC BAA-450]
 gi|260605401|gb|EEX31696.1| membrane-bound lytic murein transglycosylase B [Vibrio
           coralliilyticus ATCC BAA-450]
          Length = 323

 Score =  112 bits (281), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 63/202 (31%), Positives = 105/202 (51%), Gaps = 2/202 (0%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F ++    +  A ++G+S +T    F D+ Y    +  DR       ++  +Y+      
Sbjct: 24  FEQYVEGLKQEARQKGISEQTISAAFEDVTYKPRAVKADRNQ-PEKKLTLDEYIPRAVPD 82

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             + Q   L   +   L  + +EYGV P  ++ALWG+E++FG+  G   ++  L+T+AYD
Sbjct: 83  WKVKQAKELYVKHKEELQRIGEEYGVQPRFIVALWGVESNFGKFTGNYSVIDALSTMAYD 142

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR  FF  +   AL ++ +G I    + G+  G +GQ QF+P + + YA D   DGK D
Sbjct: 143 GRREAFFRNEAMAALTILDEGHIKPENMKGSWAGAMGQCQFMPSSFLSYAADGSGDGKKD 202

Query: 221 LVKSNIDAIASAAKFLAKLGWT 242
           +  +  D  ASAA +L++ GWT
Sbjct: 203 IWDNEADVFASAANYLSQSGWT 224


>gi|114765851|ref|ZP_01444944.1| hypothetical protein 1100011001323_R2601_11144 [Pelagibaca
           bermudensis HTCC2601]
 gi|114541850|gb|EAU44887.1| hypothetical protein R2601_11144 [Roseovarius sp. HTCC2601]
          Length = 391

 Score =  112 bits (281), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 65/203 (32%), Positives = 105/203 (51%), Gaps = 6/203 (2%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRK--MVTSPPVSFKDYLDGLS 99
           F  +K+  R  AV  G   + A+   +      + + RDR   +  +P + F   L    
Sbjct: 27  FQTFKAGLRDEAVAMGHDAEVARRFLSGARQDSSVLRRDRAQGIFQTPFIEFSRKL---I 83

Query: 100 SSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLA 159
           S + + +G  L +    +   ++++YG+  G+L+A W  ET +G   G    L+ L TLA
Sbjct: 84  SQDRLDRGRQLSQRWDEVFDRIERDYGISRGVLLAFWAFETDYGAFQGDFNTLNALVTLA 143

Query: 160 YDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGK 218
           +DCRR + F  Q F A++L ++G    +   GA  GEIG  Q LP ++++  +D D DG 
Sbjct: 144 HDCRRPEIFRPQIFAAMELYERGDFDPATTTGAWAGEIGMVQMLPRDILENGMDGDGDGH 203

Query: 219 IDLVKSNIDAIASAAKFLAKLGW 241
           + L  S  DA+ S AK L++LGW
Sbjct: 204 VTLKTSAPDALLSGAKMLSELGW 226


>gi|299529933|ref|ZP_07043361.1| lytic murein transglycosylase [Comamonas testosteroni S44]
 gi|298722105|gb|EFI63034.1| lytic murein transglycosylase [Comamonas testosteroni S44]
          Length = 444

 Score =  112 bits (280), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 75/234 (32%), Positives = 117/234 (50%), Gaps = 13/234 (5%)

Query: 39  ADRFGEWKS--AARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLD 96
           A  F  WK   A RARA   G+S +T +   A      + +  DR         ++ YLD
Sbjct: 66  ASNFAHWKQEFAPRARAA--GISERTLRSALAGARLQPSIVKLDRSQPEFTRTPWQ-YLD 122

Query: 97  GLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLA 156
              S++ I  G    +  +  L    + YGVP  ++ A+WG+E+++G   G    +  LA
Sbjct: 123 SAVSAQRIRTGKLKMQEYAASLQAASQRYGVPAPVIAAIWGMESNYGSNFGSFSAVDALA 182

Query: 157 TLAYDCRRAKFFTEQFFYALDLVKKGVI-SSHALGATFGEIGQFQFLPVNVVKYAIDADE 215
           TLA+D RRA++  ++   AL ++  G I ++H + +  G +G  QFLP   ++YA+DAD 
Sbjct: 183 TLAFDGRRAEWAQKELIAALRIIDNGDIDAAHMISSWAGAMGNTQFLPSVFLQYAVDADG 242

Query: 216 DGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKT 269
           DG+ D+  S  D  AS A +LA  GW       PGE  + +     A  +Y +T
Sbjct: 243 DGRRDIWGSMADVAASTANYLASSGWN------PGEP-WGVEVRLPADFDYART 289


>gi|93007070|ref|YP_581507.1| lytic murein transglycosylase [Psychrobacter cryohalolentis K5]
 gi|92394748|gb|ABE76023.1| Lytic murein transglycosylase [Psychrobacter cryohalolentis K5]
          Length = 490

 Score =  112 bits (280), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 60/150 (40%), Positives = 90/150 (60%), Gaps = 1/150 (0%)

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
           DYL  L  +E +  GI  K+  +  L  ++  YGV    ++ +WG+E++FG+T+GK PL 
Sbjct: 88  DYLSSLVDTERVEDGIRAKRQWADTLRKIESRYGVKAEHVLGVWGVESNFGQTLGKKPLF 147

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAI 211
            +LATL+   RR  +F  ++  AL +V+ G I+ S   G+  G  GQ QF+P   ++ A+
Sbjct: 148 ESLATLSCFDRRQSYFQGEYANALKIVQNGDIAPSDMTGSWAGAFGQTQFMPSTFLELAV 207

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
           D D DG+ DLV S  DA+AS A FL K G+
Sbjct: 208 DFDGDGRRDLVNSVPDALASTANFLDKRGY 237


>gi|316935913|ref|YP_004110895.1| lytic murein transglycosylase [Rhodopseudomonas palustris DX-1]
 gi|315603627|gb|ADU46162.1| lytic murein transglycosylase [Rhodopseudomonas palustris DX-1]
          Length = 460

 Score =  112 bits (280), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 66/204 (32%), Positives = 106/204 (51%), Gaps = 3/204 (1%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F ++ +  + +AV  G+S          L Y    + RDR       + F  +   ++S 
Sbjct: 61  FPQFLAGLKQKAVAAGVSQGAIAQASPYLVYDQGIVNRDRGQRVFGQI-FTVFAGRMASE 119

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
               +G  L K  +      +KEYGVPP ++ A W LE+ FG   G    L +L +LAYD
Sbjct: 120 GRRVKGQQLIKQYANAFARAEKEYGVPPAVIAAFWALESDFGAVQGNLSTLRSLVSLAYD 179

Query: 162 CRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
           CRR++ F ++   AL ++ +G ++ +  +G+  GE+GQ QFLP +   YA+D D DG  D
Sbjct: 180 CRRSEMFQDETIAALKIIDRGDLTPAEMIGSWAGELGQTQFLPQHYYDYAVDYDGDGHRD 239

Query: 221 LVKSNIDAIASAAKFLAK-LGWTK 243
           +++S  D I S A ++A  L W +
Sbjct: 240 MLRSAPDVIGSTAHYIATGLKWRR 263


>gi|222149157|ref|YP_002550114.1| lytic murein transglycosylase [Agrobacterium vitis S4]
 gi|221736142|gb|ACM37105.1| lytic murein transglycosylase [Agrobacterium vitis S4]
          Length = 396

 Score =  112 bits (280), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 66/198 (33%), Positives = 100/198 (50%), Gaps = 2/198 (1%)

Query: 47  SAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQ 106
           +  +A AV  G S + A    A  +     + RDR        +F ++     S   + Q
Sbjct: 37  AGVKAEAVANGASAEAADKALAGAQIDQKVLGRDRAQGVFKQ-TFTEFSTRTVSKGRLDQ 95

Query: 107 GIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAK 166
           G    +  S +    +KEYGV PG++ A W +ET FG   G     + L TLA+DCRR +
Sbjct: 96  GKQKLQQYSAVFDRAEKEYGVAPGVIAAFWAMETDFGAVQGDFNTRNALVTLAHDCRRPE 155

Query: 167 FFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSN 225
            F  Q    + +V+ G +  +   GA  GE+GQ Q LP ++V + +D D DG + L  S+
Sbjct: 156 LFRPQLLALITMVQHGDLDPATNTGAWAGEVGQVQMLPKDIVAFGVDGDGDGHVALKSSS 215

Query: 226 IDAIASAAKFLAKLGWTK 243
            DAI +AAKF+  LG+ +
Sbjct: 216 PDAIMTAAKFIQHLGFKR 233


>gi|285019884|ref|YP_003377595.1| membrane bound lytic murein transglycosylase b transmembrane
           protein [Xanthomonas albilineans GPE PC73]
 gi|283475102|emb|CBA17601.1| putative membrane bound lytic murein transglycosylase b
           transmembrane protein [Xanthomonas albilineans]
          Length = 462

 Score =  112 bits (280), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 60/150 (40%), Positives = 88/150 (58%), Gaps = 1/150 (0%)

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
           DYL GL  ++ I  G A+  A+  LL ++ ++YGV    ++A+WG+E+ +G + GK PLL
Sbjct: 84  DYLAGLVDTQRIDDGRAMLSAHRDLLAHVAQQYGVDAQTVVAVWGVESDYGRSTGKRPLL 143

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAI 211
            +L TLA + RR  FF  + F  L L++ G +    L G+  G  G  QF+P    + A+
Sbjct: 144 VSLLTLACNGRRQPFFRGELFALLKLLQAGDLKPEGLTGSWAGAFGHTQFMPSTYARIAV 203

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
           D D DG+ DLV S  DA+AS A +L   GW
Sbjct: 204 DGDGDGRRDLVASLPDALASTAHYLKLSGW 233


>gi|15602378|ref|NP_245450.1| hypothetical protein PM0513 [Pasteurella multocida subsp. multocida
           str. Pm70]
 gi|12720773|gb|AAK02597.1| unknown [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 364

 Score =  112 bits (280), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 77/267 (28%), Positives = 132/267 (49%), Gaps = 33/267 (12%)

Query: 1   MSFKKYLLISLLMMVYPMLAQA---VTQPKKATTQFICSDTADRFGEWKSAARARAVREG 57
           MS K +  +S L++   ++  A      P    +QF  +   + F ++    + +A  EG
Sbjct: 1   MSIKLWFRVSGLLLSLILVGCANKPPITPLATGSQFSKARQVENFSDYVIFLKRKARAEG 60

Query: 58  MSPKTAKHLFADLEYLDTTIARDRKM------------VTSPPVSFKDYLD--------G 97
           +S +T      D++Y+   I  DR+             V S P     YL+         
Sbjct: 61  VSEQTLND-HNDIQYISRAIELDRQQAGRVQKRDPNAPVRSNPHGTTHYLNRVLTQRKVD 119

Query: 98  LSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLAT 157
           +++S    Q   L+KA+ R        +GV    LM+LWG+E+ FG   G+  +LS LAT
Sbjct: 120 VATSRYWEQQAQLEKASQR--------FGVQKEYLMSLWGMESSFGHYQGQYDVLSVLAT 171

Query: 158 LAYDCRRAKFFTEQFFYALDLV-KKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADED 216
           LA++ RR   F+ +F  A+ ++ ++ +     LG+  G +GQ QF+P + ++YA D + D
Sbjct: 172 LAFEGRRESLFSREFVSAMKMLERRDIPRQKMLGSWAGAMGQTQFMPSSYLRYAADGNHD 231

Query: 217 GKIDLVKSNIDAIASAAKFLAKLGWTK 243
           G+ D+ K++ D  AS A +L+ +GW K
Sbjct: 232 GEKDIWKNHDDVFASIASYLSTVGWDK 258


>gi|33592814|ref|NP_880458.1| putative peptidoglycan-binding protein [Bordetella pertussis Tohama
           I]
 gi|33572462|emb|CAE42032.1| putative peptidoglycan-binding protein [Bordetella pertussis Tohama
           I]
 gi|332382227|gb|AEE67074.1| putative peptidoglycan-binding protein [Bordetella pertussis CS]
          Length = 409

 Score =  112 bits (280), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 56/150 (37%), Positives = 88/150 (58%), Gaps = 1/150 (0%)

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
           DY+ GL   E I  G      ++ +L   + EYGV P  ++A+WG+E++FG+ +G  PLL
Sbjct: 89  DYMAGLVDEERIEDGRQALARHADVLARAQAEYGVDPATVVAVWGVESNFGKNLGGRPLL 148

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATF-GEIGQFQFLPVNVVKYAI 211
           ++L+TL+   RR  +F  +FF  L +++   +    L  ++ G  GQ QF+P   ++ A+
Sbjct: 149 TSLSTLSCFGRRQSYFRGEFFATLKIIQDEHMQPERLAGSWAGAFGQTQFMPSTYLRLAV 208

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
           D D DG+ DLV S  DA+ S A FL + GW
Sbjct: 209 DFDGDGRRDLVDSVPDALGSTANFLRRAGW 238


>gi|33597706|ref|NP_885349.1| putative peptidoglycan-binding protein [Bordetella parapertussis
           12822]
 gi|33602554|ref|NP_890114.1| putative peptidoglycan-binding protein [Bordetella bronchiseptica
           RB50]
 gi|33574134|emb|CAE38463.1| putative peptidoglycan-binding protein [Bordetella parapertussis]
 gi|33576993|emb|CAE34073.1| putative peptidoglycan-binding protein [Bordetella bronchiseptica
           RB50]
          Length = 409

 Score =  112 bits (280), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 56/150 (37%), Positives = 88/150 (58%), Gaps = 1/150 (0%)

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
           DY+ GL   E I  G      ++ +L   + EYGV P  ++A+WG+E++FG+ +G  PLL
Sbjct: 89  DYMAGLVDEERIEDGRQALARHADVLARAQAEYGVDPATVVAVWGVESNFGKNLGGRPLL 148

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATF-GEIGQFQFLPVNVVKYAI 211
           ++L+TL+   RR  +F  +FF  L +++   +    L  ++ G  GQ QF+P   ++ A+
Sbjct: 149 TSLSTLSCFGRRQSYFRGEFFATLKIIQDEHMQPERLAGSWAGAFGQTQFMPSTYLRLAV 208

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
           D D DG+ DLV S  DA+ S A FL + GW
Sbjct: 209 DFDGDGRRDLVDSVPDALGSTANFLRRAGW 238


>gi|15596368|ref|NP_249862.1| transglycolase [Pseudomonas aeruginosa PAO1]
 gi|254234305|ref|ZP_04927628.1| hypothetical protein PACG_00144 [Pseudomonas aeruginosa C3719]
 gi|9947095|gb|AAG04560.1|AE004547_6 probable transglycolase [Pseudomonas aeruginosa PAO1]
 gi|126166236|gb|EAZ51747.1| hypothetical protein PACG_00144 [Pseudomonas aeruginosa C3719]
          Length = 398

 Score =  112 bits (280), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 85/267 (31%), Positives = 124/267 (46%), Gaps = 36/267 (13%)

Query: 27  KKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTS 86
           KKA  Q I +D+ +RF                       L ADL  LD   A+     T+
Sbjct: 34  KKAQAQGISADSYERF--------------------TSGLQADLSVLDLLDAQPE--FTT 71

Query: 87  PPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETM 146
           P     DYL GL   + ++ G A+   + +LL  +   YGV    ++A+WG+E+ +G   
Sbjct: 72  P---LWDYLAGLVDEQRVSDGKAMLAQHDKLLDQVAARYGVDKYTVVAVWGVESDYGRIF 128

Query: 147 GKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVN 205
           GK PLL++L+TL+   RR  FF  +F   L L++ G I    + G+  G  G  QF+P  
Sbjct: 129 GKRPLLTSLSTLSCYGRRQSFFQGEFLATLKLLQAGDIRDAGITGSWAGAFGHTQFMPST 188

Query: 206 VVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASL- 264
             + A+D D DG+ DLV S  DA+ S A +L K GW      QP      +   + ASL 
Sbjct: 189 YARIAVDFDGDGRRDLVGSVPDALGSTANYLKKAGWRTG---QPWGYEVKVPADFPASLA 245

Query: 265 ---NYNKTIAYIA---AHIDGVPIGKG 285
                    A++A     +DG P+  G
Sbjct: 246 GRGKRQPLSAWVARGVRRVDGQPLPGG 272


>gi|107100620|ref|ZP_01364538.1| hypothetical protein PaerPA_01001646 [Pseudomonas aeruginosa PACS2]
 gi|296390459|ref|ZP_06879934.1| transglycolase [Pseudomonas aeruginosa PAb1]
          Length = 398

 Score =  112 bits (280), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 85/267 (31%), Positives = 124/267 (46%), Gaps = 36/267 (13%)

Query: 27  KKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTS 86
           KKA  Q I +D+ +RF                       L ADL  LD   A+     T+
Sbjct: 34  KKAQAQGISADSYERF--------------------TSGLQADLSVLDLLDAQPE--FTT 71

Query: 87  PPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETM 146
           P     DYL GL   + ++ G A+   + +LL  +   YGV    ++A+WG+E+ +G   
Sbjct: 72  P---LWDYLAGLVDEQRVSDGKAMLAQHDKLLDQVAARYGVDKYTVVAVWGVESDYGRIF 128

Query: 147 GKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVN 205
           GK PLL++L+TL+   RR  FF  +F   L L++ G I    + G+  G  G  QF+P  
Sbjct: 129 GKRPLLTSLSTLSCYGRRQSFFQGEFLATLKLLQAGDIRDAGITGSWAGAFGHTQFMPST 188

Query: 206 VVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASL- 264
             + A+D D DG+ DLV S  DA+ S A +L K GW      QP      +   + ASL 
Sbjct: 189 YARIAVDFDGDGRRDLVGSVPDALGSTANYLKKAGWRTG---QPWGYEVKVPADFPASLA 245

Query: 265 ---NYNKTIAYIA---AHIDGVPIGKG 285
                    A++A     +DG P+  G
Sbjct: 246 GRGKRQPLSAWVARGVRRVDGQPLPGG 272


>gi|326571087|gb|EGE21111.1| putative lytic murein transglycosylase [Moraxella catarrhalis BC7]
          Length = 468

 Score =  112 bits (280), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 66/209 (31%), Positives = 110/209 (52%), Gaps = 5/209 (2%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F EWK     RA+ +G++  +   L  +       IA DR       + + +Y++  +SS
Sbjct: 103 FAEWKHDFIHRALAKGINANSLNSLMGNATLNQRVIALDRSQAEFTKMPW-EYVESAASS 161

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             I+QG +    N  +L + +  YG P  I  A+WG+E+ +G  MG   L+S L++LAYD
Sbjct: 162 NRISQGRSKLNENLSILTSAESIYGTPKEITAAIWGMESSYGAGMGSMDLVSALSSLAYD 221

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR +F   Q    L ++++G +++  L G+  G +G  QF+P   ++ +ID D +G+ +
Sbjct: 222 GRRREFAENQLLAMLLMIERGDVAASQLKGSWAGGMGHTQFIPTTWIQESIDGDANGRKN 281

Query: 221 LVKSNIDAIASAAKFLAKLGWTKCAGYQP 249
                 DA+ S A +LA  GW +  G QP
Sbjct: 282 PWNRQ-DALTSTASYLANAGWIR--GLQP 307


>gi|294625350|ref|ZP_06703986.1| type III secretion system hopAJ-like protein [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 11122]
 gi|292600368|gb|EFF44469.1| type III secretion system hopAJ-like protein [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 11122]
          Length = 425

 Score =  112 bits (280), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 72/234 (30%), Positives = 116/234 (49%), Gaps = 7/234 (2%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVS--FKDYLDGLS 99
           F +W +  R RA+  G+   T  +  A +    +    D++    P  +    DYLD   
Sbjct: 53  FEQWLADFRQRALAAGIEATTLDNALAGVTPDPSVHELDQQQ---PEFTQYLWDYLDARV 109

Query: 100 SSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLA 159
           +   I +G  L  +   L   L++ YGV PGIL A+W +E+ +G+ +G   ++ +LATLA
Sbjct: 110 TPSAIQEGQQLLISQHALFQKLRQHYGVDPGILTAIWSMESGYGKQIGDFYVIRSLATLA 169

Query: 160 YDCRRAKFFTEQFFYALDLVK--KGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDG 217
           ++ RR  +   Q   AL +++  K +  S  +G+  G +GQ QF+P     YA+D D D 
Sbjct: 170 HEGRRTTYGNTQLLAALQILQTEKNIDRSQLVGSWAGAMGQTQFIPSTYRDYAVDEDGDQ 229

Query: 218 KIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIA 271
           K D+  S  DA+ SAA +L +  WT    +    +  A   +  A L   KT+A
Sbjct: 230 KRDVWNSKADALGSAANYLKQSNWTSAVPWGQEVQLSAGFDYAQADLTIKKTVA 283


>gi|313106144|ref|ZP_07792398.1| putative transglycosylase [Pseudomonas aeruginosa 39016]
 gi|310878900|gb|EFQ37494.1| putative transglycosylase [Pseudomonas aeruginosa 39016]
          Length = 398

 Score =  112 bits (280), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 74/216 (34%), Positives = 107/216 (49%), Gaps = 26/216 (12%)

Query: 27  KKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTS 86
           KKA  Q I +D+ +RF                       L ADL  LD   A+     T+
Sbjct: 34  KKAQAQGISADSYERF--------------------TSGLQADLSVLDLLDAQPE--FTT 71

Query: 87  PPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETM 146
           P     DYL GL   + ++ G A+   + +LL  +   YGV    ++A+WG+E+ +G   
Sbjct: 72  P---LWDYLAGLVDEQRVSDGKAMLAQHDKLLDQVAARYGVDKYTVVAVWGVESDYGRIF 128

Query: 147 GKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVN 205
           GK PLL++L+TL+   RR  FF  +F   L L++ G I    + G+  G  G  QF+P  
Sbjct: 129 GKRPLLTSLSTLSCYGRRQSFFQGEFLATLKLLQAGDIRDAGITGSWAGAFGHTQFMPST 188

Query: 206 VVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
             + A+D D DG+ DLV S  DA+ S A +L K GW
Sbjct: 189 YARIAVDFDGDGRRDLVGSVPDALGSTANYLKKAGW 224


>gi|326575725|gb|EGE25648.1| putative lytic murein transglycosylase [Moraxella catarrhalis CO72]
          Length = 420

 Score =  112 bits (279), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 66/209 (31%), Positives = 110/209 (52%), Gaps = 5/209 (2%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F EWK     RA+ +G++  +   L  +       IA DR       + + +Y++  +SS
Sbjct: 103 FAEWKHDFIHRALAKGINANSLNSLMGNATLNQRVIALDRSQAEFTKMPW-EYVESAASS 161

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             I+QG +    N  +L + +  YG P  I  A+WG+E+ +G  MG   L+S L++LAYD
Sbjct: 162 NRISQGRSKLNENLSILTSAESIYGTPKEITAAIWGMESSYGAGMGSMDLVSALSSLAYD 221

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR +F   Q    L ++++G +++  L G+  G +G  QF+P   ++ +ID D +G+ +
Sbjct: 222 GRRREFAENQLLAMLLMIERGDVAASQLKGSWAGGMGHTQFIPTTWIQESIDGDANGRKN 281

Query: 221 LVKSNIDAIASAAKFLAKLGWTKCAGYQP 249
                 DA+ S A +LA  GW +  G QP
Sbjct: 282 PWNRQ-DALTSTASYLANAGWIR--GLQP 307


>gi|116049103|ref|YP_792095.1| transglycolase [Pseudomonas aeruginosa UCBPP-PA14]
 gi|115584324|gb|ABJ10339.1| probable transglycolase [Pseudomonas aeruginosa UCBPP-PA14]
          Length = 398

 Score =  112 bits (279), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 74/216 (34%), Positives = 107/216 (49%), Gaps = 26/216 (12%)

Query: 27  KKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTS 86
           KKA  Q I +D+ +RF                       L ADL  LD   A+     T+
Sbjct: 34  KKAQAQGISADSYERF--------------------TSGLQADLSVLDLLDAQPE--FTT 71

Query: 87  PPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETM 146
           P     DYL GL   + ++ G A+   + +LL  +   YGV    ++A+WG+E+ +G   
Sbjct: 72  P---LWDYLAGLVDEQRVSDGKAMLAQHDKLLDQVAARYGVDKYTVVAVWGVESDYGRIF 128

Query: 147 GKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVN 205
           GK PLL++L+TL+   RR  FF  +F   L L++ G I    + G+  G  G  QF+P  
Sbjct: 129 GKRPLLTSLSTLSCYGRRQSFFQGEFLATLKLLQAGDIRDAGITGSWAGAFGHTQFMPST 188

Query: 206 VVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
             + A+D D DG+ DLV S  DA+ S A +L K GW
Sbjct: 189 YARIAVDFDGDGRRDLVGSVPDALGSTANYLKKAGW 224


>gi|227822672|ref|YP_002826644.1| lytic murein transglycosylase [Sinorhizobium fredii NGR234]
 gi|227341673|gb|ACP25891.1| lytic murein transglycosylase [Sinorhizobium fredii NGR234]
          Length = 405

 Score =  112 bits (279), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 81/290 (27%), Positives = 118/290 (40%), Gaps = 59/290 (20%)

Query: 50  RARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIA 109
           +  AV +G+    A    A        ++RDR        +F ++     S   +  G  
Sbjct: 49  KTEAVGKGIPADVADRALAGAALDQKVLSRDRAQGVFK-QTFTEFSKRTVSKGRLDIGAQ 107

Query: 110 LKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFT 169
             K  + +    + E+GVP  ++ A W +ET FG   G     + L TLA+DCRR + F 
Sbjct: 108 KMKEYADVFARAEGEFGVPAPVITAFWAMETDFGAVQGDFNTRNALVTLAHDCRRPEMFR 167

Query: 170 EQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDA 228
            Q   A+++V+ G +   A  GA  GEIGQ Q LP +++ Y +D D DG ++L KS+ DA
Sbjct: 168 PQLLSAIEMVQHGDLDPAATTGAWAGEIGQVQMLPEDIIAYGVDGDGDGHVNLKKSSPDA 227

Query: 229 IASAAKFLAKLGWT-----------------KCAGYQPGE-------------------- 251
           I +AAKF+  LG+T                 +  G QPG                     
Sbjct: 228 ILTAAKFIKSLGFTAGQPWIQEVALPDQLPWEKTGLQPGMTAGDWFALGVAPRDGNTSHG 287

Query: 252 --------------------KNFAILKHWNASLNYNKTIAYIAAHIDGVP 281
                                NF I   WN S  Y  + AY A  + G P
Sbjct: 288 ALEASLVLPQGRKGVAFLTYPNFKIYLEWNQSFIYTTSAAYFATRLAGAP 337


>gi|254239539|ref|ZP_04932861.1| hypothetical protein PA2G_00155 [Pseudomonas aeruginosa 2192]
 gi|126192917|gb|EAZ56980.1| hypothetical protein PA2G_00155 [Pseudomonas aeruginosa 2192]
          Length = 398

 Score =  112 bits (279), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 85/267 (31%), Positives = 124/267 (46%), Gaps = 36/267 (13%)

Query: 27  KKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTS 86
           KKA  Q I +D+ +RF                       L ADL  LD   A+     T+
Sbjct: 34  KKAQAQGISADSYERF--------------------TSGLQADLSVLDLLGAQPE--FTT 71

Query: 87  PPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETM 146
           P     DYL GL   + ++ G A+   + +LL  +   YGV    ++A+WG+E+ +G   
Sbjct: 72  P---LWDYLAGLVDEQRVSDGKAMLAQHDKLLDQVAARYGVDKYTVVAVWGVESDYGRIF 128

Query: 147 GKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVN 205
           GK PLL++L+TL+   RR  FF  +F   L L++ G I    + G+  G  G  QF+P  
Sbjct: 129 GKRPLLTSLSTLSCYGRRQSFFQGEFLATLKLLQAGDIRDAGITGSWAGAFGHTQFMPST 188

Query: 206 VVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASL- 264
             + A+D D DG+ DLV S  DA+ S A +L K GW      QP      +   + ASL 
Sbjct: 189 YARIAVDFDGDGRRDLVGSVPDALGSTANYLKKAGWRTG---QPWGYEVKVPADFPASLA 245

Query: 265 ---NYNKTIAYIA---AHIDGVPIGKG 285
                    A++A     +DG P+  G
Sbjct: 246 GRGKRQPLSAWVARGVRRVDGQPLPGG 272


>gi|110678651|ref|YP_681658.1| lytic murein transglycosylase, putative [Roseobacter denitrificans
           OCh 114]
 gi|109454767|gb|ABG30972.1| lytic murein transglycosylase, putative [Roseobacter denitrificans
           OCh 114]
          Length = 390

 Score =  112 bits (279), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 67/205 (32%), Positives = 100/205 (48%), Gaps = 6/205 (2%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIA--RDRKMVTSPPVSFKDYLDGLS 99
           F  +    +A AV +G +P +    F+ +    + +   RD+ M   P   F D+   L 
Sbjct: 27  FNNFVQNMKAEAVSKGHAPASVDRFFSGIRQSQSVLRADRDQGMFQRP---FLDFSRNLI 83

Query: 100 SSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLA 159
           S   +++G  L +    +  ++ + YGV  G+L+A W  ET +G   G     + L TLA
Sbjct: 84  SDARLSKGQRLGREYDAVFDSIDRRYGVSRGVLLAFWAFETAYGTYQGDFNTANALVTLA 143

Query: 160 YDCRRAKFFTEQFFYALDLVKKGVISSH-ALGATFGEIGQFQFLPVNVVKYAIDADEDGK 218
           +DCRR   F  Q F AL+L + G        GA  GEIG  Q LP ++++   DAD DG 
Sbjct: 144 HDCRRPDLFRPQVFAALELYEMGDFDPKTTTGAWAGEIGMVQMLPRDILENGQDADGDGH 203

Query: 219 IDLVKSNIDAIASAAKFLAKLGWTK 243
           + L  S  DA+ S A  LA  GW +
Sbjct: 204 VRLKTSAPDALMSGAAMLADFGWRR 228


>gi|322514411|ref|ZP_08067454.1| membrane-bound lytic murein transglycosylase B [Actinobacillus
           ureae ATCC 25976]
 gi|322119659|gb|EFX91717.1| membrane-bound lytic murein transglycosylase B [Actinobacillus
           ureae ATCC 25976]
          Length = 362

 Score =  112 bits (279), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 70/221 (31%), Positives = 111/221 (50%), Gaps = 11/221 (4%)

Query: 32  QFICSDTADRFGEWKSAARARAVREGMSPKTAK-----HLFADLEYLDTTIARDRKMVTS 86
           Q+  + T + F ++    + +A   G+S KT       H  A    LD   A  ++   +
Sbjct: 34  QYNKARTLNNFNDYVHFLKQKAAAAGVSDKTLNTQCFIHYNARAVQLDQQQAGRKRDPNA 93

Query: 87  P-----PVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETH 141
           P     P    +YL+ + +   +   +      S  L    ++YGV    +MALWG+E+ 
Sbjct: 94  PVPQPNPNGVTNYLNKVLTQAKVNTAVEKWYEFSSPLTKASQKYGVQKEYIMALWGMESS 153

Query: 142 FGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQ 200
           FG   G   +LS LATLA+D RR K FT++F  A+ ++  G I+ + + G+  G +GQ Q
Sbjct: 154 FGRYQGDFDVLSVLATLAFDGRREKLFTQEFVNAMKMLDDGTINRYEMQGSWAGAMGQTQ 213

Query: 201 FLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
           F+P   + Y  D D DGK D+  +  DA AS A +L+ +GW
Sbjct: 214 FMPTVYLSYDADGDGDGKKDIWNNEADAFASIASYLSTVGW 254


>gi|254510501|ref|ZP_05122568.1| peptidoglycan binding domain protein [Rhodobacteraceae bacterium
           KLH11]
 gi|221534212|gb|EEE37200.1| peptidoglycan binding domain protein [Rhodobacteraceae bacterium
           KLH11]
          Length = 430

 Score =  112 bits (279), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 74/206 (35%), Positives = 115/206 (55%), Gaps = 5/206 (2%)

Query: 41  RFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVT-SPPVSFKDYLDGLS 99
           RF  W  A RARA  +G+   T     A + Y    I RDR     S P+   +YLD   
Sbjct: 61  RFQAWLGAFRARAQAQGILGSTLDRALAGVTYDSDVIKRDRNQAEFSKPI--WEYLDSAV 118

Query: 100 SSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLA 159
           S   ++ G A    +   L  ++ +YGV   ++ A+WGLET FG   G    + +LATLA
Sbjct: 119 SDTRVSNGRAGLAQHQDTLTRIEAQYGVEKEVVTAIWGLETAFGTYRGSDQTIRSLATLA 178

Query: 160 YDCRRAKFFTEQFFYALDLVKKG-VISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGK 218
           +D RR++FF  Q   AL +++ G V +++ +G+  G +G  QF+P + +++A+D D DG+
Sbjct: 179 FDGRRSRFFEAQLIAALQIIQAGDVGAANMVGSWAGAMGHTQFMPTSFLEHAVDFDGDGR 238

Query: 219 IDLVKSN-IDAIASAAKFLAKLGWTK 243
            D+   +  DA+ASAA +LA+ GW +
Sbjct: 239 RDIWSDDPTDALASAAAYLARHGWKQ 264


>gi|194367769|ref|YP_002030379.1| lytic murein transglycosylase [Stenotrophomonas maltophilia R551-3]
 gi|194350573|gb|ACF53696.1| lytic murein transglycosylase [Stenotrophomonas maltophilia R551-3]
          Length = 422

 Score =  112 bits (279), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 85/150 (56%), Gaps = 1/150 (0%)

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
           DYL  L   + +  G A+ + +  LL  +  +YGV P  ++A+WG+E+ +G   GK PLL
Sbjct: 81  DYLAALVDRQRVDDGRAMLQQHRDLLDRVSAQYGVDPTTIVAVWGVESDYGRVFGKRPLL 140

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAI 211
            +LATL+   RR  FF  +    L L+ +G + +  L G+  G  G  QF+P    + A+
Sbjct: 141 QSLATLSCAGRRQAFFRGELLALLKLIDRGDLQAQGLTGSWAGAFGHTQFMPSTYARIAV 200

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
           D D DG+ DLV S  DA+AS A +L + GW
Sbjct: 201 DGDGDGRRDLVGSIPDALASTANYLKRAGW 230


>gi|289665049|ref|ZP_06486630.1| transglycosylase [Xanthomonas campestris pv. vasculorum NCPPB702]
          Length = 425

 Score =  111 bits (278), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 71/232 (30%), Positives = 114/232 (49%), Gaps = 3/232 (1%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F +W +  R RA+  G+   T  + FA +   D ++ +  +          DYLD   + 
Sbjct: 53  FEQWLADFRQRALAAGIEATTLDNAFAGVT-PDPSVQKLDQQQPEFTSYLWDYLDARVTP 111

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             I +G  L  +   L   L++ +GV PGIL A+W +E+ +G  +G   ++ +LATLA++
Sbjct: 112 SAIQEGQQLLISQHALFEKLRQHHGVDPGILTAIWSMESGYGTQIGDFYVIRSLATLAHE 171

Query: 162 CRRAKFFTEQFFYALDLVK--KGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKI 219
            RR  +   Q   AL +++  K +  S  +G+  G +GQ QF+P     YA+D D D K 
Sbjct: 172 GRRTTYGNTQLLAALQILQTEKSIARSQLVGSWAGAMGQTQFIPSTYRDYAVDEDGDQKR 231

Query: 220 DLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIA 271
           D+  S  DA+ SAA +L +  WT    +       A   +  A L   KT+A
Sbjct: 232 DVWNSKADALGSAANYLKQNNWTSAVPWGQEVHLPAGFDYAQADLTIKKTVA 283


>gi|218892865|ref|YP_002441734.1| putative transglycolase [Pseudomonas aeruginosa LESB58]
 gi|218773093|emb|CAW28905.1| probable transglycolase [Pseudomonas aeruginosa LESB58]
          Length = 398

 Score =  111 bits (278), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 85/267 (31%), Positives = 124/267 (46%), Gaps = 36/267 (13%)

Query: 27  KKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTS 86
           KKA  Q I +D+ +RF                       L ADL  LD   A+     T+
Sbjct: 34  KKAQAQGISADSYERF--------------------TSGLQADLSVLDLLDAQPE--FTT 71

Query: 87  PPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETM 146
           P     DYL GL   + ++ G A+   + +LL  +   YGV    ++A+WG+E+ +G   
Sbjct: 72  P---LWDYLAGLVDEQRVSDGKAMLAQHDKLLDQVAVRYGVDKYTVVAVWGVESDYGRIF 128

Query: 147 GKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVN 205
           GK PLL++L+TL+   RR  FF  +F   L L++ G I    + G+  G  G  QF+P  
Sbjct: 129 GKRPLLTSLSTLSCYGRRQSFFQGEFLATLKLLQAGDIRDAGITGSWAGAFGHTQFMPST 188

Query: 206 VVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASL- 264
             + A+D D DG+ DLV S  DA+ S A +L K GW      QP      +   + ASL 
Sbjct: 189 YARIAVDFDGDGRRDLVGSVPDALGSTANYLKKAGWRTG---QPWGYEVKVPADFPASLA 245

Query: 265 ---NYNKTIAYIA---AHIDGVPIGKG 285
                    A++A     +DG P+  G
Sbjct: 246 GRGKRQPLSAWVARGVRRVDGQPLPGG 272


>gi|221065451|ref|ZP_03541556.1| lytic murein transglycosylase [Comamonas testosteroni KF-1]
 gi|220710474|gb|EED65842.1| lytic murein transglycosylase [Comamonas testosteroni KF-1]
          Length = 445

 Score =  111 bits (278), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 66/205 (32%), Positives = 104/205 (50%), Gaps = 2/205 (0%)

Query: 39  ADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGL 98
           A  F  WK     RA   G+S +T     A  +   + +  DR         ++ YLD  
Sbjct: 67  ARNFAHWKQEFAPRARAAGISERTLGSALAGAKLQPSIVKLDRSQPEFTRTPWQ-YLDSA 125

Query: 99  SSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATL 158
            S++ I  G    + +   L    + YGVP  ++ A+WG+E+++G   G    +  LATL
Sbjct: 126 VSAQRIKTGKLKMQEHGASLQAASQRYGVPAPVIAAIWGMESNYGSNFGSFSAVDALATL 185

Query: 159 AYDCRRAKFFTEQFFYALDLVKKGVI-SSHALGATFGEIGQFQFLPVNVVKYAIDADEDG 217
           A+D RRA++  ++   AL ++  G I ++H + +  G +G  QFLP   ++YA+DAD DG
Sbjct: 186 AFDGRRAEWAQKELIAALRIIDNGDIDAAHMISSWAGAMGNTQFLPSVFLQYAVDADGDG 245

Query: 218 KIDLVKSNIDAIASAAKFLAKLGWT 242
           + D+  S  D  AS A +LA  GW 
Sbjct: 246 RRDIWGSMADVAASTANYLASAGWN 270


>gi|163852687|ref|YP_001640730.1| lytic murein transglycosylase [Methylobacterium extorquens PA1]
 gi|163664292|gb|ABY31659.1| lytic murein transglycosylase [Methylobacterium extorquens PA1]
          Length = 393

 Score =  111 bits (278), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 71/195 (36%), Positives = 105/195 (53%), Gaps = 5/195 (2%)

Query: 50  RARAVREGMSPKTAKHLFADLEYLDT-TIARDRKMVT-SPPVSFKDYLDGLSSSEIIAQG 107
           R  A   G+S KT    FA ++  D   +AR R+    S PV   DYL G  S   I +G
Sbjct: 34  RPDATARGISQKTFDAAFAGVQAPDPDVVARTRRQSEFSRPV--WDYLVGAVSGARITRG 91

Query: 108 IALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKF 167
            A  K  +  L  ++ + GVP  +++A WG+E+ FG + G  P    LA+LAY   R   
Sbjct: 92  QAQGKRLAATLAAIEAKTGVPRSVVLAFWGVESDFGASAGSLPTARALASLAYARHRGTL 151

Query: 168 FTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNI 226
           F ++   AL +++ G I  +  +G+  G +GQ QFLP   ++ A+D D DG+ D+ +S  
Sbjct: 152 FRDELLAALQILENGDIEPARMVGSWAGAMGQVQFLPSVYLREAVDFDGDGRRDIWRSEA 211

Query: 227 DAIASAAKFLAKLGW 241
           DA+AS A +L  LGW
Sbjct: 212 DALASIAHYLQSLGW 226


>gi|229523972|ref|ZP_04413377.1| membrane-bound lytic murein transglycosylase B [Vibrio cholerae bv.
           albensis VL426]
 gi|229337553|gb|EEO02570.1| membrane-bound lytic murein transglycosylase B [Vibrio cholerae bv.
           albensis VL426]
          Length = 323

 Score =  111 bits (278), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 60/201 (29%), Positives = 111/201 (55%), Gaps = 2/201 (0%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F ++    + +A  EG+S +     F D+E+   ++  D+       ++  +Y+      
Sbjct: 24  FEQYVERLKQQAREEGISERILNEAFRDVEFKPRSVVADKNQ-PEKKLTLDEYIPRAVPE 82

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             + Q  +L + +   L  + K+YGV P  ++ALWG+E++FG   G   ++  L+TLAY+
Sbjct: 83  WKVKQAQSLYEKHYTELQRIGKQYGVQPRFIVALWGVESNFGAFTGNFRVIDALSTLAYE 142

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR +FF ++   AL ++++G I+  A+ G+  G +GQ QF+P + + +A D + DGK D
Sbjct: 143 GRREEFFRKETMAALQILEQGHIAPEAMKGSWAGAMGQCQFMPSSFLNFAADGNGDGKKD 202

Query: 221 LVKSNIDAIASAAKFLAKLGW 241
           +  +  D  AS A +L++ GW
Sbjct: 203 IWGTREDVFASTANYLSQSGW 223


>gi|89052862|ref|YP_508313.1| lytic murein transglycosylase [Jannaschia sp. CCS1]
 gi|88862411|gb|ABD53288.1| Lytic murein transglycosylase [Jannaschia sp. CCS1]
          Length = 390

 Score =  111 bits (278), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 71/213 (33%), Positives = 100/213 (46%), Gaps = 12/213 (5%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRK--MVTSPPVSFKDYLDGLS 99
           F ++    RA A   G S +     F    Y    +  DR+  + T P   F D+   L 
Sbjct: 26  FNQFVQGLRAEAAERGHSQEAIDGFFRHASYYQRALDADRRQGIFTVP---FTDFARRLI 82

Query: 100 SSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLA 159
           S   +  G       +     +++ +GV  GIL+A W  ET +G   G    L +L TLA
Sbjct: 83  SQGRMDNGRRNADRQAATFAEIERRFGVSQGILLAFWAFETDYGAFQGDYNTLDSLVTLA 142

Query: 160 YDCRRAKFFTEQFFYALDLVKKGVISS-HALGATFGEIGQFQFLPVNVVKYAIDADEDGK 218
           +DCRR + F  + F AL+L + G     +  GA  GEIG  Q LP ++V + ID D DG 
Sbjct: 143 HDCRRPELFRPEVFGALELYEMGDFDPVNTQGAWAGEIGMVQMLPEDIVAHGIDGDGDGH 202

Query: 219 IDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGE 251
           + L  S  DA+ S A  L+ LGW      +PGE
Sbjct: 203 VYLQTSAPDALMSGANILSSLGW------RPGE 229


>gi|240140021|ref|YP_002964498.1| putative membrane bound lytic murein transglycosylase B, mltB
           [Methylobacterium extorquens AM1]
 gi|240009995|gb|ACS41221.1| putative membrane bound lytic murein transglycosylase B, mltB
           [Methylobacterium extorquens AM1]
          Length = 393

 Score =  111 bits (278), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 71/195 (36%), Positives = 107/195 (54%), Gaps = 5/195 (2%)

Query: 50  RARAVREGMSPKTAKHLFADLEYLDT-TIAR-DRKMVTSPPVSFKDYLDGLSSSEIIAQG 107
           R  A   G+S KT    FA ++  D+  +AR  R+   S PV   DYL G  S   I +G
Sbjct: 34  RPDATARGISQKTFDAAFAGVQGPDSDVVARTHRQSEFSRPV--WDYLVGAVSGARITRG 91

Query: 108 IALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKF 167
            A  K  +  L  ++ + GVP  +++A WG+E+ FG + G  P +  LA+LAY   R   
Sbjct: 92  QAQGKRLAATLAAIEAKTGVPRSVVLAFWGVESDFGASAGSLPTIRALASLAYARHRGTL 151

Query: 168 FTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNI 226
           F ++   AL +++ G I  +  +G+  G +GQ QFLP   ++ A+D D DG+ D+ +S  
Sbjct: 152 FRDELLAALQILENGDIEPARMVGSWAGAMGQVQFLPSVYLREAVDFDGDGRRDIWRSEA 211

Query: 227 DAIASAAKFLAKLGW 241
           DA+AS A +L  LGW
Sbjct: 212 DALASIAHYLQSLGW 226


>gi|150397314|ref|YP_001327781.1| lytic murein transglycosylase [Sinorhizobium medicae WSM419]
 gi|150028829|gb|ABR60946.1| lytic murein transglycosylase [Sinorhizobium medicae WSM419]
          Length = 405

 Score =  111 bits (278), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 70/219 (31%), Positives = 95/219 (43%), Gaps = 60/219 (27%)

Query: 122 KKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKK 181
           ++E+GVP  ++ A W +ET FG   G    L+ L TLA+DCRR + F  Q   A+++V+ 
Sbjct: 120 EQEFGVPAPVITAFWAMETDFGAVQGDFNTLNALVTLAHDCRRPEMFRPQLLAAIEMVQH 179

Query: 182 GVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLG 240
           G +  +   GA  GEIGQ Q LP +++ Y ID D DG ++L  S+ DAI +AAKF+  LG
Sbjct: 180 GDLDPATTTGAWAGEIGQVQMLPEDIIAYGIDGDGDGHVNLKTSSPDAILTAAKFIQSLG 239

Query: 241 ------------------WTKCAGYQPGE------------------------------- 251
                             W K  G QPG                                
Sbjct: 240 FKAGEPWIQEVRVPDQLPWEKT-GLQPGMTAGDWFALGVTPRDGNTSNSALEASLVLPQG 298

Query: 252 ---------KNFAILKHWNASLNYNKTIAYIAAHIDGVP 281
                     NF I   WN S  Y  + AY A  + G P
Sbjct: 299 RKGAAFLTYPNFNIYLEWNQSFIYTTSAAYFATRLAGAP 337


>gi|297183959|gb|ADI20079.1| membrane-bound lytic murein transglycosylase b [uncultured alpha
           proteobacterium EB080_L06A09]
          Length = 411

 Score =  111 bits (278), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 78/246 (31%), Positives = 120/246 (48%), Gaps = 16/246 (6%)

Query: 5   KYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAK 64
           K L   L++   P++A           Q I     + F +W S  +  AV  G++  T  
Sbjct: 6   KLLASCLILFSTPLVAD----DNDNNNQQISVQKENAFKQWVSNFKKDAVSNGITTTTFD 61

Query: 65  HLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKE 124
             F +++     I  D K          DYLD  +S + IA G    K N    +NL +E
Sbjct: 62  TAFENVQLNSRVIKADNKQAEFS-REIWDYLDTATSPKRIANG----KENLSDYLNLLRE 116

Query: 125 ----YGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVK 180
               Y V   +++A+WGLE+ +G+ MG   ++  LATLA+D RR KF  +Q   AL +++
Sbjct: 117 IQFKYQVDAEVILAIWGLESSYGKRMGDINIIEALATLAFDGRREKFGKQQLLEALSIIQ 176

Query: 181 KGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVK--SNIDAIASAAKFLA 237
           +G I+    +G+  G +G  QF+P +   YA D   DGK ++       DA+AS A +LA
Sbjct: 177 RGDITPDKMMGSWAGAMGHTQFIPTSYQAYAQDFTGDGKRNVWDPLDPSDALASTANYLA 236

Query: 238 KLGWTK 243
           + GWT 
Sbjct: 237 EFGWTN 242


>gi|21243951|ref|NP_643533.1| transglycosylase [Xanthomonas axonopodis pv. citri str. 306]
 gi|21109562|gb|AAM38069.1| transglycosylase [Xanthomonas axonopodis pv. citri str. 306]
          Length = 425

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 72/234 (30%), Positives = 115/234 (49%), Gaps = 7/234 (2%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVS--FKDYLDGLS 99
           F +W +  R RA+  G+   T  +  A +         D++    P  +    DYLD   
Sbjct: 53  FEQWLADFRQRALAAGIGATTLDNALAGVTPDPAVHELDQRQ---PEFTQYLWDYLDARV 109

Query: 100 SSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLA 159
           +   I +G  L  +   L   L++ YGV PGIL A+W +E+ +G+ +G   ++ +LATLA
Sbjct: 110 TPSAIQEGQQLLISQHALFEKLRQHYGVDPGILTAIWSMESGYGKQIGDFYVIRSLATLA 169

Query: 160 YDCRRAKFFTEQFFYALDLVK--KGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDG 217
           ++ RR  +   Q   AL +++  K +  S  +G+  G +GQ QF+P     YA+D D D 
Sbjct: 170 HEGRRTTYGNTQLLAALQILQTEKSIDRSQLVGSWAGAMGQTQFIPSTYRDYAVDEDGDQ 229

Query: 218 KIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIA 271
           K D+  S  DA+ SAA +L +  WT    +    +  A   +  A L   KT+A
Sbjct: 230 KRDVWNSKADALGSAANYLKQNNWTSAVPWGQEVQLSAGFDYAQADLTIKKTVA 283


>gi|254476983|ref|ZP_05090369.1| lytic murein transglycosylase [Ruegeria sp. R11]
 gi|214031226|gb|EEB72061.1| lytic murein transglycosylase [Ruegeria sp. R11]
          Length = 464

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 70/224 (31%), Positives = 117/224 (52%), Gaps = 10/224 (4%)

Query: 24  TQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARD--R 81
           TQP     + + ++TA  F  W +A R RA   G+   T     A + +    + RD  +
Sbjct: 81  TQPDG---EAVDAETARAFEVWLTAFRGRAQEAGIYRATLDSALAGVRFDPDIVKRDGNQ 137

Query: 82  KMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETH 141
               +P      YL+   S   +  G A  + ++  L  ++  YGV   ++ A+WG+E++
Sbjct: 138 SEFVTP---IWTYLERAVSDSRVENGRAALRDHADTLARIEATYGVDKEVVAAVWGMESN 194

Query: 142 FGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQ 200
           +G   G   ++ +LATL +D RRA FF  Q   AL +++ G +S+ A+ G+  G +G  Q
Sbjct: 195 YGNFRGSRDIVRSLATLVFDGRRAAFFESQLIAALRILQSGDVSARAMTGSWAGAMGHTQ 254

Query: 201 FLPVNVVKYAIDADEDGKIDLVKSN-IDAIASAAKFLAKLGWTK 243
           F+P + ++YA+D   DGK D+   +  DA+AS A +L + GW K
Sbjct: 255 FMPTSYLEYAVDFTGDGKRDIWSDDPTDALASTAAYLKRFGWVK 298


>gi|261210604|ref|ZP_05924897.1| membrane-bound lytic murein transglycosylase B [Vibrio sp. RC341]
 gi|260840389|gb|EEX66960.1| membrane-bound lytic murein transglycosylase B [Vibrio sp. RC341]
          Length = 325

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 59/201 (29%), Positives = 112/201 (55%), Gaps = 2/201 (0%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F ++  + + +  +EG+S +  +  F ++EY    +  D+       ++  +Y+      
Sbjct: 24  FEQYVESLKQQGRQEGISDRVLEAAFRNVEYKPRAVVADKNQ-PEKKLTLDEYIPRAVPE 82

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             + Q  AL + +   L  + ++YGV P  ++ALWG+E++FG   G   ++  L+TLAY+
Sbjct: 83  WKVKQAQALYEKHYDELQRIGQQYGVQPRFIVALWGVESNFGALTGNFSVIDALSTLAYE 142

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR +FF ++   AL ++++G I+  A+ G+  G +GQ QF+P + + +A D + DGK D
Sbjct: 143 GRREEFFRKETMAALQILEQGHIAPEAMKGSWAGAMGQCQFMPSSFLNFAADGNGDGKKD 202

Query: 221 LVKSNIDAIASAAKFLAKLGW 241
           +  +  D  AS A +L++ GW
Sbjct: 203 IWGTRSDVFASTANYLSQSGW 223


>gi|21264235|ref|NP_644735.1| lytic murein transglycosylase [Xanthomonas axonopodis pv. citri
           str. 306]
 gi|21110871|gb|AAM39253.1| lytic murein transglycosylase [Xanthomonas axonopodis pv. citri
           str. 306]
          Length = 425

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 72/234 (30%), Positives = 115/234 (49%), Gaps = 7/234 (2%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVS--FKDYLDGLS 99
           F +W +  R RA+  G+   T  +  A +         D++    P  +    DYLD   
Sbjct: 53  FEQWLADFRQRALAAGIGATTLDNALAGVTPDPAVHELDQRQ---PEFTQYLWDYLDARV 109

Query: 100 SSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLA 159
           +   I +G  L  +   L   L++ YGV PGIL A+W +E+ +G+ +G   ++ +LATLA
Sbjct: 110 TPSAIQEGQQLLISQHALFEKLRQHYGVDPGILTAIWSMESGYGKQIGDFYVIRSLATLA 169

Query: 160 YDCRRAKFFTEQFFYALDLVK--KGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDG 217
           ++ RR  +   Q   AL +++  K +  S  +G+  G +GQ QF+P     YA+D D D 
Sbjct: 170 HEGRRTTYGNTQLLAALQILQTEKSIDRSQLVGSWAGAMGQTQFIPSTYRDYAVDEDGDQ 229

Query: 218 KIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIA 271
           K D+  S  DA+ SAA +L +  WT    +    +  A   +  A L   KT+A
Sbjct: 230 KRDVWNSKADALGSAANYLKQNNWTSAVPWGQEVQLSAGFDYAQADLTIKKTVA 283


>gi|240949210|ref|ZP_04753554.1| membrane-bound lytic murein transglycosylase B [Actinobacillus
           minor NM305]
 gi|240296326|gb|EER46970.1| membrane-bound lytic murein transglycosylase B [Actinobacillus
           minor NM305]
          Length = 364

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 78/127 (61%), Gaps = 1/127 (0%)

Query: 118 LINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALD 177
           L    +++GV    +MALWG+E+ FG   G   +LS LATLA+D RR K FT++F  A+ 
Sbjct: 132 LTKASQKFGVQKEYIMALWGMESSFGNYQGDFDVLSVLATLAFDGRREKLFTQEFVNAMK 191

Query: 178 LVKKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFL 236
           ++  G IS +  LG+  G +GQ QF+P   + YA D D DGK D+  +  DA AS A +L
Sbjct: 192 MLDDGTISRYELLGSWAGAMGQTQFMPTAYLSYAADGDGDGKKDIWNNEYDAFASIASYL 251

Query: 237 AKLGWTK 243
           + +GW K
Sbjct: 252 STVGWDK 258


>gi|315123527|ref|YP_004065533.1| putative periplasmic lytic murein transglycosylase
           [Pseudoalteromonas sp. SM9913]
 gi|315017287|gb|ADT70624.1| putative periplasmic lytic murein transglycosylase
           [Pseudoalteromonas sp. SM9913]
          Length = 338

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 65/212 (30%), Positives = 110/212 (51%), Gaps = 6/212 (2%)

Query: 34  ICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPV--SF 91
           + + T   F ++ +  +  A+ +G   +  +  FA   Y +  I+ D+     P V  + 
Sbjct: 18  VMAKTQAEFQQYLTNLKQEAIAKGYDTQLIEQAFATASYKEKVISADK---NQPEVKETL 74

Query: 92  KDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPL 151
           + YL        I +   L K N  +L  + K++GV    ++A+WGLE++FG   G   +
Sbjct: 75  ETYLPKRVPQWKIDRARKLYKENQEVLEKVAKDFGVQARFIVAIWGLESNFGAIQGGHNV 134

Query: 152 LSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYA 210
           +S+L TLA+D RR   +  Q + ALD++K G I+     G+  G +GQ QF+P +   YA
Sbjct: 135 ISSLVTLAFDGRREALYKRQLWAALDILKSGHITLDKFKGSWAGAMGQTQFMPTSFNAYA 194

Query: 211 IDADEDGKIDLVKSNIDAIASAAKFLAKLGWT 242
           +D + DG+ D+  +  DA AS A +L + GW 
Sbjct: 195 VDYNNDGRKDIWTTKEDAFASIANYLKQEGWN 226


>gi|119384390|ref|YP_915446.1| lytic murein transglycosylase [Paracoccus denitrificans PD1222]
 gi|119374157|gb|ABL69750.1| lytic murein transglycosylase [Paracoccus denitrificans PD1222]
          Length = 424

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 68/205 (33%), Positives = 107/205 (52%), Gaps = 11/205 (5%)

Query: 45  WKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFK----DYLDGLSS 100
           W    +A A  +G+S  T    F D+ Y    I R +         FK    +YL+   S
Sbjct: 56  WVQGFKANARSQGISDSTLDFAFRDVTYNPEVIRRSQSQA-----EFKKSVWEYLENAVS 110

Query: 101 SEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAY 160
            +  A G A       +L  ++  YGV   ++ A+WG+E+ +GE  G  PL+ +LATL+Y
Sbjct: 111 EKRQADGRAALAQYGGVLSRIEATYGVDKEVVAAVWGMESTYGERRGDLPLIESLATLSY 170

Query: 161 DCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKI 219
           +  R +FF  Q   AL +++ G I  +H  G+  G +G  QF+P   + +A+D   DG+ 
Sbjct: 171 EGYRGEFFRSQLMGALRILQAGDIDPAHMTGSWAGAMGHTQFIPTTYLSFAVDFTGDGRR 230

Query: 220 DLVKSN-IDAIASAAKFLAKLGWTK 243
           D+  ++  DA+ASAA +LAK GW +
Sbjct: 231 DIWSNDPSDALASAANYLAKSGWQR 255


>gi|326316822|ref|YP_004234494.1| lytic murein transglycosylase [Acidovorax avenae subsp. avenae ATCC
           19860]
 gi|323373658|gb|ADX45927.1| lytic murein transglycosylase [Acidovorax avenae subsp. avenae ATCC
           19860]
          Length = 471

 Score =  111 bits (277), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 69/213 (32%), Positives = 107/213 (50%), Gaps = 12/213 (5%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKM--VTSPPVSFKDYLDGLS 99
           F +W +  R  A++ G+ P+T        ++L   I  DR     T  P +   YLD   
Sbjct: 102 FAQWIAGFRQEALQAGIRPETVAAALDGAQWLPQVIELDRSQPEFTRTPWA---YLDSAV 158

Query: 100 SSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLA 159
           S   I +G  +       L +    YGVP  ++ A+WG+E+++G   G    +  LATLA
Sbjct: 159 SPTRIQRGRDVLAEQRAALDSAAARYGVPAEVITAIWGMESNYGSNFGSFRTVDALATLA 218

Query: 160 YDCRRAKFFTEQFFYALDLVKKGVISS-HALGATFGEIGQFQFLPVNVVKYAIDADEDGK 218
           Y+ RR  +   +   AL ++ +G I++   +G+  G +G  QFLP   + YA+DAD DG 
Sbjct: 219 YEGRRRDWARGELLAALRIIDQGDIAADRMIGSWAGAMGHTQFLPSVFLGYAVDADGDGH 278

Query: 219 IDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGE 251
            D+  S  D  AS A FL+++GW      QPG+
Sbjct: 279 RDIWGSVPDVAASTANFLSRMGW------QPGQ 305


>gi|109899111|ref|YP_662366.1| lytic murein transglycosylase [Pseudoalteromonas atlantica T6c]
 gi|109701392|gb|ABG41312.1| lytic murein transglycosylase [Pseudoalteromonas atlantica T6c]
          Length = 331

 Score =  110 bits (276), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 54/140 (38%), Positives = 88/140 (62%), Gaps = 1/140 (0%)

Query: 104 IAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCR 163
           + Q + L   +  +L ++ + +GV    ++ALWG E++FG+ MGK P++S+LAT+AY+ R
Sbjct: 93  VQQALDLSAKHRAVLEDVAQTFGVQARFIVALWGNESNFGKIMGKYPVISSLATMAYEGR 152

Query: 164 RAKFFTEQFFYALDLVKKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLV 222
           R + F +Q + A+D++++G I     LG+  G +GQ QF+P + + YA D D DGK D+ 
Sbjct: 153 REEMFKKQLYAAMDILRQGHIKQDEFLGSWAGAMGQSQFMPTSFLHYAYDFDGDGKKDIW 212

Query: 223 KSNIDAIASAAKFLAKLGWT 242
            +  D  AS A FL   GW+
Sbjct: 213 NNPADVFASIANFLKTEGWS 232


>gi|257455301|ref|ZP_05620536.1| lytic murein transglycosylase [Enhydrobacter aerosaccus SK60]
 gi|257447263|gb|EEV22271.1| lytic murein transglycosylase [Enhydrobacter aerosaccus SK60]
          Length = 447

 Score =  110 bits (276), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 67/206 (32%), Positives = 112/206 (54%), Gaps = 3/206 (1%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F +WKS    RAV++G      + L +   Y +  ++ D+       + + +Y+DG +SS
Sbjct: 83  FYQWKSDFIERAVQKGYPRADVERLLSSANYSEQVVSLDKGQPEFAKMPW-EYIDGAASS 141

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             ++ G     + S LL  ++ +YGVP  I+ A+WG+E+ +G+  G + L+++LATLAYD
Sbjct: 142 GRVSGGQRNFASQSALLDRIENQYGVPASIVTAIWGMESSYGQGTGNSSLVNSLATLAYD 201

Query: 162 CRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR  F  +Q    L L+++G I  S   G+  G +G  QF+P   +  A+D + DG  +
Sbjct: 202 GRRRSFAEDQLLALLSLLERGDIDWSQLRGSWAGGMGHTQFIPKTWLDEAVDGNGDGHRN 261

Query: 221 LVKSNIDAIASAAKFLAKLGWTKCAG 246
              +  DA+AS A +L   GW +  G
Sbjct: 262 PWHT-ADALASTASYLKNAGWQRGMG 286


>gi|221369246|ref|YP_002520342.1| Membrane-bound lytic murein transglycosylase B [Rhodobacter
           sphaeroides KD131]
 gi|221162298|gb|ACM03269.1| Membrane-bound lytic murein transglycosylase B [Rhodobacter
           sphaeroides KD131]
          Length = 413

 Score =  110 bits (276), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 75/233 (32%), Positives = 122/233 (52%), Gaps = 6/233 (2%)

Query: 45  WKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEII 104
           W +  R RA+  G+ P T    F    +L   I RDR   T    + +DYL   +S E +
Sbjct: 47  WVAGFRPRALGAGIDPGTFDRAFRSAGFLPDVIERDRNQ-TEFTRTTEDYLSIAASEERV 105

Query: 105 AQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRR 164
           + G A    ++ +L  ++  YGV   ++ A+WG+E+ +GE  G  P++S L+TLA++ RR
Sbjct: 106 SLGRAALARHAGVLSQIESRYGVEAEVVTAVWGVESRYGERRGDVPIVSALSTLAFEGRR 165

Query: 165 AKFFTEQFFYALDLVKKG-VISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVK 223
             FF  Q   AL +++ G    +H  G+  G +G  QF+P + + YA+D + DG+ D+  
Sbjct: 166 GAFFESQLIAALKILQSGDTDPAHLTGSWAGAMGHTQFIPTSYLAYAVDFNGDGRRDIWS 225

Query: 224 SN-IDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAA 275
            +  DA+ASAA +L++ GW +    QP      +   +N+ L    T    AA
Sbjct: 226 DDPTDALASAAAYLSRSGWQRG---QPWGVEVQLPAGFNSGLAGRGTTRSPAA 275


>gi|84514556|ref|ZP_01001920.1| hypothetical protein SKA53_10059 [Loktanella vestfoldensis SKA53]
 gi|84511607|gb|EAQ08060.1| hypothetical protein SKA53_10059 [Loktanella vestfoldensis SKA53]
          Length = 389

 Score =  110 bits (276), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 67/203 (33%), Positives = 100/203 (49%), Gaps = 8/203 (3%)

Query: 43  GEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLD---GLS 99
           G + +  +A AV  G+   TA   FA  +   + +  DR    S  V  +D++     L 
Sbjct: 26  GSFIAGVKAEAVATGIPAATADAFFAGAQIEQSVLNADR----SQGVFQQDFIQFSRNLI 81

Query: 100 SSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLA 159
           S   I  G    +        ++  +G+P G+L+A W  ET +G   G     + L TLA
Sbjct: 82  SQNRIDNGTRNSQRFDSTFRAIENRFGIPRGVLLAFWAFETDYGAVQGNFNTRNALLTLA 141

Query: 160 YDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGK 218
           +DCRR   F  Q   A++L ++G +  +  LGA  GEIGQ Q LP  +V+  +D D DG 
Sbjct: 142 HDCRRPDLFRPQLIAAIELYRRGGMDPATTLGAWAGEIGQLQKLPREIVEKGMDGDGDGL 201

Query: 219 IDLVKSNIDAIASAAKFLAKLGW 241
           +DL  S  DA+ + A  L+ LGW
Sbjct: 202 VDLKNSAPDALTTGANVLSSLGW 224


>gi|319779305|ref|YP_004130218.1| Membrane-bound lytic murein transglycosylase B precursor
           [Taylorella equigenitalis MCE9]
 gi|317109329|gb|ADU92075.1| Membrane-bound lytic murein transglycosylase B precursor
           [Taylorella equigenitalis MCE9]
          Length = 405

 Score =  110 bits (276), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 88/149 (59%), Gaps = 1/149 (0%)

Query: 94  YLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLS 153
           Y+  L   E I QG AL + ++ LL  ++ + GV P  ++A+WG+E++FG  +GK  L+ 
Sbjct: 81  YMANLVDQERINQGRALMQKHASLLEKVQNQMGVDPATVVAIWGVESNFGTNLGKYDLVR 140

Query: 154 TLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAID 212
           +L TLA   RR  +F  + F AL +++ G I+   L G+  G  GQ QF+P    + A+D
Sbjct: 141 SLGTLACKGRRKLYFRGELFSALRILQSGDITKDKLKGSWAGAFGQTQFMPSTFERIAVD 200

Query: 213 ADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
            D DG+ DLV +  DA+ S A ++ K GW
Sbjct: 201 FDHDGRRDLVDNVADALGSTANYMVKSGW 229


>gi|332560848|ref|ZP_08415166.1| membrane-bound lytic murein transglycosylase B [Rhodobacter
           sphaeroides WS8N]
 gi|332274646|gb|EGJ19962.1| membrane-bound lytic murein transglycosylase B [Rhodobacter
           sphaeroides WS8N]
          Length = 413

 Score =  110 bits (275), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 75/233 (32%), Positives = 122/233 (52%), Gaps = 6/233 (2%)

Query: 45  WKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEII 104
           W +  R RA+  G+ P T    F    +L   I RDR   T    + +DYL   +S E +
Sbjct: 47  WVAGFRPRALGAGIDPGTFDRAFRSAGFLPDVIERDRNQ-TEFTRTTEDYLSIAASEERV 105

Query: 105 AQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRR 164
           + G A    ++ +L  ++  YGV   ++ A+WG+E+ +GE  G  P++S L+TLA++ RR
Sbjct: 106 SLGRAALARHAGVLSQIESRYGVEAEVVTAVWGVESRYGERRGDVPIVSALSTLAFEGRR 165

Query: 165 AKFFTEQFFYALDLVKKG-VISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVK 223
             FF  Q   AL +++ G    +H  G+  G +G  QF+P + + YA+D + DG+ D+  
Sbjct: 166 GAFFESQLIAALKILQSGDTDPAHLTGSWAGAMGHTQFIPTSYLAYAVDFNGDGRRDIWS 225

Query: 224 SN-IDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAA 275
            +  DA+ASAA +L++ GW +    QP      +   +N+ L    T    AA
Sbjct: 226 DDPTDALASAAAYLSRSGWRRG---QPWGVEVQLPAGFNSGLAGRGTTRSPAA 275


>gi|163733182|ref|ZP_02140626.1| transglycosylase, putative [Roseobacter litoralis Och 149]
 gi|161393717|gb|EDQ18042.1| transglycosylase, putative [Roseobacter litoralis Och 149]
          Length = 451

 Score =  110 bits (275), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 65/202 (32%), Positives = 104/202 (51%), Gaps = 3/202 (1%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F  W S  + RA R+G+   T    F  + +    I RDR         ++ YL   +S 
Sbjct: 83  FDAWVSGFKQRATRQGIRSATLDPAFRGVTFDSDVIRRDRNQSEFTKTIWQ-YLASAASD 141

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             IA G A    +   L  +++ YGV   +++A+WGLE+ +G   G   ++ +L+TLAY+
Sbjct: 142 RRIANGKAALAKHRTTLEAIERRYGVEKEVVVAVWGLESGYGAYRGSNDVIRSLSTLAYE 201

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR  FF EQ   AL +++ G  +   + G+  G +G  QF+P + + YA+D   DG+ D
Sbjct: 202 GRRGAFFEEQLIAALKILQNGDTAPRNMTGSWAGAMGHTQFIPTSYLAYAVDFTGDGRRD 261

Query: 221 LVKSN-IDAIASAAKFLAKLGW 241
           +   +  DA+AS A +L   GW
Sbjct: 262 IWSEDPTDALASTAAYLKNAGW 283


>gi|223042084|ref|ZP_03612259.1| membrane-bound lytic murein transglycosylase [Actinobacillus minor
           202]
 gi|223017120|gb|EEF15557.1| membrane-bound lytic murein transglycosylase [Actinobacillus minor
           202]
          Length = 365

 Score =  110 bits (275), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 54/127 (42%), Positives = 77/127 (60%), Gaps = 1/127 (0%)

Query: 118 LINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALD 177
           L    +++GV    +MALWG+E+ FG   G   +LS LATLA+D RR K FT++F  A+ 
Sbjct: 133 LTKASQKFGVQKEYIMALWGMESSFGNYQGDFDVLSVLATLAFDGRREKLFTQEFVNAMK 192

Query: 178 LVKKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFL 236
           ++  G IS +  LG+  G +GQ QF+P   + YA D D DGK D+  +  DA AS A +L
Sbjct: 193 MLDNGTISRYELLGSWAGAMGQTQFMPTAYLSYAADGDGDGKKDIWNNEYDAFASIASYL 252

Query: 237 AKLGWTK 243
           + +GW  
Sbjct: 253 STVGWNN 259


>gi|326560137|gb|EGE10527.1| putative lytic murein transglycosylase [Moraxella catarrhalis
           46P47B1]
          Length = 468

 Score =  110 bits (275), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 66/209 (31%), Positives = 108/209 (51%), Gaps = 5/209 (2%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F EWK     RA+ +G++  +   L  +       I  DR       + + +Y++  +SS
Sbjct: 103 FAEWKHDFIHRALAKGINANSLNSLMGNATLNQRVIELDRSQAEFTKMPW-EYVESAASS 161

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             I+QG +    N  +L + +  YG P  I  A+WG+E+ +G  MG   L+S L++LAYD
Sbjct: 162 NRISQGRSKLNENLSILTSAESIYGTPKEITAAIWGMESSYGAGMGSMDLVSALSSLAYD 221

Query: 162 CRRAKFFTEQFFYALDLVKKG-VISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR +F   Q    L ++++G V +S   G+  G +G  QF+P   ++ +ID D +G+ +
Sbjct: 222 GRRREFAENQLLAMLLMIERGDVAASQLKGSWAGGMGHTQFIPTTWIQESIDGDANGRKN 281

Query: 221 LVKSNIDAIASAAKFLAKLGWTKCAGYQP 249
                 DA+ S A +LA  GW +  G QP
Sbjct: 282 PWNRQ-DALTSTASYLANAGWIR--GLQP 307


>gi|260574097|ref|ZP_05842102.1| lytic murein transglycosylase [Rhodobacter sp. SW2]
 gi|259023563|gb|EEW26854.1| lytic murein transglycosylase [Rhodobacter sp. SW2]
          Length = 416

 Score =  110 bits (275), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 112/204 (54%), Gaps = 3/204 (1%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F  W +A R RA  +G+   T    F    +L   I RDR   T    + +DYL   +S 
Sbjct: 46  FDAWVAAFRPRAAAKGIPAGTLDAAFRSAGFLPGVIERDRNQ-TEFTRTTEDYLAIAASD 104

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
           E ++ G A       +L  +++ +GV   ++ A+WGLE+ FG   G  P++S LATLAY+
Sbjct: 105 ERLSTGRAALGQYGGVLAEIEQRFGVESNVVAAIWGLESFFGTRRGSVPVVSALATLAYE 164

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RRA FF  Q   AL ++  G ++   + G+  G +G  QF+P + + YA+D   DG+ D
Sbjct: 165 GRRAAFFESQLIAALKILANGDVTPAGMTGSWAGAMGHTQFIPTSYLAYAVDFRGDGRRD 224

Query: 221 LVKSN-IDAIASAAKFLAKLGWTK 243
           +   +  DA+ASAA +L++ GWT+
Sbjct: 225 IWSDDPTDALASAAAYLSRSGWTR 248


>gi|77465241|ref|YP_354744.1| membrane-bound lytic murein transglycosylase B [Rhodobacter
           sphaeroides 2.4.1]
 gi|77389659|gb|ABA80843.1| Membrane-bound lytic murein transglycosylase B [Rhodobacter
           sphaeroides 2.4.1]
          Length = 462

 Score =  110 bits (275), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 75/233 (32%), Positives = 122/233 (52%), Gaps = 6/233 (2%)

Query: 45  WKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEII 104
           W +  R RA+  G+ P T    F    +L   I RDR   T    + +DYL   +S E +
Sbjct: 96  WVAGFRPRALGAGIDPGTFDRAFRSAGFLPDVIERDRNQ-TEFTRTTEDYLSIAASEERV 154

Query: 105 AQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRR 164
           + G A    ++ +L  ++  YGV   ++ A+WG+E+ +GE  G  P++S L+TLA++ RR
Sbjct: 155 SLGRAALARHAGVLSQIESRYGVEAEVVTAVWGVESRYGERRGDVPIVSALSTLAFEGRR 214

Query: 165 AKFFTEQFFYALDLVKKG-VISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVK 223
             FF  Q   AL +++ G    +H  G+  G +G  QF+P + + YA+D + DG+ D+  
Sbjct: 215 GAFFESQLIAALKILQSGDTDPAHLTGSWAGAMGHTQFIPTSYLAYAVDFNGDGRRDIWS 274

Query: 224 SN-IDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAA 275
            +  DA+ASAA +L++ GW +    QP      +   +N+ L    T    AA
Sbjct: 275 DDPTDALASAAAYLSRSGWRRG---QPWGVEVQLPAGFNSGLAGRGTTRSPAA 324


>gi|332977225|gb|EGK14020.1| type III effector HopAJ2 [Psychrobacter sp. 1501(2011)]
          Length = 469

 Score =  110 bits (275), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 89/150 (59%), Gaps = 1/150 (0%)

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
           DYL  L   E +  GI  K+  +  L  ++  YGV    ++ +WG+E++FG+T+GK  L 
Sbjct: 86  DYLSSLVDKERVEDGIRAKREMADTLRRIESRYGVKAEHVLGVWGVESNFGQTLGKKDLF 145

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAI 211
            +LATL+   RR  +F  ++  AL +V+ G I++  + G+  G  GQ QF+P   +  A+
Sbjct: 146 QSLATLSCFDRRQSYFRGEYANALKIVQNGDIAASDMKGSWAGAFGQTQFMPGTFLDLAV 205

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
           D D DG+ DLV S  DA+AS A FLAK G+
Sbjct: 206 DFDGDGRRDLVNSKPDALASTANFLAKRGY 235


>gi|222086465|ref|YP_002544999.1| membrane-bound lytic murein transglycosylase protein [Agrobacterium
           radiobacter K84]
 gi|221723913|gb|ACM27069.1| membrane-bound lytic murein transglycosylase protein [Agrobacterium
           radiobacter K84]
          Length = 414

 Score =  110 bits (275), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 76/123 (61%), Gaps = 1/123 (0%)

Query: 122 KKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKK 181
           +K+YGVPPG++ A WG+ET +G   G     + L TL++DCRR +FF  +    ++LV++
Sbjct: 129 EKDYGVPPGVITAFWGMETDYGAVQGNFNTRNALVTLSHDCRRPEFFRPRLIALIELVQR 188

Query: 182 G-VISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLG 240
           G V  +   GA  GEIGQ Q LP +++ Y  D D DG ++L  S  D I + A+FL  LG
Sbjct: 189 GDVDPATTTGAWAGEIGQTQMLPPDIIAYGTDGDGDGHVNLKTSAPDVILTTARFLQHLG 248

Query: 241 WTK 243
           + +
Sbjct: 249 FQR 251


>gi|326573378|gb|EGE23346.1| putative lytic murein transglycosylase [Moraxella catarrhalis
           101P30B1]
          Length = 468

 Score =  110 bits (274), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 65/209 (31%), Positives = 109/209 (52%), Gaps = 5/209 (2%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F EWK     RA+ +G++  +   L  +       I  DR       + + +Y++  +SS
Sbjct: 103 FAEWKHDFIHRALAKGINANSLNSLMGNATLNQHVIELDRSQAEFTKMPW-EYVESAASS 161

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             I+QG +    N  +L + +  YG P  I  A+WG+E+ +G  MG   L+S L++LAYD
Sbjct: 162 NRISQGRSKLNENLSILTSAESIYGTPKEITAAIWGMESSYGAGMGSMDLVSALSSLAYD 221

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR +F   Q    L ++++G +++  L G+  G +G  QF+P   ++ +ID D +G+ +
Sbjct: 222 GRRREFAENQLLAMLLMIERGDVAASQLKGSWAGGMGHTQFIPTTWIQESIDGDANGRKN 281

Query: 221 LVKSNIDAIASAAKFLAKLGWTKCAGYQP 249
                 DA+ S A +LA  GW +  G QP
Sbjct: 282 PWNRQ-DALTSTASYLANAGWIR--GLQP 307


>gi|326565750|gb|EGE15912.1| putative lytic murein transglycosylase [Moraxella catarrhalis BC1]
          Length = 468

 Score =  110 bits (274), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 65/209 (31%), Positives = 109/209 (52%), Gaps = 5/209 (2%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F EWK     RA+ +G++  +   L  +       I  DR       + + +Y++  +SS
Sbjct: 103 FAEWKHDFIHRALAKGINANSLNALMGNTTLNQRVIELDRSQAEFTKMPW-EYVESAASS 161

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             I+QG +    N  +L + +  YG P  I  A+WG+E+ +G  MG   L+S L++LAYD
Sbjct: 162 NRISQGRSKLNENLSILTSAESIYGTPKEITAAIWGMESSYGAGMGSMDLVSALSSLAYD 221

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR +F   Q    L ++++G +++  L G+  G +G  QF+P   ++ +ID D +G+ +
Sbjct: 222 GRRREFAENQLLAMLLMIERGDVAASQLKGSWAGGMGHTQFIPTTWIQESIDGDANGRKN 281

Query: 221 LVKSNIDAIASAAKFLAKLGWTKCAGYQP 249
                 DA+ S A +LA  GW +  G QP
Sbjct: 282 PWNRQ-DALTSTASYLANAGWIR--GLQP 307


>gi|295688037|ref|YP_003591730.1| lytic murein transglycosylase [Caulobacter segnis ATCC 21756]
 gi|295429940|gb|ADG09112.1| lytic murein transglycosylase [Caulobacter segnis ATCC 21756]
          Length = 435

 Score =  110 bits (274), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 78/245 (31%), Positives = 123/245 (50%), Gaps = 13/245 (5%)

Query: 13  MMVYPMLAQAVTQPK----KATTQFICSDTADR----FGEWKSAARARAVREGMSPKTAK 64
            M +P   +  +QP+     +TT  I     D     F  W +  R RA+  G+SP+   
Sbjct: 24  QMTHPPAPKPASQPQTPQTPSTTPAIPQTQVDAETQAFDAWLADFRPRAIAAGVSPQVFD 83

Query: 65  HLFADLEYLDTTIARD-RKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKK 123
              + +      I+ D R+   S PV    Y+ G+ S + IA G A K+     L  ++ 
Sbjct: 84  RELSGVTPNPRVISLDSRQPEFSKPVGA--YIAGVISDDRIAIGRA-KREQLAFLPQIEA 140

Query: 124 EYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGV 183
            YGVP  IL+A+W +E+ FG+  G   ++ ++A+LA D RR  +   +   AL +++ G 
Sbjct: 141 RYGVPRDILLAVWAMESAFGKLQGDFDVVRSMASLAADGRRRAWAEGELIAALKIIESGE 200

Query: 184 ISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWT 242
            +   L G+  G +GQ QFLP +    A+D D DG+ D+  S+ D++ASAA  L K GW 
Sbjct: 201 DTREQLKGSWAGAMGQTQFLPSSYRATAVDFDGDGRRDIWGSDADSLASAANLLVKGGWK 260

Query: 243 KCAGY 247
              G+
Sbjct: 261 PGVGW 265


>gi|171058531|ref|YP_001790880.1| lytic murein transglycosylase [Leptothrix cholodnii SP-6]
 gi|170775976|gb|ACB34115.1| lytic murein transglycosylase [Leptothrix cholodnii SP-6]
          Length = 409

 Score =  110 bits (274), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 73/216 (33%), Positives = 105/216 (48%), Gaps = 8/216 (3%)

Query: 31  TQFICSDTA--DRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPP 88
           T     DTA    F  W  + R  A   G+   T    F  + YL   +  DR   + P 
Sbjct: 27  TPIQADDTALQQDFSRWILSMRDTARTAGIDEATLAVAFDGIRYLPRVVESDR---SQPE 83

Query: 89  VSFK--DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETM 146
            +    DYLD   S + IA G    +            YGVP  I++A+WG+E+++G   
Sbjct: 84  FTRTVWDYLDRAVSPQRIALGQDKLQQVRPEADAAAARYGVPAAIVVAIWGVESNYGGNF 143

Query: 147 GKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVN 205
           G  P +  LATL ++ RR  +  +Q   AL +++ G I  +H +G+  G +GQ QFLP  
Sbjct: 144 GDIPTIDALATLGFEGRRQTWARDQLLAALKILQNGDIDRAHMIGSWAGAMGQTQFLPSV 203

Query: 206 VVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
            +  A+DAD DG+ D+  S  D  AS A FLA+ GW
Sbjct: 204 FLNTAVDADGDGRRDIWGSMADVTASTANFLARAGW 239


>gi|21233574|ref|NP_639491.1| epimerase [Xanthomonas campestris pv. campestris str. ATCC 33913]
 gi|21115436|gb|AAM43373.1| transglycolase [Xanthomonas campestris pv. campestris str. ATCC
           33913]
          Length = 719

 Score =  110 bits (274), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 62/153 (40%), Positives = 90/153 (58%), Gaps = 1/153 (0%)

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
           DYL  L  S+ ++ G A+   +  LL  L ++ GV P  ++A+WG+E+ +G   GK PLL
Sbjct: 75  DYLASLVDSQRVSDGQAMLVTHRELLTRLSEQTGVDPATIVAVWGVESDYGRITGKRPLL 134

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAI 211
            +LATL+   RR  FF  +F   L L+++G ++   L G+  G  GQ QF+P    + AI
Sbjct: 135 VSLATLSCAGRRQPFFRGEFLALLGLLQQGDLAPEGLTGSWAGAFGQTQFMPSTYARIAI 194

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGWTKC 244
           D D DG+ DLV S  DA+AS A +L K GW + 
Sbjct: 195 DGDGDGRRDLVASIPDALASTANYLVKAGWERA 227


>gi|326577191|gb|EGE27085.1| putative lytic murein transglycosylase [Moraxella catarrhalis O35E]
          Length = 468

 Score =  110 bits (274), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 65/209 (31%), Positives = 109/209 (52%), Gaps = 5/209 (2%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F EWK     RA+ +G++  +   L  +       I  DR       + + +Y++  +SS
Sbjct: 103 FAEWKHDFIHRALAKGINANSLNALMGNATLNQRVIELDRSQAEFTKMPW-EYVESAASS 161

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             I+QG +    N  +L + +  YG P  I  A+WG+E+ +G  MG   L+S L++LAYD
Sbjct: 162 NRISQGRSKLNENLSILTSAESIYGTPKEITAAIWGMESSYGAGMGSMDLVSALSSLAYD 221

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR +F   Q    L ++++G +++  L G+  G +G  QF+P   ++ +ID D +G+ +
Sbjct: 222 GRRREFAENQLLAMLLMIERGDVAASQLKGSWAGGMGHTQFIPTTWIQESIDGDANGRKN 281

Query: 221 LVKSNIDAIASAAKFLAKLGWTKCAGYQP 249
                 DA+ S A +LA  GW +  G QP
Sbjct: 282 PWNRQ-DALTSTASYLANAGWIR--GLQP 307


>gi|148553405|ref|YP_001260987.1| lytic murein transglycosylase [Sphingomonas wittichii RW1]
 gi|148498595|gb|ABQ66849.1| lytic murein transglycosylase [Sphingomonas wittichii RW1]
          Length = 372

 Score =  110 bits (274), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 69/200 (34%), Positives = 99/200 (49%), Gaps = 6/200 (3%)

Query: 50  RARAVREGMSPKTAKHLFADLEYLDTTIARDR------KMVTSPPVSFKDYLDGLSSSEI 103
           R RA+  G+SP         L +    +  DR         T+ P  F  YL        
Sbjct: 66  RPRALAMGISPTLFDATLPTLSFNARVVRLDRGQPGASPTSTAAPPPFAPYLASHVDRVR 125

Query: 104 IAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCR 163
           I  G +   +   LL+ +++E GVP  I++A++G ET +G   G   LL+ L TLAY+ R
Sbjct: 126 INMGRSRYGSLRPLLLRIEQETGVPEQIMLAIYGHETGYGTFTGNFDLLNALGTLAYEGR 185

Query: 164 RAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVK 223
           R + F ++F   L L+ +GV  S   G+  G  G  QFLP   ++ AID D DGK D+ +
Sbjct: 186 RRELFADEFLKTLLLMNRGVPRSQLKGSWAGATGYPQFLPSVYLRLAIDGDNDGKADIWR 245

Query: 224 SNIDAIASAAKFLAKLGWTK 243
           S  DA+AS   +L   GW K
Sbjct: 246 SEPDALASIGNYLRDAGWKK 265


>gi|229592793|ref|YP_002874912.1| putative lipoprotein [Pseudomonas fluorescens SBW25]
 gi|229364659|emb|CAY52587.1| putative lipoprotein [Pseudomonas fluorescens SBW25]
          Length = 441

 Score =  110 bits (274), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 71/204 (34%), Positives = 114/204 (55%), Gaps = 4/204 (1%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVT-SPPVSFKDYLDGLSS 100
           F EW++A R +A++ G++     + FA++      I  DR     S PV   +YLDG  S
Sbjct: 68  FAEWQAAFRVQALQAGITAAVFDNAFANVTPDMAVIRADRSQPEFSRPV--WEYLDGALS 125

Query: 101 SEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAY 160
              +  G AL    + +L ++++ YGV    L+++WG+E++FG+  G   ++ +LATLAY
Sbjct: 126 PVRVRNGQALLIKYADILQSIEQRYGVDRQALVSVWGMESNFGQFQGNNSVIRSLATLAY 185

Query: 161 DCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKI 219
           + RR  F   Q   AL +++ G I +  + G+  G +GQ QF+P     +A+D D DG+ 
Sbjct: 186 EGRRPAFAQAQLLAALQIIQHGDIQADQMKGSWAGAMGQTQFIPTTYNTHAVDFDGDGRR 245

Query: 220 DLVKSNIDAIASAAKFLAKLGWTK 243
           D+  S  DA+AS A +L   GW K
Sbjct: 246 DIWNSPADALASTAHYLQSSGWQK 269


>gi|326560520|gb|EGE10902.1| putative lytic murein transglycosylase [Moraxella catarrhalis 7169]
 gi|326565390|gb|EGE15567.1| putative lytic murein transglycosylase [Moraxella catarrhalis
           103P14B1]
 gi|326570401|gb|EGE20441.1| putative lytic murein transglycosylase [Moraxella catarrhalis BC8]
          Length = 468

 Score =  110 bits (274), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 65/209 (31%), Positives = 109/209 (52%), Gaps = 5/209 (2%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F EWK     RA+ +G++  +   L  +       I  DR       + + +Y++  +SS
Sbjct: 103 FAEWKHDFIHRALAKGINANSLNALMGNATLNQRVIELDRSQAEFTKMPW-EYVESAASS 161

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             I+QG +    N  +L + +  YG P  I  A+WG+E+ +G  MG   L+S L++LAYD
Sbjct: 162 NRISQGRSKLNENLSILTSAESIYGTPKEITAAIWGMESSYGAGMGSMDLVSALSSLAYD 221

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR +F   Q    L ++++G +++  L G+  G +G  QF+P   ++ +ID D +G+ +
Sbjct: 222 GRRREFAENQLLAMLLMIERGDVAASQLKGSWAGGMGHTQFIPTTWIQESIDGDANGRKN 281

Query: 221 LVKSNIDAIASAAKFLAKLGWTKCAGYQP 249
                 DA+ S A +LA  GW +  G QP
Sbjct: 282 PWNRQ-DALTSTASYLANAGWIR--GLQP 307


>gi|188993766|ref|YP_001905776.1| lytic murein transglycosylase precursor [Xanthomonas campestris pv.
           campestris str. B100]
 gi|167735526|emb|CAP53741.1| lytic murein transglycosylase precursor [Xanthomonas campestris pv.
           campestris]
          Length = 719

 Score =  110 bits (274), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 62/153 (40%), Positives = 90/153 (58%), Gaps = 1/153 (0%)

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
           DYL  L  S+ ++ G A+   +  LL  L ++ GV P  ++A+WG+E+ +G   GK PLL
Sbjct: 75  DYLASLVDSQRVSDGQAMLVTHRELLTRLSEQTGVDPATIVAVWGVESDYGRITGKRPLL 134

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAI 211
            +LATL+   RR  FF  +F   L L+++G ++   L G+  G  GQ QF+P    + AI
Sbjct: 135 VSLATLSCAGRRQPFFRGEFLALLGLLQQGDLAPEGLTGSWAGAFGQTQFMPSTYARIAI 194

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGWTKC 244
           D D DG+ DLV S  DA+AS A +L K GW + 
Sbjct: 195 DGDGDGRRDLVASIPDALASTANYLVKAGWERA 227


>gi|261492527|ref|ZP_05989080.1| putative transglycosylase [Mannheimia haemolytica serotype A2 str.
           BOVINE]
 gi|261311686|gb|EEY12836.1| putative transglycosylase [Mannheimia haemolytica serotype A2 str.
           BOVINE]
          Length = 364

 Score =  110 bits (274), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 52/125 (41%), Positives = 79/125 (63%), Gaps = 1/125 (0%)

Query: 118 LINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALD 177
           L +  ++YGV    ++ALWG+E+ FG   G   +LS LATLA+D RR K FT++F  A+ 
Sbjct: 132 LTHASQKYGVQKEYILALWGMESSFGRNQGDFDVLSVLATLAFDGRREKLFTQEFVNAMK 191

Query: 178 LVKKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFL 236
           ++  G I  +  LG+  G +GQ QF+P + + YA D + DGK D+ ++  DA AS A +L
Sbjct: 192 MLDDGTIKRYELLGSWAGAMGQTQFMPTSYLTYAADGNNDGKKDIWENEADAFASIANYL 251

Query: 237 AKLGW 241
           + +GW
Sbjct: 252 STVGW 256


>gi|261496802|ref|ZP_05993176.1| putative transglycosylase [Mannheimia haemolytica serotype A2 str.
           OVINE]
 gi|261307549|gb|EEY08878.1| putative transglycosylase [Mannheimia haemolytica serotype A2 str.
           OVINE]
          Length = 364

 Score =  110 bits (274), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 52/125 (41%), Positives = 79/125 (63%), Gaps = 1/125 (0%)

Query: 118 LINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALD 177
           L +  ++YGV    ++ALWG+E+ FG   G   +LS LATLA+D RR K FT++F  A+ 
Sbjct: 132 LTHASQKYGVQKEYILALWGMESSFGRNQGDFDVLSVLATLAFDGRREKLFTQEFVNAMK 191

Query: 178 LVKKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFL 236
           ++  G I  +  LG+  G +GQ QF+P + + YA D + DGK D+ ++  DA AS A +L
Sbjct: 192 MLDDGTIKRYELLGSWAGAMGQTQFMPTSYLTYAADGNNDGKKDIWENEADAFASIANYL 251

Query: 237 AKLGW 241
           + +GW
Sbjct: 252 STVGW 256


>gi|89069939|ref|ZP_01157272.1| peptidoglycan binding domain protein [Oceanicola granulosus
           HTCC2516]
 gi|89044493|gb|EAR50621.1| peptidoglycan binding domain protein [Oceanicola granulosus
           HTCC2516]
          Length = 375

 Score =  110 bits (274), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 72/214 (33%), Positives = 105/214 (49%), Gaps = 5/214 (2%)

Query: 34  ICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVT-SPPVSFK 92
           + +D    F +W +A R RA + G     A   F  L      + RDR       P+   
Sbjct: 1   MSADEQRSFTDWHAAFRERARQRGNVGPAALAAFDALTPDPEVLQRDRSQAELVRPIW-- 58

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
           DYLD   +   +  G AL      L   + + YGV P I++A+WG+ET +G   G+  +L
Sbjct: 59  DYLDRAVTDARVDAGRALLSERRELFGRISERYGVAPEIVVAIWGVETGYGRDRGRFDVL 118

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAID 212
             LATLA D RR   F  Q   AL + + G  +    G+  G +G  QF+P + + YA+D
Sbjct: 119 RALATLAADGRRRGLFEAQLMAALRIHEDG-DAREMRGSWAGAMGHTQFMPTSYLAYAVD 177

Query: 213 ADEDGKIDLVKSN-IDAIASAAKFLAKLGWTKCA 245
            D DG+ D+   +  DA+AS A +LA+ GW   A
Sbjct: 178 FDGDGRRDIWSDDPTDALASTAAYLARFGWQSGA 211


>gi|89067811|ref|ZP_01155255.1| Membrane-bound lytic murein transglycosylase B [Oceanicola
           granulosus HTCC2516]
 gi|89046409|gb|EAR52465.1| Membrane-bound lytic murein transglycosylase B [Oceanicola
           granulosus HTCC2516]
          Length = 419

 Score =  110 bits (274), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 66/188 (35%), Positives = 99/188 (52%), Gaps = 3/188 (1%)

Query: 58  MSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRL 117
           +S  T    FAD  +L   I RDR   T    + +DYL   +S E +A G A    +   
Sbjct: 68  ISAATLDTAFADAGFLPGVIERDRNQ-TEFTRTLEDYLAIAASDERLALGRAAFARHRGA 126

Query: 118 LINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALD 177
           L  ++  YGVP  ++ A+WGLE+ +G  MG  P++S  +TLAY+ RR  FF  Q   AL 
Sbjct: 127 LSAIEARYGVPAHVVAAVWGLESRYGTRMGDIPVVSATSTLAYEGRRGAFFEAQLMAALR 186

Query: 178 LVKKG-VISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNI-DAIASAAKF 235
           +++ G  + S+  G+  G +G  QF+P     +A+D   DG+ D+   +  DA+AS A  
Sbjct: 187 ILQSGDTVPSNMTGSWAGAMGHTQFIPTTYEAFAVDFTGDGRRDIWSDDPSDALASTANH 246

Query: 236 LAKLGWTK 243
            A  GW +
Sbjct: 247 FADHGWRQ 254


>gi|330445498|ref|ZP_08309150.1| lytic murein transglycosylase family protein [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
 gi|328489689|dbj|GAA03647.1| lytic murein transglycosylase family protein [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
          Length = 323

 Score =  110 bits (274), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 60/194 (30%), Positives = 100/194 (51%), Gaps = 2/194 (1%)

Query: 50  RARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIA 109
           +A A  +G+S       F  + +    +  D+       ++   Y+        + Q   
Sbjct: 35  KAEARSKGISEPILDSAFDGITFTHRAVKADKNQ-PEKKLTLDQYIPRAVPDWKVKQARR 93

Query: 110 LKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFT 169
           L   N   L  + KEYGV P  ++ALWG+E++FG+  G   ++  L TLAY+ RR + F 
Sbjct: 94  LYHENKETLDRIGKEYGVQPRFIVALWGVESNFGKLQGNYHVVEALTTLAYEGRREELFR 153

Query: 170 EQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDA 228
           +Q   AL ++++G I+   + G+  G +GQ QF+P + + +A+D + DGK D+  +  D 
Sbjct: 154 KQVMAALQILQEGHITIDEMRGSWAGAMGQCQFMPTSYLTFAVDGNNDGKADIWNTKADV 213

Query: 229 IASAAKFLAKLGWT 242
            ASAA +L K GW 
Sbjct: 214 FASAANYLKKSGWN 227


>gi|260914130|ref|ZP_05920603.1| conserved hypothetical protein [Pasteurella dagmatis ATCC 43325]
 gi|260631763|gb|EEX49941.1| conserved hypothetical protein [Pasteurella dagmatis ATCC 43325]
          Length = 364

 Score =  110 bits (274), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 66/237 (27%), Positives = 117/237 (49%), Gaps = 14/237 (5%)

Query: 20  AQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIAR 79
           +Q    P  +  Q+    T + F ++    + +A  EG+S K   H    + Y+   +  
Sbjct: 23  SQPEINPLDSNMQYNNMRTVENFDDYVKFLKGKAKGEGVSDKVL-HENQQINYIQKAVDL 81

Query: 80  DRKM------------VTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGV 127
           DR+             V   P    +YL+ + +   +           + L    + +GV
Sbjct: 82  DRQQAGKIRKRDPNEPVRLNPNGTTNYLNRVLTQRKVDIASERYWEQQKQLEQASQRFGV 141

Query: 128 PPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVI-SS 186
               L++LWG+E+ FG   G   +LS LATLA++ RR K F+++F  A+ ++++  I   
Sbjct: 142 QKEYLLSLWGMESSFGYYQGNYDVLSVLATLAFEGRREKLFSQEFVSAMKMLERQDIPRQ 201

Query: 187 HALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTK 243
             LG+  G +GQ QF+P + ++YA D ++DG+ D+ K++ D  AS A +L+ +GW K
Sbjct: 202 RMLGSWAGAMGQTQFMPSSYLRYAADGNQDGEKDIWKNHYDVFASIASYLSTVGWNK 258


>gi|332533390|ref|ZP_08409255.1| membrane-bound lytic murein transglycosylase B precursor
           [Pseudoalteromonas haloplanktis ANT/505]
 gi|332037099|gb|EGI73556.1| membrane-bound lytic murein transglycosylase B precursor
           [Pseudoalteromonas haloplanktis ANT/505]
          Length = 338

 Score =  110 bits (274), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 66/212 (31%), Positives = 108/212 (50%), Gaps = 6/212 (2%)

Query: 34  ICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPV--SF 91
           + + T   F ++ +  +  A+ +G   K     FA   Y +  ++ D+     P V  + 
Sbjct: 18  VMAKTQAEFQDYLANLKQEAIAKGYEAKLIDDAFATATYKEKVVSADK---NQPEVKETL 74

Query: 92  KDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPL 151
           + YL        I +   L   N  +L  + KE+GV    ++ALWGLE++FG   G   +
Sbjct: 75  ETYLPKRVPQWKIDRARKLYAENKEVLEKVAKEFGVQARFIVALWGLESNFGTIQGGHNV 134

Query: 152 LSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYA 210
           +S+L TLA+D RR   +  Q + ALD++K G I+     G+  G +GQ QF+P +   YA
Sbjct: 135 ISSLVTLAFDGRREALYKRQLWAALDILKSGHITLDKFKGSWAGAMGQTQFMPTSFNAYA 194

Query: 211 IDADEDGKIDLVKSNIDAIASAAKFLAKLGWT 242
           +D + DG+ D+  +  DA AS A +L + GW 
Sbjct: 195 VDYNNDGRKDIWTTKEDAFASIANYLKQEGWN 226


>gi|126738028|ref|ZP_01753749.1| hypothetical protein RSK20926_05827 [Roseobacter sp. SK209-2-6]
 gi|126720525|gb|EBA17230.1| hypothetical protein RSK20926_05827 [Roseobacter sp. SK209-2-6]
          Length = 389

 Score =  110 bits (274), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 69/208 (33%), Positives = 100/208 (48%), Gaps = 4/208 (1%)

Query: 36  SDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDR-KMVTSPPVSFKDY 94
           S     F  + +  +  AV  G    T    F         +  DR + V   P  F ++
Sbjct: 19  SQCGGSFSNFVAGLKQEAVTAGYDVATVNAFFKGARQDPKVLKADRAQGVFQKP--FIEF 76

Query: 95  LDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLST 154
              L S   I +G A+ K    +   ++  YG+  G+L+A W  ET +G   G     + 
Sbjct: 77  SRRLISQNRIDRGRAMAKKYDSIFRRIEDTYGIDRGVLLAFWAFETDYGAFQGDFNTRNA 136

Query: 155 LATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDA 213
           L TLA+DCRR + F  Q F AL+L K+G  + +   GA  GEIG  Q LP ++++  +DA
Sbjct: 137 LITLAHDCRRPELFRPQIFAALELYKRGNFAPNRTTGAWAGEIGMVQMLPKDILENGVDA 196

Query: 214 DEDGKIDLVKSNIDAIASAAKFLAKLGW 241
           D DG++ L  S  DA+ S  K LA LGW
Sbjct: 197 DGDGQVSLKNSAPDALMSGGKMLAHLGW 224


>gi|260432728|ref|ZP_05786699.1| lytic murein transglycosylase [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260416556|gb|EEX09815.1| lytic murein transglycosylase [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 387

 Score =  110 bits (274), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 67/204 (32%), Positives = 102/204 (50%), Gaps = 10/204 (4%)

Query: 50  RARAVREGMSPKTAKHLFADLEYLDTTIARDR-KMVTSPPVSFKDYLDGLSSSEIIAQGI 108
           +A A ++G    T    F  ++     +  DR + V   P  F ++   L S + I +G 
Sbjct: 33  KAEAAQQGFDTATVDAFFNGVQQDPKVLKADRAQGVFQKP--FIEFSRRLISQDRIRRGQ 90

Query: 109 ALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFF 168
           A+ +    +   ++ EYGV  G+L+A W  ET +G   G     + L TLA+DCRR + F
Sbjct: 91  AMAQKYDAVFDRIEAEYGVSRGVLLAFWAFETDYGAFQGDFNTRNALVTLAHDCRRPELF 150

Query: 169 TEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNID 227
             Q F A++L + G    +   GA  GEIG  Q LP ++++  +D D DG + L  S  D
Sbjct: 151 RPQIFAAIELFRNGDFDPNRTTGAWAGEIGMVQMLPRDILENGVDGDGDGHVRLKTSAPD 210

Query: 228 AIASAAKFLAKLGWTKCAGYQPGE 251
           A+ S  K L+ LGW      QPG+
Sbjct: 211 ALMSGGKMLSHLGW------QPGQ 228


>gi|87199961|ref|YP_497218.1| lytic murein transglycosylase [Novosphingobium aromaticivorans DSM
           12444]
 gi|87135642|gb|ABD26384.1| Lytic murein transglycosylase [Novosphingobium aromaticivorans DSM
           12444]
          Length = 339

 Score =  110 bits (274), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 69/194 (35%), Positives = 96/194 (49%), Gaps = 3/194 (1%)

Query: 51  ARAVREGMSPKTAKHLFADLEYLDTTIARDRKM---VTSPPVSFKDYLDGLSSSEIIAQG 107
           ARA  EG+   T   + + L      I  DR      T P  +F+ Y      +  IA+G
Sbjct: 37  ARARGEGVRETTISAMTSGLTLNHRVIELDRSQPGSATGPIANFEPYRRQHVDAARIARG 96

Query: 108 IALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKF 167
                A S  L  +++ YGVP  IL+A+WG ET +G   G   L   LATLAY+ RR + 
Sbjct: 97  RRQFAAASGQLATIERRYGVPGPILLAIWGHETDYGGYTGNFDLPRALATLAYEGRRREL 156

Query: 168 FTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNID 227
           F ++F  A+ +V +GV  S  +G+  G  G  QFLP   ++ A D D DG  D+  S  D
Sbjct: 157 FADEFIAAMKMVDRGVPRSKLVGSWAGAFGNPQFLPSVYLRVAQDGDGDGFADIWTSRAD 216

Query: 228 AIASAAKFLAKLGW 241
            +AS A +    GW
Sbjct: 217 TLASIANYFRDAGW 230


>gi|126464704|ref|YP_001045817.1| lytic murein transglycosylase [Rhodobacter sphaeroides ATCC 17029]
 gi|126106515|gb|ABN79045.1| lytic murein transglycosylase [Rhodobacter sphaeroides ATCC 17029]
          Length = 413

 Score =  109 bits (273), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 75/233 (32%), Positives = 121/233 (51%), Gaps = 6/233 (2%)

Query: 45  WKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEII 104
           W +  R RA   G+ P T    F    +L   I RDR   T    + +DYL   +S E +
Sbjct: 47  WVAGFRPRAFGAGIDPGTFDRAFRSAGFLPDVIERDRNQ-TEFTRTTEDYLSIAASEERV 105

Query: 105 AQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRR 164
           + G A    ++ +L  ++  YGV   ++ A+WG+E+ +GE  G  P++S L+TLA++ RR
Sbjct: 106 SLGRAALARHAGVLSQIESRYGVEAEVVTAVWGVESRYGERRGDVPIVSALSTLAFEGRR 165

Query: 165 AKFFTEQFFYALDLVKKG-VISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVK 223
             FF  Q   AL +++ G    +H  G+  G +G  QF+P + + YA+D + DG+ D+  
Sbjct: 166 GAFFESQLIAALKILQSGDTDPAHLTGSWAGAMGHTQFIPTSYLAYAVDFNGDGRRDIWS 225

Query: 224 SN-IDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIAYIAA 275
            +  DA+ASAA +L++ GW +    QP      +   +N+ L    T    AA
Sbjct: 226 DDPTDALASAAAYLSRSGWRRG---QPWGVEVQLPAGFNSGLAGRGTTRSPAA 275


>gi|319781607|ref|YP_004141083.1| lytic murein transglycosylase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317167495|gb|ADV11033.1| lytic murein transglycosylase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 406

 Score =  109 bits (273), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 72/218 (33%), Positives = 116/218 (53%), Gaps = 14/218 (6%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTI---ARDRKMVTSPPVSFKDYLDGL 98
           F +W +  RA AV+ G+S       F ++  +D  +   AR +   T+P     DY D  
Sbjct: 35  FRQWVAGFRATAVQSGVSGALYDQAFRNIRDIDPVVLEKARTQPEFTAPAW---DYFDNR 91

Query: 99  SSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLS----T 154
              + +A G  + +     L  ++  +GV   IL+A+W +E+++GE + +  ++     +
Sbjct: 92  VHDQSVAVGQQMARKWKPWLDRIEARFGVDRYILLAIWSMESNYGEILKRDDIMRNVVRS 151

Query: 155 LATLAY-DCRRAKFFTEQFFYALDLVKKGVI-SSHALGATFGEIGQFQFLPVNVVKYAID 212
           LATLAY D +RAKF   Q   AL +++ G I  SH  G+  G +G  QF+P + + YA+D
Sbjct: 152 LATLAYADPKRAKFARTQLIAALKILQTGDIDESHLSGSWAGAMGHTQFIPTSYLHYAVD 211

Query: 213 ADEDGKIDLVKSNIDAIASAAKFLAKLGWT--KCAGYQ 248
            D +GK D+  S  DA+A++A  L K GW   K  GY+
Sbjct: 212 MDGNGKRDIWNSIPDALATSANLLKKNGWQAGKTWGYE 249


>gi|302806872|ref|XP_002985167.1| hypothetical protein SELMODRAFT_424300 [Selaginella moellendorffii]
 gi|300146995|gb|EFJ13661.1| hypothetical protein SELMODRAFT_424300 [Selaginella moellendorffii]
          Length = 450

 Score =  109 bits (273), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 64/205 (31%), Positives = 109/205 (53%), Gaps = 11/205 (5%)

Query: 45  WKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPP--VSFKDYLDGLSSSE 102
           W    +  A++ G+   T    F  ++     + +D+   T P   ++ +DY+  + S  
Sbjct: 142 WLEDLKEEAIQRGVGKDTVLEAFDGVKISPKIMEKDQ---TQPEKTLTAEDYIKTMVSQS 198

Query: 103 IIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD- 161
            +++G+     N  LL  +  EYGVP  +L+++WG+E+++G   G   ++  L TLA+D 
Sbjct: 199 RVSRGVQAFVDNKALLEEISAEYGVPASLLVSIWGIESNYGSYTGSWNVIQALVTLAFDS 258

Query: 162 --CRRAKFFTEQFFYALDLVKKGVISSHAL---GATFGEIGQFQFLPVNVVKYAIDADED 216
              RR  FF ++ F+AL ++ K    S+A    G+  G +GQ QF+P +   YA+D D D
Sbjct: 259 PEARRRAFFRDEVFHALFILDKAEGPSNAAGLKGSWAGAMGQCQFMPSSFRNYAVDFDRD 318

Query: 217 GKIDLVKSNIDAIASAAKFLAKLGW 241
           G+ D+  S  D  AS A +LA+ GW
Sbjct: 319 GRKDIWSSKADIFASIANYLAEHGW 343


>gi|319782828|ref|YP_004142304.1| lytic murein transglycosylase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317168716|gb|ADV12254.1| lytic murein transglycosylase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 393

 Score =  109 bits (273), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 69/210 (32%), Positives = 101/210 (48%), Gaps = 2/210 (0%)

Query: 34  ICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKD 93
           +  +    F  WK    A A   G+       L A     D  +ARDR        +F +
Sbjct: 22  MAQECGGDFESWKQGVAAEAKAAGVGAVGLDALEA-ATLDDKVLARDRAQGVFT-QTFVE 79

Query: 94  YLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLS 153
           + + + S+  + QG A  K  + +     +++GV   I+ A W LET FG   G    LS
Sbjct: 80  FSNRMISAYRLKQGAANMKKYADVFARADQQFGVQAPIIAAFWALETDFGAVQGDFHTLS 139

Query: 154 TLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDA 213
            L TL++DCRR + F +Q    L+L+ +GV+ +   GA  GEIGQ Q LP + +   +D 
Sbjct: 140 ALVTLSHDCRRPQLFRQQLVPLLELIDRGVLPADVRGAWAGEIGQTQILPSDYLARGVDG 199

Query: 214 DEDGKIDLVKSNIDAIASAAKFLAKLGWTK 243
           D DGKIDL  S  D I + A  +   GW +
Sbjct: 200 DGDGKIDLRGSVPDVIMTTANKVLSRGWKR 229


>gi|296113146|ref|YP_003627084.1| putative lytic murein transglycosylase [Moraxella catarrhalis RH4]
 gi|295920840|gb|ADG61191.1| putative lytic murein transglycosylase [Moraxella catarrhalis RH4]
          Length = 483

 Score =  109 bits (273), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 66/209 (31%), Positives = 108/209 (51%), Gaps = 5/209 (2%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F EWK     RA+ +G++  +   L  +       I  DR       + + +Y++  +SS
Sbjct: 118 FTEWKHDFIHRALAKGINANSLNSLMGNATLNQRVIELDRSQAEFTKMPW-EYVESAASS 176

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             I+QG +    N  +L + +  YG P  I  A+WG+E+ +G  MG   L+S L++LAYD
Sbjct: 177 NRISQGRSKLNENLSILTSAESIYGTPKEITAAIWGMESSYGAGMGSMDLVSALSSLAYD 236

Query: 162 CRRAKFFTEQFFYALDLVKKG-VISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR +F   Q    L ++++G V +S   G+  G +G  QF+P   ++ +ID D +G+ +
Sbjct: 237 GRRREFAENQLLAMLLMIERGDVAASQLKGSWAGGMGHTQFIPTTWIQESIDGDANGRKN 296

Query: 221 LVKSNIDAIASAAKFLAKLGWTKCAGYQP 249
                 DA+ S A +LA  GW +  G QP
Sbjct: 297 PWNRQ-DALTSTASYLANAGWIR--GLQP 322


>gi|89075747|ref|ZP_01162135.1| putative lytic murein transglycosylase [Photobacterium sp. SKA34]
 gi|89048479|gb|EAR54054.1| putative lytic murein transglycosylase [Photobacterium sp. SKA34]
          Length = 322

 Score =  109 bits (273), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 59/194 (30%), Positives = 100/194 (51%), Gaps = 2/194 (1%)

Query: 50  RARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIA 109
           +A A   G+S       F  + +    +  D+       ++   Y+    +   + Q   
Sbjct: 35  KAEARSNGISEPILDSAFKGITFTHRAVKADKNQ-PEKKLTLDQYIPRAVTDWKVKQARR 93

Query: 110 LKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFT 169
           L + N   L  + KEYGV P  ++ALWG+E++FG+  G   ++  L TLAY+ RR   F 
Sbjct: 94  LYQENKTTLDRIGKEYGVQPRFIVALWGVESNFGKLQGNYHVVEALTTLAYEGRREALFR 153

Query: 170 EQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDA 228
           +Q   AL ++++G I+   + G+  G +GQ QF+P + + +A+D + DG+ D+  +  D 
Sbjct: 154 KQVMAALQILQEGHITIDEMKGSWAGAMGQCQFMPTSYLTFAVDGNNDGRADIWNTKADV 213

Query: 229 IASAAKFLAKLGWT 242
            ASAA +L K GW 
Sbjct: 214 FASAANYLKKSGWN 227


>gi|120611895|ref|YP_971573.1| lytic murein transglycosylase [Acidovorax citrulli AAC00-1]
 gi|120590359|gb|ABM33799.1| lytic murein transglycosylase [Acidovorax citrulli AAC00-1]
          Length = 470

 Score =  109 bits (273), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 69/213 (32%), Positives = 105/213 (49%), Gaps = 12/213 (5%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKM--VTSPPVSFKDYLDGLS 99
           F EW +  R  A++ G+ P+         ++L   I  DR     T  P +   YLD   
Sbjct: 101 FAEWIAGFRQEALQAGIRPEAVAAALDGAQWLPQVIELDRSQPEFTRTPWA---YLDSAV 157

Query: 100 SSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLA 159
           S   I +G          L +    YGVP  ++ A+WG+E+++G   G    +  LATLA
Sbjct: 158 SPTRIQRGRDALAEQRAALDSAAARYGVPAEVITAIWGMESNYGSNFGTFRTVDALATLA 217

Query: 160 YDCRRAKFFTEQFFYALDLVKKGVISS-HALGATFGEIGQFQFLPVNVVKYAIDADEDGK 218
           Y+ RR  +   +   AL ++ +G I++   +G+  G +G  QFLP   + YA+DAD DG 
Sbjct: 218 YEGRRRDWARGELLAALRIIDQGDIAADRMIGSWAGAMGHTQFLPSVFLGYAVDADGDGH 277

Query: 219 IDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGE 251
            D+  S  D  AS A FL+++GW      QPG+
Sbjct: 278 RDIWGSVPDVAASTANFLSRMGW------QPGQ 304


>gi|157962263|ref|YP_001502297.1| lytic murein transglycosylase [Shewanella pealeana ATCC 700345]
 gi|157847263|gb|ABV87762.1| lytic murein transglycosylase [Shewanella pealeana ATCC 700345]
          Length = 331

 Score =  109 bits (272), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 68/223 (30%), Positives = 114/223 (51%), Gaps = 4/223 (1%)

Query: 29  ATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPP 88
           ++T    S+T   F  + +  +  A+ +G S +T   +F  ++     +  ++  +  P 
Sbjct: 18  SSTAMAESETQGTFSNYVAELKQDAIDKGFSQQTIDEVFPKIKMFKKALVSNKDPIEDP- 76

Query: 89  VSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGK 148
           ++ + YL  +     +    A  K +   L  + + YGV P  ++AL G+E++ G+  G 
Sbjct: 77  ITLETYLPQIVPQTKVDLARAFYKQHYTELEKIGERYGVQPRFIVALLGIESNLGQDAGG 136

Query: 149 TPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVV 207
            P+LS  A+LAY  +R   F ++FF AL +V +G I    L G + G +GQ  FLP   +
Sbjct: 137 YPVLSVTASLAYQGQREAHFRQEFFAALKIVDQGHIDFSELKGTSTGTMGQPLFLPSIYL 196

Query: 208 KYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW--TKCAGYQ 248
            YA D D DG+ D+  +N D  ASAA +L + GW  T+  G Q
Sbjct: 197 AYAQDGDGDGRKDIWSNNSDVFASAAYYLQQAGWKATETWGRQ 239


>gi|163758871|ref|ZP_02165958.1| putative membrane-bound lytic murein transglycosylase protein
           [Hoeflea phototrophica DFL-43]
 gi|162284161|gb|EDQ34445.1| putative membrane-bound lytic murein transglycosylase protein
           [Hoeflea phototrophica DFL-43]
          Length = 393

 Score =  109 bits (272), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 65/206 (31%), Positives = 113/206 (54%), Gaps = 6/206 (2%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F +W ++  + A + G++  T    F  +   D  +    +          DYLD   + 
Sbjct: 19  FRQWVASFYSTAAKSGITQATYNAAFNGVTAPDPRVLEKARFQPEFTTKVWDYLDSRVNP 78

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL----STLAT 157
             IA+G  ++  ++R L  +++++G+   +L+A+W +E++FGE + KT  L      LAT
Sbjct: 79  YTIAKGREMQARHARTLAAIERKFGIDASVLLAIWSMESNFGEILTKTDRLHYVPQALAT 138

Query: 158 LAY-DCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADE 215
           LAY D +RAKF  +Q   AL +++ G I++  + G+  G +G  QF+P + + +A+DAD 
Sbjct: 139 LAYGDRKRAKFARQQLVAALKILQSGDIAAREMTGSWAGAMGHTQFIPTSYLAFAVDADG 198

Query: 216 DGKIDLVKSNIDAIASAAKFLAKLGW 241
           +G  D+  S  DA+A+AA  L K GW
Sbjct: 199 NGHRDIWNSIPDALATAANLLKKNGW 224


>gi|90580082|ref|ZP_01235890.1| putative lytic murein transglycosylase [Vibrio angustum S14]
 gi|90438967|gb|EAS64150.1| putative lytic murein transglycosylase [Vibrio angustum S14]
          Length = 322

 Score =  109 bits (272), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 61/202 (30%), Positives = 102/202 (50%), Gaps = 2/202 (0%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F  + +  +A A   G+S       F  + +    +  D+       ++   Y+      
Sbjct: 27  FNAYINKLKAEARSNGISEPILDSAFKGITFTHRAVKADKNQ-PEKKLTLDQYIPRAVPD 85

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             + Q   L + N   L  + KEYGV P  ++ALWG+E++FG+  G   ++  L TLAY+
Sbjct: 86  WKVKQARRLYQENKTTLDRIGKEYGVQPRFIVALWGVESNFGKLQGNYHVVEALTTLAYE 145

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR   F +Q   AL ++++G I+   + G+  G +GQ QF+P + + +A+D + DGK D
Sbjct: 146 GRREALFRKQVMAALQILQEGHITIDEMKGSWAGAMGQCQFMPTSYLTFAVDGNNDGKAD 205

Query: 221 LVKSNIDAIASAAKFLAKLGWT 242
           +  +  D  ASAA +L K GW 
Sbjct: 206 IWNTKADVFASAANYLKKSGWN 227


>gi|259417667|ref|ZP_05741586.1| lytic murein transglycosylase [Silicibacter sp. TrichCH4B]
 gi|259346573|gb|EEW58387.1| lytic murein transglycosylase [Silicibacter sp. TrichCH4B]
          Length = 398

 Score =  109 bits (272), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 64/191 (33%), Positives = 97/191 (50%), Gaps = 4/191 (2%)

Query: 53  AVREGMSPKTAKHLFADLEYLDTTIARDRKM-VTSPPVSFKDYLDGLSSSEIIAQGIALK 111
           AV  G +  T    F  +    + +  DR   V   P  F ++   L S   + +G +  
Sbjct: 45  AVSAGYAISTVNEFFNGVSQDQSVLRADRSQGVFQKP--FVEFSRRLISQSRLNRGRSKG 102

Query: 112 KANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQ 171
           +   ++   ++  YG+  G+L+A W  ET +G   G     + L TLA+DCRR   F  Q
Sbjct: 103 EEFDKIFDRIETTYGINRGVLLAFWAFETDYGAVQGDFNTRNALVTLAHDCRRPDLFRPQ 162

Query: 172 FFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIA 230
            F AL+L +KG    +   GA  GEIG  Q LP +++++ +DAD DG + L  S  DA+ 
Sbjct: 163 IFSALELYRKGDFDPARTTGAWAGEIGMVQMLPSDILEHGVDADGDGHVTLKTSAADALM 222

Query: 231 SAAKFLAKLGW 241
           SAA+ L+ LGW
Sbjct: 223 SAARMLSHLGW 233


>gi|163856176|ref|YP_001630474.1| putative peptidoglycan-binding protein [Bordetella petrii DSM
           12804]
 gi|163259904|emb|CAP42205.1| putative peptidoglycan-binding protein [Bordetella petrii]
          Length = 421

 Score =  109 bits (272), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 56/150 (37%), Positives = 88/150 (58%), Gaps = 1/150 (0%)

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
           DYL  L   E IA G    +     L   + ++GV P  ++A+WG+E++FG+ +G  PLL
Sbjct: 87  DYLAALVDDERIADGRQALQQWQPELARAQAQFGVDPATVVAVWGVESNFGKKLGGRPLL 146

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATF-GEIGQFQFLPVNVVKYAI 211
           ++L+TL+   RR  +F  +FF  L ++++  +    L  ++ G  GQ QF+P   ++ A+
Sbjct: 147 TSLSTLSCFGRRQSYFRGEFFATLKIIEQEHVRPERLNGSWAGAFGQTQFMPSTYLRLAV 206

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
           D D DG+ DLV S  DA+AS A FL + GW
Sbjct: 207 DFDGDGRRDLVDSVPDALASTANFLKRAGW 236


>gi|302772825|ref|XP_002969830.1| hypothetical protein SELMODRAFT_410831 [Selaginella moellendorffii]
 gi|300162341|gb|EFJ28954.1| hypothetical protein SELMODRAFT_410831 [Selaginella moellendorffii]
          Length = 1366

 Score =  109 bits (272), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 64/205 (31%), Positives = 109/205 (53%), Gaps = 11/205 (5%)

Query: 45   WKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPP--VSFKDYLDGLSSSE 102
            W    +  A++ G+   T    F  ++     + +D+   T P   ++ +DY+  + S  
Sbjct: 1058 WLEDLKEEAIQRGVGKDTVLEAFDGVKISPKIMEKDQ---TQPEKTLTAEDYIKTMVSQS 1114

Query: 103  IIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD- 161
             +++G+     N  LL  +  EYGVP  +L+++WG+E+++G   G   ++  L TLA+D 
Sbjct: 1115 RVSRGVQAFVDNKALLEEISAEYGVPASLLVSIWGIESNYGSYTGSWNVIQALVTLAFDS 1174

Query: 162  --CRRAKFFTEQFFYALDLVKKGVISSHAL---GATFGEIGQFQFLPVNVVKYAIDADED 216
               RR  FF ++ F+AL ++ K    S+A    G+  G +GQ QF+P +   YA+D D D
Sbjct: 1175 PEARRRAFFRDEVFHALFILDKAEGPSNAAGLKGSWAGAMGQCQFMPSSFRNYAVDFDRD 1234

Query: 217  GKIDLVKSNIDAIASAAKFLAKLGW 241
            G+ D+  S  D  AS A +LA+ GW
Sbjct: 1235 GRKDIWSSKADIFASIANYLAEHGW 1259


>gi|293604157|ref|ZP_06686565.1| type III effector HopAJ2 [Achromobacter piechaudii ATCC 43553]
 gi|292817382|gb|EFF76455.1| type III effector HopAJ2 [Achromobacter piechaudii ATCC 43553]
          Length = 411

 Score =  109 bits (272), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 84/151 (55%), Gaps = 1/151 (0%)

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
           DY+ GL   E +  G A        L      Y V P  + A+WG+E++FG T+G  PLL
Sbjct: 87  DYMAGLVDDERVTDGQAGMARWQAELARAASRYRVDPATIAAVWGVESNFGRTLGGRPLL 146

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAI 211
           ++L+TL+   RR  +F  +FF  L +++   I    L G+  G  GQ QF+P   ++ A+
Sbjct: 147 TSLSTLSCFGRRQAYFRGEFFATLKIIQDEHIDPQRLVGSWAGAFGQTQFMPSTYLRLAV 206

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGWT 242
           D D DG+ DL+ S  DA+AS A FLA+ GW 
Sbjct: 207 DFDGDGRRDLIDSVPDALASTANFLARAGWN 237


>gi|311104883|ref|YP_003977736.1| lytic murein transglycosylase family protein [Achromobacter
           xylosoxidans A8]
 gi|310759572|gb|ADP15021.1| lytic murein transglycosylase family protein [Achromobacter
           xylosoxidans A8]
          Length = 415

 Score =  109 bits (272), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 64/182 (35%), Positives = 94/182 (51%), Gaps = 14/182 (7%)

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
           DY+  L   E +A G A        L      YGV P  + A+WG+E+++G T+G  PLL
Sbjct: 91  DYMAALVDDERVADGQAGMARWQSDLERAASRYGVDPATIAAVWGVESNYGRTLGGRPLL 150

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAI 211
           ++L+TL+   RR  +F  +FF  L +++   I+   L G+  G  GQ QF+P   ++ A+
Sbjct: 151 TSLSTLSCFGRRQAYFRGEFFATLKIIQDEHIAPERLTGSWAGAFGQTQFMPSTYLRLAV 210

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCA--GYQ-----------PGEKNFAILK 258
           D D DG+ DLV S  DA+AS A FL + GW      GY+            G KN   + 
Sbjct: 211 DFDGDGRRDLVDSVPDALASTANFLKRAGWNSALHWGYEVRLPAGLDTSGAGRKNKRAMS 270

Query: 259 HW 260
           +W
Sbjct: 271 YW 272


>gi|13471570|ref|NP_103136.1| transglycolase [Mesorhizobium loti MAFF303099]
 gi|14022312|dbj|BAB48922.1| probable transglycolase [Mesorhizobium loti MAFF303099]
          Length = 392

 Score =  108 bits (271), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 66/202 (32%), Positives = 98/202 (48%), Gaps = 2/202 (0%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F  WK    A A   G+          D    +  +ARDR        +F ++ + + S+
Sbjct: 29  FETWKQGVAAEAKAAGVG-AVGLDALEDATIDERALARDRAQGVFT-QTFIEFSNRMISA 86

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             + QG A  K  + +     +++GV   ++ A W LET FG   G    LS L TL++D
Sbjct: 87  YRLKQGAANMKKYADVFARADQQFGVQAPVITAFWALETDFGAVQGDFHTLSALVTLSHD 146

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDL 221
           CRR + F +Q    L+L+ +GV+ +   GA  GEIGQ Q LP + +   +D D DGKIDL
Sbjct: 147 CRRPQLFRQQLVPLLELIDRGVLPADVKGAWAGEIGQTQILPSDYLARGVDGDGDGKIDL 206

Query: 222 VKSNIDAIASAAKFLAKLGWTK 243
             S  D I + A  +   GW +
Sbjct: 207 RNSVPDVIMTTANKVLSRGWKR 228


>gi|254475203|ref|ZP_05088589.1| lytic murein transglycosylase [Ruegeria sp. R11]
 gi|214029446|gb|EEB70281.1| lytic murein transglycosylase [Ruegeria sp. R11]
          Length = 390

 Score =  108 bits (271), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 67/202 (33%), Positives = 98/202 (48%), Gaps = 4/202 (1%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDR-KMVTSPPVSFKDYLDGLSS 100
           F  + S+ +  A+  G    T    F  +      +  DR + V   P  F ++   L S
Sbjct: 26  FSNFVSSLKEEAMTGGYDRATVNRFFKGVRQDPAVLKADRAQGVFQKP--FVEFSQRLIS 83

Query: 101 SEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAY 160
              + +G A+ K    +   ++  YG+  G+L+A W  ET +G   G    L+ L TLA+
Sbjct: 84  QGRLDRGRAMSKKYDAIFRRIETTYGIDRGVLLAFWAFETDYGAVQGNFNTLNALVTLAH 143

Query: 161 DCRRAKFFTEQFFYALDLVKKGVISSH-ALGATFGEIGQFQFLPVNVVKYAIDADEDGKI 219
           DCRR + F  Q F AL+L   G        GA  GEIG  Q LP ++++  +DAD DG +
Sbjct: 144 DCRRPELFRPQVFAALELYSNGDFDPQKTTGAWAGEIGMVQMLPRDILENGVDADGDGHV 203

Query: 220 DLVKSNIDAIASAAKFLAKLGW 241
            L  S  DA+ S AK L+ LGW
Sbjct: 204 RLKTSAPDALMSGAKMLSHLGW 225


>gi|315498554|ref|YP_004087358.1| lytic murein transglycosylase [Asticcacaulis excentricus CB 48]
 gi|315416566|gb|ADU13207.1| lytic murein transglycosylase [Asticcacaulis excentricus CB 48]
          Length = 442

 Score =  108 bits (271), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 68/212 (32%), Positives = 106/212 (50%), Gaps = 11/212 (5%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVT-SPPVSFKDYLDGLSS 100
           F +W+ A  A+A   G      ++L  D++  ++ +  D      S P+S   Y+    S
Sbjct: 61  FADWREAFVAKAAARGFERAFVENLLVDVQPKESVVKADTGQPEFSKPIS--SYVKNAVS 118

Query: 101 SEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAY 160
           +  I  G     AN  +   ++  YGVP  +L  +WG+E+ FG   G   +L+  ATLAY
Sbjct: 119 AARIQTGRERVNANPDIAA-IEARYGVPREVLGGVWGMESDFGRVQGDIDVLTAFATLAY 177

Query: 161 DCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKI 219
           D RR  +   Q    + ++K G  +   L G+  G +GQ QFLP N +K   D D DG +
Sbjct: 178 DGRRRDWAETQLLSVMTIIKSGKATRQELKGSWAGAMGQTQFLPENYLKLGQDGDGDGHV 237

Query: 220 DLVKSNIDAIASAAKFLAKLGWTKCAGYQPGE 251
           ++  S+ DA+ASAA  L      K  G++PG+
Sbjct: 238 NIWTSDSDALASAANLL------KSEGWRPGQ 263


>gi|323498253|ref|ZP_08103255.1| putative lytic murein transglycosylase [Vibrio sinaloensis DSM
           21326]
 gi|323316681|gb|EGA69690.1| putative lytic murein transglycosylase [Vibrio sinaloensis DSM
           21326]
          Length = 321

 Score =  108 bits (271), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 58/193 (30%), Positives = 104/193 (53%), Gaps = 2/193 (1%)

Query: 50  RARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIA 109
           +  A  +G+S +     FA++E+    +  DR       ++  +Y+        + Q   
Sbjct: 32  KNEARDKGISEQVISQAFANVEHKPRAVKADRNQ-PEKKLTLDEYIPRAVPDWKVKQARD 90

Query: 110 LKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFT 169
           L K + + L  + KEYGV P  ++ALWG+E++FG   G   ++  L+T+AYD RR  FF 
Sbjct: 91  LYKKHYKELQRIGKEYGVQPRFIVALWGVESNFGRFTGNYRVIDALSTMAYDGRREAFFR 150

Query: 170 EQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDA 228
           ++   AL ++++G ++     G+  G +GQ QF+P + + +A D + DG+ D+  +  D 
Sbjct: 151 KEAMAALQILEEGHVAYEDFKGSWAGAMGQCQFMPSSFLSFAADGNGDGRKDIWNTKADV 210

Query: 229 IASAAKFLAKLGW 241
            AS A +L++ GW
Sbjct: 211 FASTANYLSQSGW 223


>gi|254507810|ref|ZP_05119941.1| membrane-bound lytic murein transglycosylase B [Vibrio
           parahaemolyticus 16]
 gi|219549335|gb|EED26329.1| membrane-bound lytic murein transglycosylase B [Vibrio
           parahaemolyticus 16]
          Length = 323

 Score =  108 bits (271), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 60/201 (29%), Positives = 104/201 (51%), Gaps = 2/201 (0%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F ++    +  A   G+S +     F+D+ Y    +  DR       ++  +Y+      
Sbjct: 24  FEQYVDGLKQEAREHGISEQVISAAFSDVTYKPRAVKADRNQ-PEKKLTLDEYIPRAVPD 82

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             + Q   L + +   L  +  EYGV P  ++ALWG+E++FG   G   ++  L+T+AYD
Sbjct: 83  WKVKQAKELYEKHYETLSRIGDEYGVQPRFIVALWGVESNFGRFTGNYSVIDALSTMAYD 142

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR  FF ++   AL ++++G I      G+  G +GQ QF+P + + +A D + DGK D
Sbjct: 143 GRREAFFRKEAMAALQILEEGHIPVEDFKGSWAGAMGQCQFMPSSFLAFAADGNGDGKKD 202

Query: 221 LVKSNIDAIASAAKFLAKLGW 241
           + ++  D  ASAA +L++ GW
Sbjct: 203 IWQTEADVFASAANYLSESGW 223


>gi|13472659|ref|NP_104226.1| hypothetical protein mlr3027 [Mesorhizobium loti MAFF303099]
 gi|14023406|dbj|BAB50012.1| mlr3027 [Mesorhizobium loti MAFF303099]
          Length = 418

 Score =  108 bits (270), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 72/218 (33%), Positives = 115/218 (52%), Gaps = 14/218 (6%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTI---ARDRKMVTSPPVSFKDYLDGL 98
           F +W +  RA AV  G+S       F D++  D  +   AR +   T+P     DY D  
Sbjct: 47  FRQWVAGFRATAVAGGVSGAVYDQAFRDIKEPDPVVLEKARTQPEFTAPAW---DYFDNR 103

Query: 99  SSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLS----T 154
              + +A G  + K     L  ++  +GV   IL+A+W +E+++GE + +  ++     +
Sbjct: 104 VHDQSVAVGQQMAKKWKPWLDRIEARFGVDRYILLAIWSMESNYGEILKRDDIMRNVIRS 163

Query: 155 LATLAY-DCRRAKFFTEQFFYALDLVKKGVI-SSHALGATFGEIGQFQFLPVNVVKYAID 212
           LATL Y D +R+K+   Q   AL +++ G I  SH +G+  G +GQ QF+P +   YA+D
Sbjct: 164 LATLGYGDPKRSKYARTQLVAALKILQTGDIDESHLMGSWAGAMGQTQFIPTSYQHYAVD 223

Query: 213 ADEDGKIDLVKSNIDAIASAAKFLAKLGWT--KCAGYQ 248
            D +GK D+  S  DA+A++A  L K GW   K  GY+
Sbjct: 224 MDGNGKRDIWNSIPDALATSANLLKKNGWQAGKTWGYE 261


>gi|78047996|ref|YP_364171.1| lytic murein transglycosylase precursor [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|38564795|gb|AAR23828.1| putative murein transglycosylase precursor [Xanthomonas
           euvesicatoria]
 gi|78036426|emb|CAJ24117.1| Lytic murein transglycosylase precursor [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
          Length = 425

 Score =  108 bits (270), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 71/234 (30%), Positives = 114/234 (48%), Gaps = 7/234 (2%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVS--FKDYLDGLS 99
           F +W +  R RA+  G+   T  +  A +    +    D++    P  +    DYL    
Sbjct: 53  FEQWLADFRQRALAAGIGATTLDNALAGVTPDPSVHELDQRQ---PEFTQYLWDYLSARV 109

Query: 100 SSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLA 159
           +   I +G  L      L   L++ YGV PGIL A+W +E+ +G+ +G   ++ +LATLA
Sbjct: 110 TPSAIQEGQQLLIRQHALFEKLRQHYGVDPGILTAIWSMESGYGKQIGDFYVIRSLATLA 169

Query: 160 YDCRRAKFFTEQFFYALDLVK--KGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDG 217
           ++ RR  +   Q   AL +++  K +  S  +G+  G +GQ QF+P     YA+D D D 
Sbjct: 170 HEGRRTTYGNTQLLAALQILQTEKSIDRSQLVGSWAGAMGQTQFIPSTYRDYAVDEDGDQ 229

Query: 218 KIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIA 271
           K D+  S  DA+ SAA +L +  WT    +    +  A   +  A L   KT+A
Sbjct: 230 KRDVWNSKADALGSAANYLKQNNWTSAVPWGQEVQLSAGFDYAQADLTIKKTVA 283


>gi|152989315|ref|YP_001349562.1| transglycolase [Pseudomonas aeruginosa PA7]
 gi|150964473|gb|ABR86498.1| probable transglycolase [Pseudomonas aeruginosa PA7]
          Length = 398

 Score =  108 bits (269), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 73/216 (33%), Positives = 106/216 (49%), Gaps = 26/216 (12%)

Query: 27  KKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTS 86
           KKA  Q I +D+  RF                       L ADL  L+   A+     T+
Sbjct: 34  KKAQAQGISADSYARF--------------------TSGLQADLSVLELLDAQPE--FTT 71

Query: 87  PPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETM 146
           P     DYL GL   + ++ G A+   + +LL  +   YGV    ++A+WG+E+ +G   
Sbjct: 72  P---LWDYLAGLVDEQRVSDGKAMLAQHDKLLDQVVARYGVDKYTVVAVWGVESDYGRIF 128

Query: 147 GKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVN 205
           GK PLL++L+TL+   RR  FF  +F   L L++ G I    + G+  G  G  QF+P  
Sbjct: 129 GKRPLLTSLSTLSCYGRRQSFFQGEFLATLKLLQAGDIRDAGITGSWAGAFGHTQFMPST 188

Query: 206 VVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
             + A+D D DG+ DLV S  DA+ S A +L K GW
Sbjct: 189 YARIAVDFDGDGRRDLVGSVPDALGSTANYLKKAGW 224


>gi|116253070|ref|YP_768908.1| lytic transglycosylase [Rhizobium leguminosarum bv. viciae 3841]
 gi|115257718|emb|CAK08816.1| putative lytic transglycosylase [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 405

 Score =  108 bits (269), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 50/123 (40%), Positives = 77/123 (62%), Gaps = 1/123 (0%)

Query: 122 KKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKK 181
           ++E+GVPPG++ A W +ET FG   G     + L TL++DCRR + F  Q    +++V+ 
Sbjct: 120 EQEFGVPPGVITAFWAMETDFGAVQGDFNTRNALVTLSHDCRRPELFRPQLIALIEMVQH 179

Query: 182 GVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLG 240
           G +  +   GA  GEIGQ Q LP +++ Y +D D DG + L +S+ DAI +AAKF+  LG
Sbjct: 180 GDLDPATNTGAWAGEIGQVQMLPRDIIAYGMDGDGDGHVRLKQSSPDAILTAAKFIQHLG 239

Query: 241 WTK 243
           + +
Sbjct: 240 FER 242


>gi|90418212|ref|ZP_01226124.1| lytic murein transglycosylase [Aurantimonas manganoxydans SI85-9A1]
 gi|90337884|gb|EAS51535.1| lytic murein transglycosylase [Aurantimonas manganoxydans SI85-9A1]
          Length = 395

 Score =  108 bits (269), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 63/201 (31%), Positives = 102/201 (50%), Gaps = 2/201 (0%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           FG +    RA A  +G+S        AD+      +A DR         ++ +   + + 
Sbjct: 30  FGAFLQGVRAEAQAKGLSAGAVGAAVADMRQDPKVLAADRAQGVFA-QDWQQFATRMVNG 88

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             + QG    +  + +L  ++ E GVP  ++ A WGLET +G  +G    L+ LATLA+D
Sbjct: 89  YRLQQGKENLQKYASVLSRIEAETGVPGPVIAAFWGLETDYGAVLGNFDTLAALATLAHD 148

Query: 162 CRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
           CRR + F      A+++V +G ++ S   GA  GEIGQ Q LP   +++  D D +G+ID
Sbjct: 149 CRRPELFRPHLLAAIEIVDRGYLTPSEMKGAWAGEIGQTQLLPEEYLEFGTDGDGNGRID 208

Query: 221 LVKSNIDAIASAAKFLAKLGW 241
           L +   D + +  K++  LGW
Sbjct: 209 LRQDAADVLFTTGKYIQSLGW 229


>gi|37679243|ref|NP_933852.1| membrane-bound lytic murein transglycosylase B [Vibrio vulnificus
           YJ016]
 gi|320157013|ref|YP_004189392.1| membrane-bound lytic murein transglycosylase B [Vibrio vulnificus
           MO6-24/O]
 gi|326423660|ref|NP_759141.2| membrane-bound lytic murein transglycosylase B [Vibrio vulnificus
           CMCP6]
 gi|37197986|dbj|BAC93823.1| membrane-bound lytic murein transglycosylase B [Vibrio vulnificus
           YJ016]
 gi|319932325|gb|ADV87189.1| membrane-bound lytic murein transglycosylase B [Vibrio vulnificus
           MO6-24/O]
 gi|319999012|gb|AAO08668.2| Membrane-bound lytic murein transglycosylase B [Vibrio vulnificus
           CMCP6]
          Length = 323

 Score =  108 bits (269), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 63/212 (29%), Positives = 107/212 (50%), Gaps = 5/212 (2%)

Query: 34  ICSD---TADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVS 90
           +CS      + F ++    +A+A  EG+S +T +  F D+++    +  DR        +
Sbjct: 13  LCSSAWANTESFEQYLERLKAQAAEEGISAQTIEQAFRDVQFKPRAVKADRNQ-PEKKQT 71

Query: 91  FKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTP 150
             +YL        + Q   L   +   L  +   YGV    ++ALWG+E++FG+  G  P
Sbjct: 72  LDEYLPRAVPDWKVKQAKDLYAKHYAELSQIADRYGVQARFIVALWGVESNFGKFTGNFP 131

Query: 151 LLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKY 209
           ++  L+T+AY+ RR  FF  +   AL ++ +G I      G+  G +GQ QF+P + + Y
Sbjct: 132 VVDALSTMAYEGRREAFFRAETMAALKILDQGHIEFENFKGSWAGAMGQCQFMPSSFLAY 191

Query: 210 AIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
           A D + DGK D+  +  D  AS A +L++ GW
Sbjct: 192 AADGNGDGKKDIWNTKADVFASTASYLSQSGW 223


>gi|269103051|ref|ZP_06155748.1| membrane-bound lytic murein transglycosylase B [Photobacterium
           damselae subsp. damselae CIP 102761]
 gi|268162949|gb|EEZ41445.1| membrane-bound lytic murein transglycosylase B [Photobacterium
           damselae subsp. damselae CIP 102761]
          Length = 323

 Score =  108 bits (269), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 62/202 (30%), Positives = 104/202 (51%), Gaps = 2/202 (0%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F ++    +A A  +G+S +     F  +E+    +  D+       ++   Y+      
Sbjct: 27  FDKYVEGLKAEAREKGISEQIINEAFTGIEFKHRAVKADKNQ-PEKKLTLDQYIPRAVPQ 85

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             + Q   L + +   L  + K++GV P  ++ALWG+E++FG+  GK  ++  LAT+AY+
Sbjct: 86  WKVKQANRLYREHYTDLQRIGKQFGVQPRFIVALWGVESNFGKFTGKYNVVEALATMAYE 145

Query: 162 CRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR  FF  Q   AL ++ +G I  S   G+  G +GQ QF+P + + +A D + DGK D
Sbjct: 146 GRREAFFRGQVMDALQILNEGHIKPSEMKGSWAGAMGQPQFMPSSYLTFAADGNNDGKSD 205

Query: 221 LVKSNIDAIASAAKFLAKLGWT 242
           +  +  D  ASAA +L K GW 
Sbjct: 206 IWNTTEDVFASAANYLHKSGWN 227


>gi|312963230|ref|ZP_07777714.1| lytic murein transglycosylase [Pseudomonas fluorescens WH6]
 gi|311282496|gb|EFQ61093.1| lytic murein transglycosylase [Pseudomonas fluorescens WH6]
          Length = 441

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 70/204 (34%), Positives = 112/204 (54%), Gaps = 4/204 (1%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVT-SPPVSFKDYLDGLSS 100
           F EW++  R  A++ G++     + FA++      I  DR     S PV   +YLDG  S
Sbjct: 68  FAEWQAGFRVDALKAGITAAVFDNAFANVTPDMAVIRADRSQPEFSRPV--WEYLDGALS 125

Query: 101 SEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAY 160
              +  G AL    + +L ++++ YGV    L+++WG+E++FG+  G   ++ +LATLAY
Sbjct: 126 PVRVRNGQALLIKYADILQSIEQRYGVDRQALVSVWGMESNFGQFQGNNSVIRSLATLAY 185

Query: 161 DCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKI 219
           + RR  F   Q   AL +++ G I +  + G+  G +GQ QF+P     +A+D D DG+ 
Sbjct: 186 EGRRPAFAQAQLLAALQIIQHGDIQADQMKGSWAGAMGQTQFIPTTYNTHAVDFDGDGRR 245

Query: 220 DLVKSNIDAIASAAKFLAKLGWTK 243
           D+  S  DA+AS A +L   GW K
Sbjct: 246 DIWNSPADALASTAHYLQSSGWQK 269


>gi|254440054|ref|ZP_05053548.1| lytic murein transglycosylase subfamily [Octadecabacter antarcticus
           307]
 gi|198255500|gb|EDY79814.1| lytic murein transglycosylase subfamily [Octadecabacter antarcticus
           307]
          Length = 392

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 57/152 (37%), Positives = 81/152 (53%), Gaps = 1/152 (0%)

Query: 91  FKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTP 150
           F D+   L S+  I  G A  +    +   ++ EYG+P G+L+A W  ET FG   G   
Sbjct: 78  FIDFSRRLISNNRIENGRAQAQRQDAIFDRIEAEYGIPRGVLLAFWAFETDFGAVQGDFN 137

Query: 151 LLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKY 209
             + L TLA+DCRR + F  Q F A++L  +G +  +   GA  GEIG  Q LP ++++ 
Sbjct: 138 TRNALVTLAHDCRRPELFRPQVFAAMELFARGDLDPATTKGAWAGEIGMVQMLPRDIIEN 197

Query: 210 AIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
             D D DG + L  S  DA+ S A  L+ LGW
Sbjct: 198 GRDGDGDGHVSLKTSAPDALLSGASVLSSLGW 229


>gi|56698311|ref|YP_168684.1| peptidoglycan binding domain-containing protein [Ruegeria pomeroyi
           DSS-3]
 gi|56680048|gb|AAV96714.1| peptidoglycan binding domain protein [Ruegeria pomeroyi DSS-3]
          Length = 423

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 75/232 (32%), Positives = 113/232 (48%), Gaps = 8/232 (3%)

Query: 15  VYPMLAQA---VTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLE 71
           + P +AQ+   V +P   T   +  D   +F  W    RARA+  G++P T       L 
Sbjct: 24  LIPAVAQSLRPVLRPDLLTP--VSQDIEAQFQTWLIEFRARALTLGITPATLNAALPGLS 81

Query: 72  YLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGI 131
           Y    + RDR         + DYLD   S   IA G      +  LL  ++  +GV   +
Sbjct: 82  YDAEVVRRDRNQAEFTKTIW-DYLDTAVSEARIANGRKAVARHRDLLARIEARWGVDRHV 140

Query: 132 LMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-G 190
           + A+WGLE+ +G   G    L +LA+LA+D RRA+FF  Q   AL ++  G      L G
Sbjct: 141 VAAIWGLESAYGAVRGGDSTLRSLASLAFDTRRAEFFEGQLIAALRILDSGDARLRDLRG 200

Query: 191 ATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSN-IDAIASAAKFLAKLGW 241
           +  G +G  QF+P +  ++A+D   DG+ D+   +  DA+AS A +L   GW
Sbjct: 201 SWAGAMGHTQFMPTSYQEHAVDFTGDGRRDIWSDDPSDALASTAAYLKANGW 252


>gi|257455960|ref|ZP_05621177.1| lytic murein transglycosylase [Enhydrobacter aerosaccus SK60]
 gi|257446706|gb|EEV21732.1| lytic murein transglycosylase [Enhydrobacter aerosaccus SK60]
          Length = 460

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 61/160 (38%), Positives = 90/160 (56%), Gaps = 7/160 (4%)

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
           DYL GL   E +  GI  K      L  +++ YGV    ++ +WG+E++FG+ +GK  L+
Sbjct: 81  DYLSGLVDEERVQDGINAKNQLQSTLSRIEQRYGVKGTDVLGVWGVESNFGKQLGKKDLI 140

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAI 211
            +LATL+   RR  +F  ++  AL +++ G I    + G+  G  GQ QF+P   ++ A 
Sbjct: 141 QSLATLSCFDRRQSYFRTEYANALRILQNGDIRRDDMTGSWAGAFGQTQFMPSTFLRLAQ 200

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGE 251
           D D DG+ DLV S  DA+AS A FL K      AGY+ GE
Sbjct: 201 DFDGDGRKDLVNSQADALASTANFLDK------AGYRTGE 234


>gi|119470943|ref|ZP_01613527.1| putative periplasmic lytic murein transglycosylase [Alteromonadales
           bacterium TW-7]
 gi|119445965|gb|EAW27245.1| putative periplasmic lytic murein transglycosylase [Alteromonadales
           bacterium TW-7]
          Length = 338

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 66/212 (31%), Positives = 106/212 (50%), Gaps = 6/212 (2%)

Query: 34  ICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPV--SF 91
           + + T   F ++    +  A+ +G         FA   Y +  ++ D+     P V  + 
Sbjct: 18  VVAKTQAEFKDYLVNLKEEAIAKGYETSLIDSAFATATYKEKVVSADK---NQPEVKETL 74

Query: 92  KDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPL 151
           + YL        I +   L   N  +L  + KE+GV    ++ALWGLE++FG   G   +
Sbjct: 75  ETYLPKRVPQWKIDRARKLYAENKDILEQVAKEFGVQARFIVALWGLESNFGTIQGGHNV 134

Query: 152 LSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYA 210
           +S+L TLA+D RR   +  Q + ALD++K G I+     G+  G +GQ QF+P +   YA
Sbjct: 135 ISSLVTLAFDGRREALYKRQLWAALDILKSGHITLDKFKGSWAGAMGQTQFMPTSFNAYA 194

Query: 211 IDADEDGKIDLVKSNIDAIASAAKFLAKLGWT 242
           ID + DG+ D+  +  DA AS A +L + GW 
Sbjct: 195 IDYNNDGRKDIWTTKEDAFASIANYLKQEGWN 226


>gi|99082426|ref|YP_614580.1| lytic murein transglycosylase [Ruegeria sp. TM1040]
 gi|99038706|gb|ABF65318.1| Lytic murein transglycosylase [Ruegeria sp. TM1040]
          Length = 398

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 64/191 (33%), Positives = 96/191 (50%), Gaps = 4/191 (2%)

Query: 53  AVREGMSPKTAKHLFADLEYLDTTIARDRKM-VTSPPVSFKDYLDGLSSSEIIAQGIALK 111
           AV  G +  T    F  +      +  DR   V   P  F ++   L S + + +G    
Sbjct: 45  AVSAGYAINTVNEFFNGVSQDQKVLRADRSQGVFQKP--FIEFSRRLISQDRLNRGRRKG 102

Query: 112 KANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQ 171
           +   ++   ++  YG+  G+L+A W  ET +G   G     + L TLA+DCRR + F  Q
Sbjct: 103 EEFDKIFERIETTYGINRGVLLAFWAFETDYGAFQGDFNTRNALVTLAHDCRRPELFRPQ 162

Query: 172 FFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIA 230
            F AL+L +KG        GA  GEIG  Q LP +++++ +DAD DG + L  S  DA+ 
Sbjct: 163 IFSALELYRKGDFDPERTTGAWAGEIGMVQMLPGDILEHGVDADGDGHVTLKTSAADALM 222

Query: 231 SAAKFLAKLGW 241
           SAA+ L+ LGW
Sbjct: 223 SAARMLSHLGW 233


>gi|146328673|ref|YP_001209973.1| lytic murein transglycosylase family protein [Dichelobacter nodosus
           VCS1703A]
 gi|146232143|gb|ABQ13121.1| lytic murein transglycosylase family protein [Dichelobacter nodosus
           VCS1703A]
          Length = 416

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 70/209 (33%), Positives = 115/209 (55%), Gaps = 5/209 (2%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F  WK+    RA   G++    + L   +E    TI+RDR+      + + +Y+D   + 
Sbjct: 51  FTAWKTDFIERAKAAGIAATDVERLILPVELHQKTISRDRQQAEFMKMPW-EYIDNAVAQ 109

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
           E I QG    + ++  L  L+K+YGVP  I+ A+WGLE+ +G+  G++ L  +LATLAY+
Sbjct: 110 ERIRQGQQNFQRHTDFLRTLEKQYGVPAEIITAIWGLESSYGKNTGQSDLAQSLATLAYE 169

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR +F  +Q    L L+ +G +    L G+  G +G+ QF+P   ++  ID D DG+ +
Sbjct: 170 GRRREFAEQQLLALLQLLARGDVQWTQLRGSWAGGMGETQFIPSTWLEQGIDGDRDGQRN 229

Query: 221 LVKSNIDAIASAAKFLAKLGWTKCAGYQP 249
              +  DA+AS A +L + GW   +G +P
Sbjct: 230 PW-ATADALASTAHYLNRSGWQ--SGIKP 255


>gi|241205579|ref|YP_002976675.1| lytic murein transglycosylase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240859469|gb|ACS57136.1| lytic murein transglycosylase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 405

 Score =  107 bits (266), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 50/123 (40%), Positives = 76/123 (61%), Gaps = 1/123 (0%)

Query: 122 KKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKK 181
           ++++GVPPG++ A W +ET FG   G     + L TL++DCRR + F  Q    +++V+ 
Sbjct: 120 EQDFGVPPGVITAFWAMETDFGAVQGDFNTRNALVTLSHDCRRPELFRPQLIALIEMVQH 179

Query: 182 GVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLG 240
           G +  +   GA  GEIGQ Q LP +++ Y +D D DG I L +S  DAI +AAKF+  LG
Sbjct: 180 GDLDPATNTGAWAGEIGQVQMLPRDIIAYGMDGDGDGHIRLKQSGPDAILTAAKFIQHLG 239

Query: 241 WTK 243
           + +
Sbjct: 240 FER 242


>gi|304320863|ref|YP_003854506.1| hypothetical protein PB2503_06492 [Parvularcula bermudensis
           HTCC2503]
 gi|303299765|gb|ADM09364.1| hypothetical protein PB2503_06492 [Parvularcula bermudensis
           HTCC2503]
          Length = 403

 Score =  107 bits (266), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 68/206 (33%), Positives = 103/206 (50%), Gaps = 4/206 (1%)

Query: 38  TADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVT-SPPVSFKDYLD 96
           + + F +++S  R  A+ +G+ P            L   + R+      S P+    YLD
Sbjct: 26  STENFDDFRSEFRQEAIGQGIDPAVYDREMRAATPLAVVLERNSNQPEFSRPIWA--YLD 83

Query: 97  GLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLA 156
              S   IA GIA  +  +  L  ++ EYGV   I+ A+WGLE+ +G  +G   ++S  A
Sbjct: 84  SAVSDTRIANGIAATQRQAAQLDAIEAEYGVDKEIIGAIWGLESSYGAILGDYDIISATA 143

Query: 157 TLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADE 215
           TLAY  RR  +   Q   AL +++ G      L G+  G +GQ QF+P   + YA+D D 
Sbjct: 144 TLAYQGRRQSYGRSQLIGALKILQNGYADRSQLKGSWAGAMGQTQFIPTTYLSYAVDEDG 203

Query: 216 DGKIDLVKSNIDAIASAAKFLAKLGW 241
           DGK DL  S  D  AS A +L++ G+
Sbjct: 204 DGKRDLWGSYGDVFASTANYLSRSGY 229


>gi|296444538|ref|ZP_06886502.1| lytic murein transglycosylase [Methylosinus trichosporium OB3b]
 gi|296257806|gb|EFH04869.1| lytic murein transglycosylase [Methylosinus trichosporium OB3b]
          Length = 392

 Score =  107 bits (266), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 71/240 (29%), Positives = 119/240 (49%), Gaps = 19/240 (7%)

Query: 57  GMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSR 116
           G+S +T +   A LE  D     D++     P+   DYL GL   E + +G AL + +  
Sbjct: 40  GVSARTIESATAGLEPNDAPSFMDKQPEFKTPI--WDYLAGLVDDERVEEGRALMRQHGA 97

Query: 117 LLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAK-FFTEQFFYA 175
            L   ++ YGV P  ++A+WG+E+ FG+  GK  ++ +LATLA + RR   +F  +   A
Sbjct: 98  ALQAAEQRYGVDPATVVAVWGVESDFGKNFGKRSVVQSLATLACEARRRNDYFRGELIAA 157

Query: 176 LDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAK 234
           L ++  G I+     G+  G  G  QF+P   ++ A+D D DG+ ++  S  D++ S A 
Sbjct: 158 LKILDSGDIAPQEFYGSWAGAFGHTQFMPSTFLRTAVDLDGDGRRNIASSAADSLGSTAN 217

Query: 235 FLAKLGWTKCAGYQPGEK---------NFAILKHWNASLNYNKTIAYIAAHIDGVPIGKG 285
           +L K      +GY+PG +         N++      A    +   +   + +DG P+G G
Sbjct: 218 YLHK------SGYRPGLRWGFEVRLPDNYSGPSGRTARQPMSAWASRGVSRLDGEPLGDG 271


>gi|77920031|ref|YP_357846.1| membrane-bound lytic murein transglycosylase B [Pelobacter
           carbinolicus DSM 2380]
 gi|77546114|gb|ABA89676.1| membrane-bound lytic murein transglycosylase B [Pelobacter
           carbinolicus DSM 2380]
          Length = 363

 Score =  107 bits (266), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 65/238 (27%), Positives = 116/238 (48%), Gaps = 8/238 (3%)

Query: 17  PMLAQAVTQPKKA------TTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADL 70
           P + + + +PK A        Q     ++  F  W +  +  A+++G+ P+  +    + 
Sbjct: 31  PRIVETIPEPKSAAPADPDNRQNSAEQSSADFQTWLAELKTEALQQGIRPEVVQEAL-EG 89

Query: 71  EYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPG 130
           +     + + R       +S  +Y+  L+S     +G+     +  LL  + + YGVP  
Sbjct: 90  QQPAPAVLKPRHKQAEFVLSKSEYVRRLASETRFREGLRQMAQHRVLLRKVAETYGVPES 149

Query: 131 ILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL- 189
            L+ALW +E+ FG+   +  ++  L T A+  +R  FF +Q   AL ++ +  + S AL 
Sbjct: 150 YLLALWAIESDFGKGGSRHSVIGALVTQAWQSQRRNFFRKQLLAALTILDQEHMPSSALR 209

Query: 190 GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGY 247
           G+  G +G FQF+P     YA+D D DG  ++     DA+ASAA +L + GW K  G+
Sbjct: 210 GSWAGAMGHFQFIPTTYRDYAVDFDGDGHRNIWTDVGDALASAASYLVRAGWKKDRGW 267


>gi|114562914|ref|YP_750427.1| membrane-bound lytic murein transglycosylase [Shewanella
           frigidimarina NCIMB 400]
 gi|114334207|gb|ABI71589.1| membrane-bound lytic murein transglycosylase [Shewanella
           frigidimarina NCIMB 400]
          Length = 322

 Score =  107 bits (266), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 63/216 (29%), Positives = 110/216 (50%), Gaps = 10/216 (4%)

Query: 33  FICS------DTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTS 86
           F CS      D+   F ++    + +A+  G++  TA+   A+++             + 
Sbjct: 13  FFCSNIAMAEDSRGEFTDYLLELQQKAIATGVNQLTAERYIANIKIFKKASLNTH---SD 69

Query: 87  PPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETM 146
              + +D++  +     ++   A+ + +   + NL + Y V P  LMALWG+ + FGE  
Sbjct: 70  ESQTLEDFIPQVVPEITVSTARAMFQQHESQIQNLSRAYQVQPRFLMALWGMNSRFGERT 129

Query: 147 GKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVN 205
           G+   LS LA+LAY   +  F+  +F  AL L+++  I+   L  ++ G +GQ Q +P  
Sbjct: 130 GRFSGLSVLASLAYKGDKEAFYINEFIAALKLIEQKSITEDLLRSSSSGAMGQMQMMPSQ 189

Query: 206 VVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
           +++Y IDAD+DG I++  S  DA AS A  L + GW
Sbjct: 190 ILQYGIDADKDGIINVWDSMDDAFASTANMLHRQGW 225


>gi|254454734|ref|ZP_05068171.1| lytic murein transglycosylase [Octadecabacter antarcticus 238]
 gi|198269140|gb|EDY93410.1| lytic murein transglycosylase [Octadecabacter antarcticus 238]
          Length = 384

 Score =  107 bits (266), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 72/235 (30%), Positives = 105/235 (44%), Gaps = 17/235 (7%)

Query: 8   LISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLF 67
           LI+  + V P+ AQ             C  T   F  +       A   G+   TA+   
Sbjct: 3   LIATPVFVTPLAAQ------------TCGGT---FSAFLGGVVDEATTNGIDRATAEGFL 47

Query: 68  ADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGV 127
           A  +     +  DR         F D+   L S+  I  G A  +    +   ++ E+G+
Sbjct: 48  AGAQQDQAVLTADRSQGFFQ-RDFIDFSQRLISNNRIENGRAQAQRQDAIFDRIESEFGI 106

Query: 128 PPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVIS-S 186
           P G+L+A W  ET FG   G     + L TLA+DCRR + F  Q F A++L  +G  + +
Sbjct: 107 PRGVLLAFWAFETDFGAVQGDFNTRNALLTLAHDCRRPELFRPQIFAAMELFARGDFNPA 166

Query: 187 HALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
              GA  GEIG  Q LP ++++   D D DG + L  S  DA+ S A  L+ LGW
Sbjct: 167 TTTGAWAGEIGMVQMLPGDIIENGRDGDGDGHVTLKTSAPDALLSGASVLSSLGW 221


>gi|89055359|ref|YP_510810.1| lytic murein transglycosylase [Jannaschia sp. CCS1]
 gi|88864908|gb|ABD55785.1| Lytic murein transglycosylase [Jannaschia sp. CCS1]
          Length = 425

 Score =  107 bits (266), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 60/199 (30%), Positives = 102/199 (51%), Gaps = 3/199 (1%)

Query: 45  WKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEII 104
           W    R RA   G+S          + YL   + RDR   T    S +DYL  ++  + +
Sbjct: 61  WLDGFRDRAQAAGISEDALTRGLRGVGYLPGVVERDRNQ-TEFRRSTEDYLALVAGDDDV 119

Query: 105 AQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRR 164
           + G +   A   +L +++  YGVP  +  A+WG+E+ +G  +G  P++S ++TLA++ RR
Sbjct: 120 SLGRSRFNAQRSVLADVEARYGVPAEVCCAVWGVESRYGTRLGDIPVISAVSTLAWEGRR 179

Query: 165 AKFFTEQFFYALDLVKKG-VISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVK 223
             FF  Q   AL +++ G   +   LG+  G +G  Q +P    +YA+D   DG+ D+  
Sbjct: 180 GDFFEAQTIAALRIIQNGDTTTDRMLGSWAGAMGHTQLIPTTYEEYAVDFRGDGRRDIWT 239

Query: 224 SN-IDAIASAAKFLAKLGW 241
           ++  DA AS A + ++  W
Sbjct: 240 NDPTDAFASTASYFSRFNW 258


>gi|77362418|ref|YP_341992.1| putative periplasmic lytic murein transglycosylase
           [Pseudoalteromonas haloplanktis TAC125]
 gi|76877329|emb|CAI89546.1| putative periplasmic lytic murein transglycosylase
           [Pseudoalteromonas haloplanktis TAC125]
          Length = 338

 Score =  107 bits (266), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 64/212 (30%), Positives = 108/212 (50%), Gaps = 6/212 (2%)

Query: 34  ICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPV--SF 91
           + + T   F  +  A +  A+ +G   +     FA   Y +  ++ D+     P V  + 
Sbjct: 18  VMAKTQAEFQTYLDALKQEAIAKGYDSQLIDQAFAGASYKEKIVSADK---NQPEVKETL 74

Query: 92  KDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPL 151
           + YL        I +   L   N  +L  + K++GV    ++A+WGLE++FG   G   +
Sbjct: 75  ETYLPKRVPQWKIDRARKLYAENQDVLEKVAKDFGVQARFIVAIWGLESNFGAIQGGHNV 134

Query: 152 LSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYA 210
           +S+L TLA+D RR   + +Q + ALD++K G I+     G+  G +GQ QF+P +   YA
Sbjct: 135 ISSLVTLAFDGRRETMYKKQLWAALDILKSGHITLDKFKGSWAGAMGQTQFMPTSFNAYA 194

Query: 211 IDADEDGKIDLVKSNIDAIASAAKFLAKLGWT 242
           +D + DG+ D+  +  DA AS A +L + GW 
Sbjct: 195 VDYNNDGRKDIWTTKEDAFASIANYLKQEGWN 226


>gi|148653769|ref|YP_001280862.1| lytic murein transglycosylase [Psychrobacter sp. PRwf-1]
 gi|148572853|gb|ABQ94912.1| lytic murein transglycosylase [Psychrobacter sp. PRwf-1]
          Length = 486

 Score =  106 bits (265), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 60/160 (37%), Positives = 93/160 (58%), Gaps = 7/160 (4%)

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
           DYL  L   E +  GIA  +  + +L  ++ +YGV    ++ +WG+E+ FG T+GK  ++
Sbjct: 91  DYLASLVDEERVIDGIAASERYADVLARIEAQYGVNRYDVLGVWGVESDFGTTLGKKEVV 150

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAI 211
            +LATL+   RR  +F  ++  AL ++K+G I+ +   G+  G  GQ QF+P   ++ A 
Sbjct: 151 QSLATLSCFGRRQSYFRSEYVSALKILKQGDIAPNDFKGSWAGAFGQTQFMPSTFLQLAQ 210

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGE 251
           D D DG+ DLV S  DA+AS A FL      K +GYQ G+
Sbjct: 211 DFDGDGRKDLVNSQADALASTANFL------KNSGYQSGQ 244


>gi|294083923|ref|YP_003550680.1| membrane-bound lytic murein transglycosylase B [Candidatus
           Puniceispirillum marinum IMCC1322]
 gi|292663495|gb|ADE38596.1| Membrane-bound lytic murein transglycosylase B [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 327

 Score =  106 bits (265), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 71/233 (30%), Positives = 117/233 (50%), Gaps = 23/233 (9%)

Query: 12  LMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLE 71
           L+ V+P  AQ+ +                 F +W +  R  A   G+S K       D +
Sbjct: 14  LLFVHPAFAQSQS-----------------FEQWLAEFRIDAKARGISDKIFDEALGDAK 56

Query: 72  YLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKK--ANSRLLINLKKEYGVPP 129
            +   I  DR       ++F +YL  + S     Q IA KK   +  +L  + K+YGV  
Sbjct: 57  PIPRVIELDRNQ-PEFKMTFDEYLGKVVSKA--RQRIAAKKMIEHDDILTKVSKKYGVQK 113

Query: 130 GILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL 189
             ++  WG+ET FG  +G   +  +LATLAYD RR+ +F ++   AL ++++G I++  +
Sbjct: 114 RFIITFWGVETSFGRYLGSFNVPHSLATLAYDGRRSAYFRKELLNALQILEEGHITAANM 173

Query: 190 -GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
            G+  G +GQ QF+P + + YA+D   DG+ D+  +  D  AS A +L++ GW
Sbjct: 174 KGSWAGAMGQSQFMPSSFLSYAVDWHGDGQRDIWATTEDVFASTAYYLSQAGW 226


>gi|126733814|ref|ZP_01749561.1| hypothetical protein RCCS2_06644 [Roseobacter sp. CCS2]
 gi|126716680|gb|EBA13544.1| hypothetical protein RCCS2_06644 [Roseobacter sp. CCS2]
          Length = 388

 Score =  106 bits (265), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 64/203 (31%), Positives = 98/203 (48%), Gaps = 8/203 (3%)

Query: 43  GEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLD---GLS 99
           G +    +A A  EG+  +T    F       + I  DR       V  +D++     L 
Sbjct: 25  GAFIDGVKAEARAEGIPAQTIDAFFQGARIEQSVINADRAQ----GVFQRDFISFSRALI 80

Query: 100 SSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLA 159
           S   I  G    +        ++  +G+P G+L+A W  ET +G+  G     + L TLA
Sbjct: 81  SQNRIDNGRVYGQRFDSTFDTIEARFGIPRGVLLAFWAFETDYGQVQGSFNTRNALLTLA 140

Query: 160 YDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGK 218
           +DCRR   F  Q   A++L ++G ++ +   GA  GEIGQ Q LP  +V+  +D D DG 
Sbjct: 141 HDCRRPDLFRPQLIAAIELYRRGGMNPATTTGAWAGEIGQLQKLPREIVRQGMDGDGDGV 200

Query: 219 IDLVKSNIDAIASAAKFLAKLGW 241
           +DL  S+ DA+ + A  L+ LGW
Sbjct: 201 VDLKGSSPDALMTGANVLSSLGW 223


>gi|86358472|ref|YP_470364.1| membrane-bound lytic murein transglycosylase protein [Rhizobium
           etli CFN 42]
 gi|86282574|gb|ABC91637.1| probable membrane-bound lytic murein transglycosylase protein
           [Rhizobium etli CFN 42]
          Length = 406

 Score =  106 bits (265), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 50/123 (40%), Positives = 76/123 (61%), Gaps = 1/123 (0%)

Query: 122 KKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKK 181
           ++E+GVPPG++ A W +ET FG   G     + L TL++DCRR + F  Q    +++V+ 
Sbjct: 121 EQEFGVPPGVITAFWAMETDFGAVQGDFNTRNALVTLSHDCRRPELFRPQLIALIEMVEH 180

Query: 182 GVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLG 240
           G +  +   GA  GEIGQ Q LP +++ + +D D DG I L +S  DAI +AAKF+  LG
Sbjct: 181 GDLDPATNTGAWAGEIGQVQMLPRDIIAFGMDGDGDGHIRLKQSGPDAILTAAKFIQHLG 240

Query: 241 WTK 243
           + +
Sbjct: 241 FER 243


>gi|261868371|ref|YP_003256293.1| lytic transglycosylase [Aggregatibacter actinomycetemcomitans
           D11S-1]
 gi|261413703|gb|ACX83074.1| lytic transglycosylase [Aggregatibacter actinomycetemcomitans
           D11S-1]
          Length = 376

 Score =  106 bits (265), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 71/245 (28%), Positives = 120/245 (48%), Gaps = 21/245 (8%)

Query: 20  AQAVTQPKKA---------TTQFICSDTADRFGEWKSAARARAVREGMS------PKTAK 64
           + A TQP +          T  +  S T D F ++ +  + +A  EG+S           
Sbjct: 26  SSAPTQPSEPVNSVTAVNPTAVYSKSRTLDNFNDYVNFLKGKAAAEGVSADVLNAQNNIN 85

Query: 65  HLFADLEYLDTTIARDRKM-VTSPPV----SFKDYLDGLSSSEIIAQGIALKKANSRLLI 119
           ++   ++  D    R RK    +PP+       +YL+ + +   +    A        L 
Sbjct: 86  YIQKSVDLDDQQAGRIRKRDPNAPPIINPNGTTNYLNRVLTKNKVDTAEARYWEQLPQLE 145

Query: 120 NLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLV 179
           N  K++ VP   L+ALWG+E+ FG   G   +LSTLATLA+D RR   F+++F  A+ ++
Sbjct: 146 NASKKFSVPKNYLLALWGMESSFGYYQGNYDVLSTLATLAFDGRRESLFSKEFIAAMKIL 205

Query: 180 KKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAK 238
           ++  I  +  LG+  G +GQ QF+P + + YA D + DG+ ++   + D  AS A +L  
Sbjct: 206 QRDHIQRYKMLGSWAGAMGQTQFMPSSYLSYAADGNNDGEKNIWTDHYDVFASIANYLHT 265

Query: 239 LGWTK 243
           +GW +
Sbjct: 266 VGWNE 270


>gi|325919729|ref|ZP_08181729.1| lytic murein transglycosylase [Xanthomonas gardneri ATCC 19865]
 gi|325549787|gb|EGD20641.1| lytic murein transglycosylase [Xanthomonas gardneri ATCC 19865]
          Length = 367

 Score =  106 bits (265), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 88/152 (57%), Gaps = 1/152 (0%)

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
           DYL  L  S+ +  G A+   +  LL  L ++ GV P  ++A+WG+E+ +    GK PLL
Sbjct: 75  DYLASLVDSQRVTDGQAMLVTHRALLTRLSEQTGVDPATIVAVWGVESDYSRVTGKRPLL 134

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAI 211
            +LATL+   RR  FF  +F   L L+++G +S   L G+  G  GQ QF+P    + A+
Sbjct: 135 VSLATLSCAGRRQPFFRGEFLALLGLLQQGDLSPDGLTGSWAGAFGQTQFMPSTYARIAV 194

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGWTK 243
           D D DG+ DLV S  DA+AS A +L K GW +
Sbjct: 195 DGDGDGRRDLVASIPDALASTANYLVKAGWER 226


>gi|209550196|ref|YP_002282113.1| lytic murein transglycosylase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|209535952|gb|ACI55887.1| lytic murein transglycosylase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 405

 Score =  106 bits (265), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 75/123 (60%), Gaps = 1/123 (0%)

Query: 122 KKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKK 181
           ++E+GVP G++ A W +ET FG   G     + L TL++DCRR + F  Q    +++V+ 
Sbjct: 120 EQEFGVPAGVITAFWAMETDFGAVQGDFNTRNALVTLSHDCRRPELFRPQLIALIEMVQH 179

Query: 182 GVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLG 240
           G +   A  GA  GEIGQ Q LP +++ Y +D D DG I L +S  DAI +AAKF+  LG
Sbjct: 180 GDLDPAANTGAWAGEIGQVQMLPRDIIAYGMDGDGDGHIRLKQSGPDAILTAAKFIQHLG 239

Query: 241 WTK 243
           + +
Sbjct: 240 FER 242


>gi|306845309|ref|ZP_07477884.1| lytic murein transglycosylase [Brucella sp. BO1]
 gi|306274225|gb|EFM56037.1| lytic murein transglycosylase [Brucella sp. BO1]
          Length = 412

 Score =  106 bits (264), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 68/220 (30%), Positives = 113/220 (51%), Gaps = 18/220 (8%)

Query: 41  RFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTI---ARDRKMVTSPPVSFKDYLDG 97
           RF +W +  R  A++ G++P T    F  +   D  +   AR +   T P     +Y+D 
Sbjct: 39  RFRQWIANFRPVAIKSGIAPSTFDRAFRGVNEPDPVVLEKARYQPEFTEP---VWNYIDN 95

Query: 98  LSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLS---- 153
             + + +A G  + +   + L  ++  Y V   IL+A+W +E+++GE + +  ++     
Sbjct: 96  RVNEQSVAVGQNMARKWGQWLQRIEHHYSVDRHILLAIWSMESNYGEILKRDDVMRDAIR 155

Query: 154 TLATLAY-DCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAI 211
           +LATLAY D RRAK+   Q   A+ +++ G I   H  G+  G +G  QF+P +   YA+
Sbjct: 156 SLATLAYADARRAKYGRTQLIAAMKILQTGDIERGHLSGSWAGALGHTQFIPTSYQAYAV 215

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGE 251
           D D +GK D+  S  DA+ +AA  L + GW      QPG 
Sbjct: 216 DMDGNGKRDIWNSVPDALGTAANLLHRNGW------QPGR 249


>gi|296116335|ref|ZP_06834951.1| lytic murein transglycosylase [Gluconacetobacter hansenii ATCC
           23769]
 gi|295977154|gb|EFG83916.1| lytic murein transglycosylase [Gluconacetobacter hansenii ATCC
           23769]
          Length = 329

 Score =  106 bits (264), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 63/204 (30%), Positives = 99/204 (48%), Gaps = 2/204 (0%)

Query: 39  ADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGL 98
           A  +  + +  R  A+R+G+    A     DL   +  + R  +      +++  Y   +
Sbjct: 32  AQDYATFVAGVRDDAIRQGLDTGIANRAL-DLSTPNAQVLRLDRTQPEFHLTWAQYRQRV 90

Query: 99  SSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATL 158
            +   IA G         LL      Y V PG +  +WGLE+ +G  MG   ++  L TL
Sbjct: 91  ITPRKIADGRTAVAVQRALLDQALTRYNVAPGAIAGIWGLESAYGTRMGTFGVIDALCTL 150

Query: 159 AYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDG 217
           AYD RRAKFF ++   AL ++  G I+    +G+  G +GQ QF+P   ++YA+D D DG
Sbjct: 151 AYDGRRAKFFHDELMKALHILGMGDIAPEQMIGSYAGAMGQPQFMPSAYLRYAVDMDGDG 210

Query: 218 KIDLVKSNIDAIASAAKFLAKLGW 241
           + D+  S  D   S A +L+  GW
Sbjct: 211 RRDIWHSTADVFGSIASYLSHSGW 234


>gi|302858020|ref|XP_002959999.1| hypothetical protein VOLCADRAFT_101511 [Volvox carteri f.
           nagariensis]
 gi|300253615|gb|EFJ38936.1| hypothetical protein VOLCADRAFT_101511 [Volvox carteri f.
           nagariensis]
          Length = 263

 Score =  106 bits (264), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 67/203 (33%), Positives = 98/203 (48%), Gaps = 12/203 (5%)

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
           DYL  L   + +  G A  +   R L N +  +GV   ++  +WG+E+ FG   G  PL+
Sbjct: 53  DYLAALVDEQRVEDGRAAMRQWGRALANAEARFGVDRHVIAGVWGVESDFGRNFGDRPLV 112

Query: 153 STLATLA-YDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYA 210
            +L+TLA Y  RR ++FT +    L +V+ G I   +L G+  G  G  QF+P    + A
Sbjct: 113 QSLSTLACYAPRRREYFTGELMATLKIVQDGDIDPASLRGSWAGAFGHTQFMPSTFQRLA 172

Query: 211 IDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKT- 269
           +D D D + D+V S  DA+AS A FL K GW       P      + +++NA L   K  
Sbjct: 173 VDGDGDSRRDVVNSVPDAVASTANFLRKAGWDNSL---PWGYEVRLPENFNAKLAGRKAK 229

Query: 270 ------IAYIAAHIDGVPIGKGY 286
                  A     IDG P+   Y
Sbjct: 230 RPLSSWAAMGVTRIDGRPLSGNY 252


>gi|296533259|ref|ZP_06895873.1| membrane-bound lytic murein transglycosylase B [Roseomonas
           cervicalis ATCC 49957]
 gi|296266412|gb|EFH12423.1| membrane-bound lytic murein transglycosylase B [Roseomonas
           cervicalis ATCC 49957]
          Length = 313

 Score =  106 bits (264), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 90/160 (56%), Gaps = 1/160 (0%)

Query: 89  VSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGK 148
           +S++ Y D + S   I  G      N  LL  ++  Y V P +++A+WG+ET++G   G 
Sbjct: 66  LSWEQYRDRIVSQTRIQNGRRAYAENRALLQAIEARYNVSPRVIVAIWGMETNYGSNTGG 125

Query: 149 TPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVV 207
             ++  LATLA++ RRA FF  +   AL +++   I+   + G+  G +GQ QF+P +  
Sbjct: 126 FNVVDALATLAWEGRRASFFRAELMAALRILEGQHIAPERMQGSWAGAMGQPQFMPTSFE 185

Query: 208 KYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGY 247
           + A+D D DG  D+  +  DA+AS A +LA+ GW    G+
Sbjct: 186 RLAVDFDGDGHRDIWDNRGDALASIANYLARSGWQAGQGW 225


>gi|187477860|ref|YP_785884.1| membrane-bound lytic murein transglycosylase B [Bordetella avium
           197N]
 gi|115422446|emb|CAJ48971.1| membrane-bound lytic murein transglycosylase B [Bordetella avium
           197N]
          Length = 379

 Score =  106 bits (264), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 69/216 (31%), Positives = 106/216 (49%), Gaps = 24/216 (11%)

Query: 41  RFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPV-------SFKD 93
           RFGE  ++ RA      + P+    L AD  Y  +T+AR    + +P V       S+  
Sbjct: 71  RFGESLASERA------LPPQAVLDLLADARY-SSTVAR----LIAPSVPGRKVWRSWDT 119

Query: 94  YLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLS 153
           Y       + I  G+     N  ++    ++YGVP  I++++ G+ET +G  MG   ++ 
Sbjct: 120 YRARFIEPKRIGWGVEFWNENRAVIERAAQQYGVPASIIVSIIGVETLYGRNMGNFRVID 179

Query: 154 TLATLAYD------CRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVV 207
            LATLA+D        R + F +Q    + L  +G +    LG+  G IG  QF+P ++ 
Sbjct: 180 ALATLAFDHPEPARPERVEMFRKQLADFITLTLQGKLEPGTLGSFAGAIGMPQFMPTSIA 239

Query: 208 KYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTK 243
            YA+D D+DG IDL  S  DA+ S   FL K GW +
Sbjct: 240 HYAVDGDDDGHIDLANSVPDAVMSVGSFLQKHGWQR 275


>gi|260574123|ref|ZP_05842128.1| lytic murein transglycosylase [Rhodobacter sp. SW2]
 gi|259023589|gb|EEW26880.1| lytic murein transglycosylase [Rhodobacter sp. SW2]
          Length = 417

 Score =  105 bits (263), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 78/267 (29%), Positives = 122/267 (45%), Gaps = 19/267 (7%)

Query: 11  LLMMVYPMLAQAVTQPKKATTQFICSDTADR---FGEWKSAARARAVREGMSPKTAKHLF 67
           +L +V    A  + Q ++       ++TA        W +  R RA+  G+S  T    F
Sbjct: 15  VLGVVLAFFAAPLAQAQEGKGGVELAETAGTDAGLQAWIAGFRPRALAMGISEATFDQAF 74

Query: 68  ADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGV 127
             + +    I RDR         +  YLD  +S + +  G    +A+  LL  ++  YGV
Sbjct: 75  RGVAFNAQVIDRDRHQAEFTKTIWA-YLDIATSDDRVNAGRKALQAHGPLLQRIEDTYGV 133

Query: 128 PPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSH 187
              IL+A+WGLET +G   G   L+  LA+LAYD RR  FF  +   AL +V+ G     
Sbjct: 134 DKHILLAVWGLETSYGAVRGNYGLIEALASLAYDGRRRSFFETELLAALKIVQSGDARLE 193

Query: 188 ALGATF-GEIGQFQFLPVNVVKYAIDADEDGKIDLVKSN-IDAIASAAKFLAKLGWTKCA 245
            +  ++ G  G  QF+P + + +A+D + DG+ D+   +  DA+AS A +L   GW    
Sbjct: 194 EMICSWAGATGHTQFMPSSYLAHAVDFNGDGRRDIWGDDPADALASTAAYLRHFGW---- 249

Query: 246 GYQPGEKNFAILKHWNASLNYNKTIAY 272
             Q G+       HW   +N      Y
Sbjct: 250 --QAGQ-------HWGLEVNLPAGFDY 267


>gi|254711939|ref|ZP_05173750.1| Putative peptidoglycan binding domain 1 [Brucella ceti M644/93/1]
 gi|261319579|ref|ZP_05958776.1| lytic Murein transglycosylase [Brucella ceti M644/93/1]
 gi|261292269|gb|EEX95765.1| lytic Murein transglycosylase [Brucella ceti M644/93/1]
          Length = 412

 Score =  105 bits (263), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 68/219 (31%), Positives = 113/219 (51%), Gaps = 18/219 (8%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTI---ARDRKMVTSPPVSFKDYLDGL 98
           F +W +  R  A++ G++P T    F  +   D  +   AR +   T P     +Y+D  
Sbjct: 40  FRQWIANFRPVAIKSGIAPSTFDRAFRGVNEPDPVVLEKARYQPEFTEP---VWNYIDNR 96

Query: 99  SSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLS----T 154
            + + +A G  + +   + L  ++  Y V   IL+A+W +E+++GE + +  ++     +
Sbjct: 97  VNEQSVAVGQNMARKWGQWLQRIEHHYSVDRHILLAIWSMESNYGEILKRDDVMRDAIRS 156

Query: 155 LATLAY-DCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAID 212
           LATLAY D RRAK+   Q   A+ +++ G I  SH  G+  G +G  QF+P +   YA+D
Sbjct: 157 LATLAYADARRAKYGRTQLIAAMKILQTGDIERSHLSGSWAGALGHTQFIPTSYQAYAVD 216

Query: 213 ADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGE 251
            D +GK D+  S  DA+ +AA  L + GW      QPG 
Sbjct: 217 MDGNGKRDIWNSVPDALGTAANLLHRNGW------QPGR 249


>gi|293392088|ref|ZP_06636422.1| lytic transglycosylase [Aggregatibacter actinomycetemcomitans
           D7S-1]
 gi|290952622|gb|EFE02741.1| lytic transglycosylase [Aggregatibacter actinomycetemcomitans
           D7S-1]
          Length = 339

 Score =  105 bits (263), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 67/226 (29%), Positives = 113/226 (50%), Gaps = 12/226 (5%)

Query: 30  TTQFICSDTADRFGEWKSAARARAVREGMS------PKTAKHLFADLEYLDTTIARDRKM 83
           T  +  S T D F ++ +  + +A  EG+S           ++   ++  D    R RK 
Sbjct: 4   TAVYSKSRTLDNFNDYVNFLKGKAAAEGVSADVLNAQNNINYIQKSVDLDDQQAGRIRKR 63

Query: 84  -VTSPPV----SFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGL 138
              +PP+       +YL+ + +   +    A        L N  K++ VP   L+ALWG+
Sbjct: 64  DPNAPPIINPNGTTNYLNRVLTKNKVDTAEARYWEQLPQLENASKKFSVPKNYLLALWGM 123

Query: 139 ETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHA-LGATFGEIG 197
           E+ FG   G   +LSTLATLA+D RR   F+++F  A+ ++++  I  +  LG+  G +G
Sbjct: 124 ESSFGYYQGNYDVLSTLATLAFDGRREALFSKEFIAAMKMLQRDHIQRYKMLGSWAGAMG 183

Query: 198 QFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTK 243
           Q QF+P + + YA D + DG  ++   + D  AS A +L  +GW +
Sbjct: 184 QTQFMPSSYLSYAADGNNDGAKNIWTDHYDVFASIANYLHTVGWNE 229


>gi|83951618|ref|ZP_00960350.1| hypothetical protein ISM_13685 [Roseovarius nubinhibens ISM]
 gi|83836624|gb|EAP75921.1| hypothetical protein ISM_13685 [Roseovarius nubinhibens ISM]
          Length = 390

 Score =  105 bits (262), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 69/203 (33%), Positives = 99/203 (48%), Gaps = 2/203 (0%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F  +    ++ A+  G +P T    FA        +  DR+        F ++   L S+
Sbjct: 27  FASFVQGLKSEAIARGHAPATVNGFFASARQDQAVLKADRQQGVFQK-DFTEFARHLISA 85

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             +  G A  ++  RL   ++  YGV  G+L+A W  ET FG   G    L+ L TL++D
Sbjct: 86  NRLNTGRAKAQSYDRLFDRIEATYGVDRGVLLAFWAFETDFGGFQGNINTLNALVTLSHD 145

Query: 162 CRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
           CRR + F  Q F AL L ++G  S +   GA  GEIG  Q LP +++   +D D DG + 
Sbjct: 146 CRRPELFRPQVFAALKLYERGDFSPTKTTGAWAGEIGMVQMLPQDIIDNGVDGDGDGHVS 205

Query: 221 LVKSNIDAIASAAKFLAKLGWTK 243
           L  S  DA+ S  K LA LGW K
Sbjct: 206 LKTSAADALMSGGKMLAHLGWRK 228


>gi|114769612|ref|ZP_01447222.1| Membrane bound lytic murein transglycosylase B [alpha
           proteobacterium HTCC2255]
 gi|114549317|gb|EAU52199.1| Membrane bound lytic murein transglycosylase B [alpha
           proteobacterium HTCC2255]
          Length = 410

 Score =  105 bits (262), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 73/238 (30%), Positives = 119/238 (50%), Gaps = 15/238 (6%)

Query: 11  LLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADL 70
           L++   P++A+        + Q I     + F +W    +  A+  G++  T    F ++
Sbjct: 12  LIVFSMPLVAEDTK-----SIQTIGVQKENSFKQWIRNFKEDAISNGITTSTFDTAFENV 66

Query: 71  EYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKK---EYGV 127
           +     I  D K          DYLD  +S + I  G   K+  S  L  L++   +Y V
Sbjct: 67  KLNSRVIKADNKQAEFSR-EIWDYLDTATSPKRITNG---KENLSNYLNTLREIEFKYRV 122

Query: 128 PPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVIS-S 186
              +++A+WGLE+ +G+ MG   ++  LATLA+D RR KF  +Q   AL ++++G I+  
Sbjct: 123 DAEVVLAIWGLESSYGKRMGDINIIEALATLAFDGRREKFGKQQLLEALKIIQRGDITPD 182

Query: 187 HALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVK--SNIDAIASAAKFLAKLGWT 242
             +G+  G +G  QF+P +   YA D   DGK D+       DA+AS A +LA+ GWT
Sbjct: 183 KMMGSWAGAMGHTQFIPTSYQAYAQDFTGDGKRDVWDPLDPSDALASTANYLAEFGWT 240


>gi|85374067|ref|YP_458129.1| lytic murein transglycosylase [Erythrobacter litoralis HTCC2594]
 gi|84787150|gb|ABC63332.1| lytic murein transglycosylase [Erythrobacter litoralis HTCC2594]
          Length = 343

 Score =  105 bits (262), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 64/199 (32%), Positives = 101/199 (50%), Gaps = 6/199 (3%)

Query: 49  ARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPP----VSFKDYLDGLSSSEII 104
           A+ARA  +G+S  T + + + L      I  DR    SP      + + YLD   +   I
Sbjct: 42  AKARA--QGVSEATIQRMTSGLTPNQRVIDLDRGQPGSPTRRGYPAMRPYLDTHVNPIRI 99

Query: 105 AQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRR 164
           ++G  +  A   L   +++EYGVP  +LMA+WG ET++G   G   L  +LATLA++ RR
Sbjct: 100 SRGRDMYAATRGLHGRIEREYGVPIEMLMAIWGHETNYGAIKGNFDLARSLATLAWEGRR 159

Query: 165 AKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKS 224
              F  +    + +  +G   S  +G+  G  G  QFLP   ++ A D D DG+ D+  +
Sbjct: 160 RDLFEGELIALMKIADRGFPRSQLVGSYAGAFGNPQFLPSVYLRLATDGDGDGRADIFNN 219

Query: 225 NIDAIASAAKFLAKLGWTK 243
             D +AS A++    GW +
Sbjct: 220 RADTLASIARYFQDSGWRQ 238


>gi|1944158|dbj|BAA19632.1| lytic transglycosylase [Aggregatibacter actinomycetemcomitans]
          Length = 376

 Score =  105 bits (262), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 65/218 (29%), Positives = 111/218 (50%), Gaps = 12/218 (5%)

Query: 38  TADRFGEWKSAARARAVREGMS------PKTAKHLFADLEYLDTTIARDRKM-VTSPPV- 89
           T D F ++ +  + +A  EG+S           ++   ++  D    R RK    +PP+ 
Sbjct: 53  TLDNFNDYVNFLKGKAAAEGVSADVLNAQNNINYIQKSVDLDDQQAGRIRKRDPNAPPII 112

Query: 90  ---SFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETM 146
                 +YL+ + +   +    A        L N  K++ VP   L+ALWG+E+ FG   
Sbjct: 113 NPNGTTNYLNRVLTKNKVDTAEARYWEQLPQLENASKKFSVPKNYLLALWGMESSFGYYQ 172

Query: 147 GKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHA-LGATFGEIGQFQFLPVN 205
           G   +LSTLATLA+D RR   F+++F  A+ ++++  I  +  LG+  G +GQ QF+P +
Sbjct: 173 GNYDVLSTLATLAFDGRREALFSKEFIAAMKMLQRDHIQRYKMLGSWAGAMGQTQFMPSS 232

Query: 206 VVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTK 243
            + YA D + DG+ ++   + D  AS A +L  +GW +
Sbjct: 233 YLSYAADGNNDGEKNIWTDHYDVFASIANYLHTVGWNE 270


>gi|251792393|ref|YP_003007119.1| lytic transglycosylase [Aggregatibacter aphrophilus NJ8700]
 gi|247533786|gb|ACS97032.1| lytic transglycosylase [Aggregatibacter aphrophilus NJ8700]
          Length = 375

 Score =  105 bits (262), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 71/244 (29%), Positives = 122/244 (50%), Gaps = 23/244 (9%)

Query: 20  AQAVTQPKKATTQFICSD-------TADRFGEWKSAARARAVREGMS------PKTAKHL 66
           +Q  T P + +   + ++       T D F ++ +  + +A  EG+S           ++
Sbjct: 27  SQGQTTPTENSVTTVSTNAVYNKPRTLDNFNDYVNFLKGKAAAEGVSVDVLNAQNNINYV 86

Query: 67  FADLEYLDTTIARDRKMV-TSPPV----SFKDYLDGLSSSEIIAQGIALKKANSRL--LI 119
              ++  D    R RK     PPV       +YL+ + +   +   IA  +   +L  L 
Sbjct: 87  QKSVDLDDQQAGRIRKRAPNEPPVINPNGTTNYLNRVLTPNKV--DIAETRYWEQLPQLE 144

Query: 120 NLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLV 179
           N  +++GVP   LMALWG+E+ FG   G   +LS LATLA+D RR   F+++F  A+ ++
Sbjct: 145 NASQKFGVPKNYLMALWGMESSFGYYQGSYDVLSVLATLAFDGRREALFSKEFIAAMKML 204

Query: 180 KKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAK 238
           ++  I  +  LG+  G +GQ QF+P + + YA D + DG+ ++   + D  AS A +L  
Sbjct: 205 QRDHIQRYKMLGSWAGAMGQTQFMPSSYLSYAADGNNDGEKNIWTEHYDVFASIANYLHT 264

Query: 239 LGWT 242
           +GW 
Sbjct: 265 VGWN 268


>gi|297184320|gb|ADI20437.1| membrane-bound lytic murein transglycosylase b [uncultured alpha
           proteobacterium EB080_L43F08]
          Length = 410

 Score =  105 bits (262), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 73/238 (30%), Positives = 119/238 (50%), Gaps = 15/238 (6%)

Query: 11  LLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADL 70
           L++   P++A+        + Q I     + F +W    +  A+  G++  T    F ++
Sbjct: 12  LIVFSMPLVAEDTK-----SIQTIGVQKENSFKQWIRNFKKDAISNGITTSTFDTAFENV 66

Query: 71  EYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKK---EYGV 127
           +     I  D K          DYLD  +S + I  G   K+  S  L  L++   +Y V
Sbjct: 67  KLNSRVIKADNKQAEFSR-EIWDYLDTATSPKRITNG---KENLSNYLNTLREIEFKYRV 122

Query: 128 PPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVIS-S 186
              +++A+WGLE+ +G+ MG   ++  LATLA+D RR KF  +Q   AL ++++G I+  
Sbjct: 123 DAEVVLAIWGLESSYGKRMGDINIIEALATLAFDGRREKFGKQQLLEALKIIQRGDITPD 182

Query: 187 HALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVK--SNIDAIASAAKFLAKLGWT 242
             +G+  G +G  QF+P +   YA D   DGK D+       DA+AS A +LA+ GWT
Sbjct: 183 KMMGSWAGAMGHTQFIPTSYQAYAQDFTGDGKRDVWDPLDPSDALASTANYLAEFGWT 240


>gi|303249643|ref|ZP_07335848.1| membrane-bound lytic murein transglycosylase B [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|302651455|gb|EFL81606.1| membrane-bound lytic murein transglycosylase B [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
          Length = 332

 Score =  105 bits (261), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 51/125 (40%), Positives = 76/125 (60%), Gaps = 1/125 (0%)

Query: 118 LINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALD 177
           L +   +Y V    ++ALWG+E+ FG   G   +LS LATLA+D RR K FT++F  A+ 
Sbjct: 100 LTHASNKYNVQKEYILALWGMESSFGRYQGDFDVLSVLATLAFDGRREKLFTQEFVNAMK 159

Query: 178 LVKKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFL 236
           ++  G I+ +  LG+  G +GQ QF+P   + YA D + DGK D+  +  DA AS A +L
Sbjct: 160 MLDDGTINRYEMLGSWAGAMGQTQFMPTAYLNYAADGNGDGKKDIWNTEADAFASIASYL 219

Query: 237 AKLGW 241
           + +GW
Sbjct: 220 STVGW 224


>gi|317401785|gb|EFV82401.1| peptidoglycan-binding protein [Achromobacter xylosoxidans C54]
          Length = 372

 Score =  105 bits (261), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 58/154 (37%), Positives = 88/154 (57%), Gaps = 7/154 (4%)

Query: 93  DYLDGLSSSEIIA---QGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKT 149
           DY+  L   E +A   +GIA  +A    L      YGV P  + A+WG+E+++G T+G  
Sbjct: 76  DYMAALVDDERVADGKEGIARWRAE---LDRAASRYGVDPATIAAVWGVESNYGRTLGGR 132

Query: 150 PLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVK 208
           PLL++L+TL+   RR  +F  +F+  L +++   I    L G+  G  GQ QF+P   ++
Sbjct: 133 PLLTSLSTLSCFGRRQAYFRGEFYATLKIIQDEHIDPDKLKGSWAGAFGQTQFMPSTYLR 192

Query: 209 YAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWT 242
            A+D D DG+ DL+ S  DA+AS A FL + GW 
Sbjct: 193 LAVDFDGDGRRDLIDSVPDALASTANFLKRAGWN 226


>gi|260460630|ref|ZP_05808881.1| lytic murein transglycosylase [Mesorhizobium opportunistum WSM2075]
 gi|259033735|gb|EEW34995.1| lytic murein transglycosylase [Mesorhizobium opportunistum WSM2075]
          Length = 407

 Score =  105 bits (261), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 70/218 (32%), Positives = 114/218 (52%), Gaps = 14/218 (6%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTI---ARDRKMVTSPPVSFKDYLDGL 98
           F +W +  RA AV  G+S       F  +   D  +   AR +   T+P     DY D  
Sbjct: 36  FRQWVAGFRATAVAGGVSGSVYDQAFRSINEPDPVVLEKARTQPEFTAPAW---DYFDNR 92

Query: 99  SSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLS----T 154
              + +A G  + K     L  ++ ++GV   IL+A+W +E+++GE + +  ++     +
Sbjct: 93  VHDQSVAVGQQMAKKWKPWLDRIEAKFGVDRYILLAIWSMESNYGEILKRDDIMRNVVRS 152

Query: 155 LATLAY-DCRRAKFFTEQFFYALDLVKKGVI-SSHALGATFGEIGQFQFLPVNVVKYAID 212
           LATLAY D +R+K+   Q   AL +++ G I   H +G+  G +GQ QF+P +   YA+D
Sbjct: 153 LATLAYGDPKRSKYARTQLVAALKILQTGDIDEGHLMGSWAGAMGQTQFIPTSYQHYAVD 212

Query: 213 ADEDGKIDLVKSNIDAIASAAKFLAKLGWT--KCAGYQ 248
            D +G+ D+  S  DA+A++A  L K GW   K  GY+
Sbjct: 213 MDGNGRRDIWNSIPDALATSANLLKKNGWQAGKTWGYE 250


>gi|190892606|ref|YP_001979148.1| membrane-bound lytic murein transglycosylase [Rhizobium etli CIAT
           652]
 gi|190697885|gb|ACE91970.1| probable membrane-bound lytic murein transglycosylase protein
           [Rhizobium etli CIAT 652]
          Length = 406

 Score =  105 bits (261), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 50/123 (40%), Positives = 75/123 (60%), Gaps = 1/123 (0%)

Query: 122 KKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKK 181
           ++E+GVP G++ A W +ET FG   G     + L TL++DCRR + F  Q    +++V+ 
Sbjct: 121 EQEFGVPSGVITAFWAMETDFGAVQGDFNTRNALVTLSHDCRRPELFRPQLIALIEMVQH 180

Query: 182 GVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLG 240
           G +  +   GA  GEIGQ Q LP +++ Y +D D DG I L +S  DAI +AAKF+  LG
Sbjct: 181 GDLDPATNTGAWAGEIGQVQMLPRDIIAYGMDGDGDGHIRLKQSGPDAILTAAKFIQHLG 240

Query: 241 WTK 243
           + +
Sbjct: 241 FER 243


>gi|114705440|ref|ZP_01438348.1| Putative peptidoglycan binding domain 1 [Fulvimarina pelagi
           HTCC2506]
 gi|114540225|gb|EAU43345.1| Putative peptidoglycan binding domain 1 [Fulvimarina pelagi
           HTCC2506]
          Length = 412

 Score =  105 bits (261), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 75/252 (29%), Positives = 123/252 (48%), Gaps = 13/252 (5%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F  W  +    A + G+     +  F+ +   D  +    +          DY+D   + 
Sbjct: 37  FRNWIQSFENTAAQNGVRRDVYRAAFSGVTTPDQDVLEKARYQPEFQSKVWDYIDNRVNE 96

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTL----AT 157
             +  G A +   S  L  ++  YGV   IL+A+W +ET++GE + +  ++ +L    AT
Sbjct: 97  MQVRTGQAYRSRLSSWLDRIESRYGVDRDILLAIWSMETNYGEILKRDDVMKSLPRSLAT 156

Query: 158 LAY-DCRRAKFFTEQFFYALDLVKKGVISSHALGATF-GEIGQFQFLPVNVVKYAIDADE 215
           LAY D RRAKF  EQ   AL +V+ G +S   L +++ G +G  QF+P +   YA D D 
Sbjct: 157 LAYLDKRRAKFAREQLIAALKIVQDGHVSPSNLQSSWAGAMGHTQFIPTSYRAYASDIDG 216

Query: 216 DGKIDLVKSNIDAIASAAKFLAKLGWT--KCAGYQ---PGEKNFAILKHWNASLNYNKTI 270
           DG+ ++  S  DA+A+AA  L K GW   K  GY+   P +     L+  N +++   ++
Sbjct: 217 DGRANIWASVPDALATAANLLRKNGWQTGKTWGYEVRVPAQYRGGRLERDNRTISQWASL 276

Query: 271 AYIAAHIDGVPI 282
            +  A  DG P+
Sbjct: 277 GFTRA--DGRPL 286


>gi|84684590|ref|ZP_01012491.1| Membrane bound lytic murein transglycosylase B [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84667569|gb|EAQ14038.1| Membrane bound lytic murein transglycosylase B [Rhodobacterales
           bacterium HTCC2654]
          Length = 360

 Score =  105 bits (261), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 54/160 (33%), Positives = 93/160 (58%), Gaps = 4/160 (2%)

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
           +YLD  +S E +  G    +    L I +++ +GV P ++ A+WGLE+ +G   G  P+L
Sbjct: 36  EYLDIAASEERVRNGRTALRKRRELFIEIERRFGVEPEVVAAIWGLESGYGVNRGSVPIL 95

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAI 211
           S LATLA+   R  FF ++   AL +++ G  +   + G+  G +G  QF+P + + +A+
Sbjct: 96  SALATLAWRGSRQAFFEDELVAALRILQSGHTTPEKMVGSWAGAMGHGQFMPSSFLNFAV 155

Query: 212 DADEDGKIDLVKSN-IDAIASAAKFLAKLGWTKCA--GYQ 248
           D D DG+ ++  ++  DA+AS A +L+K GW +    GY+
Sbjct: 156 DFDGDGRKNIWSNDPTDAVASIANYLSKHGWRRGQPWGYE 195


>gi|159042720|ref|YP_001531514.1| lytic murein transglycosylase [Dinoroseobacter shibae DFL 12]
 gi|157910480|gb|ABV91913.1| lytic murein transglycosylase [Dinoroseobacter shibae DFL 12]
          Length = 389

 Score =  105 bits (261), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 54/123 (43%), Positives = 72/123 (58%), Gaps = 1/123 (0%)

Query: 122 KKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKK 181
           +  +GVP G+L+ALW LET +G   G    L++L TLA+DCRR + F  Q F AL+L + 
Sbjct: 105 ETRFGVPRGVLLALWALETDYGAVQGDFNTLNSLVTLAHDCRRPELFRPQIFAALELYEA 164

Query: 182 GVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLG 240
           G    +   GA  GEIG  Q LP +++   ID D DG + L  S  DA+ S A  L+ LG
Sbjct: 165 GDFDPARTTGAWAGEIGMVQMLPEDILTKGIDGDGDGHVYLKTSAPDALLSGANMLSGLG 224

Query: 241 WTK 243
           W K
Sbjct: 225 WRK 227


>gi|126732715|ref|ZP_01748511.1| peptidoglycan binding domain protein [Sagittula stellata E-37]
 gi|126706845|gb|EBA05915.1| peptidoglycan binding domain protein [Sagittula stellata E-37]
          Length = 466

 Score =  104 bits (260), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 61/202 (30%), Positives = 102/202 (50%), Gaps = 3/202 (1%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F  W    R RA+ +G+S +T    F  + +    + RD            DYLD  +S 
Sbjct: 100 FARWVDGFRPRALSQGVSARTFDAAFRGVTFDPKVVERDSSQAEFAK-GIWDYLDSAASD 158

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             +  G +    +  LL  ++  YGV   +++A+WG+ET +G   G   ++ ++A+LA+D
Sbjct: 159 TRVNNGRSALAQHRALLDRIEAHYGVDKEVVLAVWGMETAYGSYRGSNHIIQSMASLAFD 218

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR  FF  Q   AL ++++G  +   + G+  G +G  QF+P +    A+D   DG+ D
Sbjct: 219 GRRRSFFERQLVAALQILEQGDTTPDRMTGSWAGAMGHTQFMPTSFQSLAVDFTGDGRRD 278

Query: 221 LVKSN-IDAIASAAKFLAKLGW 241
           +   +  DA+AS A +L K GW
Sbjct: 279 IWGDDPSDALASTANYLKKNGW 300


>gi|327482401|gb|AEA85711.1| membrane-bound lytic murein transglycosylase, putative [Pseudomonas
           stutzeri DSM 4166]
          Length = 444

 Score =  104 bits (260), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 71/205 (34%), Positives = 109/205 (53%), Gaps = 6/205 (2%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKM--VTSPPVSFKDYLDGLS 99
           F +W+   RA A+  G+S  T    FA ++     I  DR     T P      YL+   
Sbjct: 76  FSQWREQFRAEALAAGISAATFDRAFAGVQPDPAVIEADRSQPEFTRP---VWQYLESAI 132

Query: 100 SSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLA 159
           S + +  G  L   ++  L  ++  YGV    L+A+WGLE+ FG+ MG   ++ +LATLA
Sbjct: 133 SPQRVRSGQRLLNEHAATLDRIEARYGVDRETLVAVWGLESSFGQIMGDKSVIRSLATLA 192

Query: 160 YDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGK 218
           ++ RR  F   Q   AL++++ G +S   + G+  G +GQ QF+P     +A+D D DGK
Sbjct: 193 HEGRRPAFAKSQLIAALEILQHGDVSPQQMRGSWAGAMGQTQFIPTTYNTHAVDFDGDGK 252

Query: 219 IDLVKSNIDAIASAAKFLAKLGWTK 243
            D+  S+ DA+ASAA +L   GW +
Sbjct: 253 RDIWNSSADALASAAHYLQASGWKQ 277


>gi|146284084|ref|YP_001174237.1| membrane-bound lytic murein transglycosylase, putative [Pseudomonas
           stutzeri A1501]
 gi|145572289|gb|ABP81395.1| membrane-bound lytic murein transglycosylase, putative [Pseudomonas
           stutzeri A1501]
          Length = 446

 Score =  104 bits (260), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 71/205 (34%), Positives = 109/205 (53%), Gaps = 6/205 (2%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKM--VTSPPVSFKDYLDGLS 99
           F +W+   RA A+  G+S  T    FA ++     I  DR     T P      YL+   
Sbjct: 78  FSQWREQFRAEALAAGISSTTFDRAFAGVQPDPAVIEADRSQPEFTRP---VWQYLESAI 134

Query: 100 SSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLA 159
           S + +  G  L   ++  L  ++  YGV    L+A+WGLE+ FG+ MG   ++ +LATLA
Sbjct: 135 SPQRVRSGQRLLNEHAATLDRIEARYGVDRETLVAVWGLESSFGQIMGDKSVIRSLATLA 194

Query: 160 YDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGK 218
           ++ RR  F   Q   AL++++ G +S   + G+  G +GQ QF+P     +A+D D DGK
Sbjct: 195 HEGRRPAFAKSQLIAALEILQHGDVSPQQMRGSWAGAMGQTQFIPTTYNTHAVDFDGDGK 254

Query: 219 IDLVKSNIDAIASAAKFLAKLGWTK 243
            D+  S+ DA+ASAA +L   GW +
Sbjct: 255 RDIWNSSADALASAAHYLQASGWKQ 279


>gi|296284123|ref|ZP_06862121.1| lytic murein transglycosylase [Citromicrobium bathyomarinum JL354]
          Length = 339

 Score =  104 bits (260), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 63/199 (31%), Positives = 101/199 (50%), Gaps = 10/199 (5%)

Query: 49  ARARAVREGMSPKTAKHLFADLE------YLDTTIARDRKMVTSPPVSFKDYLDGLSSSE 102
           A+ARA  +G+S  T + + +DL        LD +          PP+  + YLD    + 
Sbjct: 38  AKARA--QGVSEDTIRRMTSDLTPNPRVIELDQSQPGSSSSPGYPPL--RPYLDRHVDNA 93

Query: 103 IIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDC 162
            I  G ++    + L   ++++YGVPP I++A+WG ET++G   G   L  +LATLA++ 
Sbjct: 94  RIGGGRSVYNETTYLHDRIRQQYGVPPEIIIAIWGHETNYGGYRGNFDLARSLATLAWEG 153

Query: 163 RRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLV 222
           RR + F  +F   L +  KG      +G+  G  G  QFLP   ++ A D D DG  ++ 
Sbjct: 154 RRRELFESEFIALLKVADKGYSRERLVGSWAGAFGNPQFLPSVYLRLATDGDGDGMANIF 213

Query: 223 KSNIDAIASAAKFLAKLGW 241
            +  D +AS A++    GW
Sbjct: 214 TNQADTMASIARYFQDAGW 232


>gi|262276188|ref|ZP_06053997.1| membrane-bound lytic murein transglycosylase B [Grimontia hollisae
           CIP 101886]
 gi|262219996|gb|EEY71312.1| membrane-bound lytic murein transglycosylase B [Grimontia hollisae
           CIP 101886]
          Length = 326

 Score =  104 bits (260), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 60/203 (29%), Positives = 101/203 (49%), Gaps = 2/203 (0%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F  +    +  +  +G      +  F++L Y +  +  DR       ++  +Y+      
Sbjct: 28  FEHYVDGLKKESAEKGFDTTLIEQAFSNLMYRERAVKADRNQ-PEKRLTLDEYIPQAVPD 86

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             +AQ   L   +   L  +   YGV P  L+ALWG+E++FG+  G   ++  L+T+AYD
Sbjct: 87  WKVAQARKLYDQHYNDLKRIGDIYGVQPRFLVALWGVESNFGKFTGNYNVIEALSTMAYD 146

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR  FF  + F AL ++++G I    + G+  G +GQ QF+P +   +A D + DGK D
Sbjct: 147 GRREAFFRNEVFEALTILQQGHIDIDKMKGSWAGAMGQCQFMPSSFNAFAADGNNDGKKD 206

Query: 221 LVKSNIDAIASAAKFLAKLGWTK 243
           +  S  D  AS+A +L   GW +
Sbjct: 207 IWASQPDVFASSANYLKNAGWDE 229


>gi|32033695|ref|ZP_00133990.1| COG2951: Membrane-bound lytic murein transglycosylase B
           [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
 gi|126208124|ref|YP_001053349.1| membrane-bound lytic murein transglycosylase B [Actinobacillus
           pleuropneumoniae L20]
 gi|307252193|ref|ZP_07534091.1| Lytic murein transglycosylase [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|126096916|gb|ABN73744.1| membrane-bound lytic murein transglycosylase B [Actinobacillus
           pleuropneumoniae serovar 5b str. L20]
 gi|306860337|gb|EFM92352.1| Lytic murein transglycosylase [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
          Length = 362

 Score =  104 bits (260), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 51/125 (40%), Positives = 76/125 (60%), Gaps = 1/125 (0%)

Query: 118 LINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALD 177
           L +   +Y V    ++ALWG+E+ FG   G   +LS LATLA+D RR K FT++F  A+ 
Sbjct: 130 LTHASNKYNVQKEYILALWGMESSFGRYQGDFDVLSVLATLAFDGRREKLFTQEFVNAMK 189

Query: 178 LVKKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFL 236
           ++  G I+ +  LG+  G +GQ QF+P   + YA D + DGK D+  +  DA AS A +L
Sbjct: 190 MLDDGTINRYEMLGSWAGAMGQTQFMPTAYLNYAADGNGDGKKDIWNTEADAFASIASYL 249

Query: 237 AKLGW 241
           + +GW
Sbjct: 250 STVGW 254


>gi|15966561|ref|NP_386914.1| putative membrane-bound lytic murein transglycosylase protein
           [Sinorhizobium meliloti 1021]
 gi|307300402|ref|ZP_07580182.1| lytic murein transglycosylase [Sinorhizobium meliloti BL225C]
 gi|307318267|ref|ZP_07597702.1| lytic murein transglycosylase [Sinorhizobium meliloti AK83]
 gi|15075832|emb|CAC47387.1| Membrane-bound lytic murein transglycosylase precursor
           [Sinorhizobium meliloti 1021]
 gi|306895949|gb|EFN26700.1| lytic murein transglycosylase [Sinorhizobium meliloti AK83]
 gi|306904568|gb|EFN35152.1| lytic murein transglycosylase [Sinorhizobium meliloti BL225C]
          Length = 405

 Score =  104 bits (260), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 86/260 (33%), Positives = 130/260 (50%), Gaps = 23/260 (8%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFK--DYLDGLS 99
           F  W +   A A + G+S  T +  FA ++  D  +    K    P    K  +Y+D   
Sbjct: 33  FQNWINNFYATAAKNGISQATYRKAFAGVKTPDPAVLE--KAAYQPEFKHKIWEYVDARV 90

Query: 100 S--SEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL----S 153
           +  ++ I Q +A K A  R L  L++ YGV   IL+A+W +E+++G  + K   L     
Sbjct: 91  NPYTKRIGQEMAAKHA--RTLNALERHYGVDKSILLAIWSMESNYGAILQKDDRLHYVPR 148

Query: 154 TLATLAY-DCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAI 211
            LATLAY D RR+KF   Q   AL +++ G I+   L G+  G +G  QF+P + + YA+
Sbjct: 149 ALATLAYADSRRSKFAKTQLIAALKILQSGDITPRELTGSWAGAMGHTQFIPTSYLLYAV 208

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEK-NFAILKHWNAS--LNYNK 268
           DAD +G  D+  S  DA+A+AA  L K GW      +PGE   + ++   N +      K
Sbjct: 209 DADGNGHRDIWNSVPDALATAANLLRKNGW------RPGETWGYEVVPPANGAKYSGQTK 262

Query: 269 TIAYIAAHIDGVPIGKGYDT 288
           T+   AA     P GKG+  
Sbjct: 263 TLGQWAALGFARPGGKGFSN 282


>gi|3132253|dbj|BAA28130.1| unnamed protein product [Actinobacillus actinomycetemcomitans]
          Length = 376

 Score =  104 bits (260), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 70/245 (28%), Positives = 119/245 (48%), Gaps = 21/245 (8%)

Query: 20  AQAVTQPKKA---------TTQFICSDTADRFGEWKSAARARAVREGMS------PKTAK 64
           + A TQP +          T  +  S T D F ++ +  + +A  EG+S           
Sbjct: 26  SSAPTQPSEPVNSVTAVNPTAVYSKSRTLDNFNDYVNFLKGKAAAEGVSADVLNAQNNIN 85

Query: 65  HLFADLEYLDTTIARDRKM-VTSPPV----SFKDYLDGLSSSEIIAQGIALKKANSRLLI 119
           ++   ++  D    R RK    +PP+       +YL+ + +   +    A        L 
Sbjct: 86  YIQKSVDLDDQQAGRIRKRDPNAPPIINPNGTTNYLNRVLTKNKVDTAEARYWEQLPQLE 145

Query: 120 NLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLV 179
           N  K++ VP   L+ALWG+E+ FG   G   +LSTLATLA+D RR   F+++F  A+ ++
Sbjct: 146 NASKKFSVPKNYLLALWGMESSFGYYQGNYDVLSTLATLAFDGRRESLFSKEFIAAMKIL 205

Query: 180 KKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAK 238
           ++  I  +  LG+  G +GQ QF+P + + YA D + DG+ ++   + D   S A +L  
Sbjct: 206 QRDHIQRYKMLGSWAGAMGQTQFMPSSYLSYAADGNNDGEKNIWTDHYDVFDSIANYLNT 265

Query: 239 LGWTK 243
           +GW +
Sbjct: 266 VGWER 270


>gi|307256664|ref|ZP_07538443.1| Lytic murein transglycosylase [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
 gi|306864712|gb|EFM96616.1| Lytic murein transglycosylase [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
          Length = 362

 Score =  104 bits (260), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 51/125 (40%), Positives = 76/125 (60%), Gaps = 1/125 (0%)

Query: 118 LINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALD 177
           L +   +Y V    ++ALWG+E+ FG   G   +LS LATLA+D RR K FT++F  A+ 
Sbjct: 130 LTHASNKYNVQKEYILALWGMESSFGRYQGDFDVLSVLATLAFDGRREKLFTQEFVNAMK 189

Query: 178 LVKKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFL 236
           ++  G I+ +  LG+  G +GQ QF+P   + YA D + DGK D+  +  DA AS A +L
Sbjct: 190 MLDDGTINRYEMLGSWAGAMGQTQFMPTAYLNYAADGNGDGKKDIWNTEADAFASIASYL 249

Query: 237 AKLGW 241
           + +GW
Sbjct: 250 STVGW 254


>gi|190149952|ref|YP_001968477.1| membrane-bound lytic murein transglycosylase B [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
 gi|307245498|ref|ZP_07527585.1| Lytic murein transglycosylase [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|307254452|ref|ZP_07536289.1| Lytic murein transglycosylase [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|307258911|ref|ZP_07540642.1| Lytic murein transglycosylase [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|307263280|ref|ZP_07544898.1| Lytic murein transglycosylase [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
 gi|189915083|gb|ACE61335.1| membrane-bound lytic murein transglycosylase B [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
 gi|306853557|gb|EFM85775.1| Lytic murein transglycosylase [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|306862593|gb|EFM94550.1| Lytic murein transglycosylase [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|306866935|gb|EFM98792.1| Lytic murein transglycosylase [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|306871342|gb|EFN03068.1| Lytic murein transglycosylase [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
          Length = 362

 Score =  104 bits (260), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 51/125 (40%), Positives = 76/125 (60%), Gaps = 1/125 (0%)

Query: 118 LINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALD 177
           L +   +Y V    ++ALWG+E+ FG   G   +LS LATLA+D RR K FT++F  A+ 
Sbjct: 130 LTHASNKYNVQKEYILALWGMESSFGRYQGDFDVLSVLATLAFDGRREKLFTQEFVNAMK 189

Query: 178 LVKKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFL 236
           ++  G I+ +  LG+  G +GQ QF+P   + YA D + DGK D+  +  DA AS A +L
Sbjct: 190 MLDDGTINRYEMLGSWAGAMGQTQFMPTAYLNYAADGNGDGKKDIWNTEADAFASIASYL 249

Query: 237 AKLGW 241
           + +GW
Sbjct: 250 STVGW 254


>gi|332976792|gb|EGK13622.1| type III effector HopAJ2 [Psychrobacter sp. 1501(2011)]
          Length = 441

 Score =  104 bits (260), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 63/208 (30%), Positives = 102/208 (49%), Gaps = 3/208 (1%)

Query: 37  DTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLD 96
           DT   F EWKS    RA+ +G S      +    +     I+ D        + + DY D
Sbjct: 71  DTYSSFSEWKSDFTTRAMSQGYSAYDVSRILDSAQLNSQVISLDSNQAEFVKMPW-DYAD 129

Query: 97  GLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLA 156
              S   ++ G +       LL  L+ +YGV   I+ A+WG+E+ +G   G + + S+LA
Sbjct: 130 SAVSGGRVSSGQSKFNDQRSLLARLESQYGVNAEIITAIWGMESSYGAVTGNSYIPSSLA 189

Query: 157 TLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATF-GEIGQFQFLPVNVVKYAIDADE 215
           TLAY+ RR  +  +Q    + L++ G I    L  ++ G +G  QF+P   + Y +D D 
Sbjct: 190 TLAYEGRRRAWAEDQLLALIKLIQHGDIYPSQLNGSWAGGMGHTQFIPGTWLDYGVDGDN 249

Query: 216 DGKIDLVKSNIDAIASAAKFLAKLGWTK 243
           DG+     +  DA++S A +L+K GW +
Sbjct: 250 DGRRSPWVT-ADALSSTANYLSKSGWVR 276


>gi|239834506|ref|ZP_04682834.1| lytic murein transglycosylase [Ochrobactrum intermedium LMG 3301]
 gi|239822569|gb|EEQ94138.1| lytic murein transglycosylase [Ochrobactrum intermedium LMG 3301]
          Length = 441

 Score =  104 bits (260), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 65/219 (29%), Positives = 117/219 (53%), Gaps = 14/219 (6%)

Query: 41  RFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTI---ARDRKMVTSPPVSFKDYLDG 97
           +F +W ++ R  A++ G+SP T    F  ++  D  +   AR +   T P     +Y+D 
Sbjct: 68  QFRQWVASFRPVAIKAGVSPSTFDRAFRGVDAPDPVVLQKARYQPEFTEP---VWNYIDN 124

Query: 98  LSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLS---- 153
             + + ++ G ++ +     L  +++ + V   IL+A+W +E+++GE + +  ++     
Sbjct: 125 RVNEQSVSVGQSMARKWGPWLQRIEQRFSVDRNILLAIWSMESNYGEILKRDDVMRDAVR 184

Query: 154 TLATLAY-DCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAI 211
           +LATLAY D RRAK+   Q   A+ +++ G I   H  G+  G +G  QF+P +   YA+
Sbjct: 185 SLATLAYADQRRAKYGRTQLIAAMKILQTGDIDRGHLSGSWAGALGHTQFIPTSYQAYAV 244

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGWT--KCAGYQ 248
           D D +GK D+  S  DA+ +AA  L + GW   +  GY+
Sbjct: 245 DVDGNGKRDIWNSVPDALGTAANLLHRNGWQPGRTWGYE 283


>gi|114327734|ref|YP_744891.1| membrane-bound lytic murein transglycosylase B [Granulibacter
           bethesdensis CGDNIH1]
 gi|114315908|gb|ABI61968.1| membrane-bound lytic murein transglycosylase B [Granulibacter
           bethesdensis CGDNIH1]
          Length = 331

 Score =  104 bits (259), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 64/206 (31%), Positives = 106/206 (51%), Gaps = 2/206 (0%)

Query: 39  ADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGL 98
           A  F  + +  +A   R G+S          L      I  DRK      ++++ Y    
Sbjct: 33  AQDFRGFIAGVKAEGRRAGISDTILAQALNTLSPNTRVIELDRKQPEFT-MTWERYRSTR 91

Query: 99  SSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATL 158
            S + IA G      N++LL+ ++  YGV  G+++ +WGLET++G   G   ++   ATL
Sbjct: 92  LSEKRIAAGREQAARNAQLLMQVENAYGVDRGVILGIWGLETNYGAFQGGFNVIEATATL 151

Query: 159 AYDCRRAKFFTEQFFYALDLVKKGVISSHALGATF-GEIGQFQFLPVNVVKYAIDADEDG 217
           A++ RRA FF  +   AL ++  G I+   +  ++ G +GQ QF+P +  +YA+D D DG
Sbjct: 152 AWEGRRASFFRAELMAALKILNHGDITMPRMQGSYAGAMGQPQFMPTSFNRYAVDFDGDG 211

Query: 218 KIDLVKSNIDAIASAAKFLAKLGWTK 243
           + ++  S  D +AS A +L K GW +
Sbjct: 212 RRNIWDSVPDVLASIANYLLKSGWHQ 237


>gi|306841151|ref|ZP_07473867.1| lytic murein transglycosylase [Brucella sp. BO2]
 gi|306288777|gb|EFM60095.1| lytic murein transglycosylase [Brucella sp. BO2]
          Length = 428

 Score =  104 bits (259), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 67/219 (30%), Positives = 112/219 (51%), Gaps = 18/219 (8%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTI---ARDRKMVTSPPVSFKDYLDGL 98
           F +W +  R  A++ G++P T    F  +   D  +   AR +   T P     +Y+D  
Sbjct: 56  FRQWIANFRPVAIKSGIAPSTFDRAFRGVNQPDPVVLEKARYQPEFTEP---VWNYIDNR 112

Query: 99  SSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLS----T 154
            + + +A G  + +   + L  ++  Y V   IL+A+W +E+++GE + +  ++     +
Sbjct: 113 VNEQSVAVGQNMARKWGQWLQRIEHHYSVDRHILLAIWSMESNYGEILKRDDVMRDAIRS 172

Query: 155 LATLAY-DCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAID 212
           LATLAY D RRAK+   Q   A+ +++ G I   H  G+  G +G  QF+P +   YA+D
Sbjct: 173 LATLAYADARRAKYGRTQLIAAMKILQTGDIERGHLSGSWAGALGHTQFIPTSYQAYAVD 232

Query: 213 ADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGE 251
            D +GK D+  S  DA+ +AA  L + GW      QPG 
Sbjct: 233 MDGNGKRDIWNSVPDALGTAANLLHRNGW------QPGR 265


>gi|217977417|ref|YP_002361564.1| lytic murein transglycosylase [Methylocella silvestris BL2]
 gi|217502793|gb|ACK50202.1| lytic murein transglycosylase [Methylocella silvestris BL2]
          Length = 405

 Score =  104 bits (259), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 66/203 (32%), Positives = 103/203 (50%), Gaps = 16/203 (7%)

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
           DYL GL   E +  G A  +  ++ L   +  YGV    ++A+WG+E+ FG + GK P++
Sbjct: 86  DYLAGLVDDERVEDGRAQMRKWAQPLSAAQSRYGVDAATIVAVWGVESDFGRSFGKRPII 145

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKG-VISSHALGATFGEIGQFQFLPVNVVKYAI 211
            +LATL+    RA +F  +   A  ++  G ++    +G+  G  G  QF+P   ++ A+
Sbjct: 146 QSLATLSCGPYRAAYFRTELTAAFKILDHGDIVPEQFVGSWAGAFGHTQFMPSTFLRTAV 205

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPG-EKNFAILKHWNASLNYNKT- 269
           D D DG+ DL+ S  DA+ S A +L K GWT      PG E  F +      +    +T 
Sbjct: 206 DFDGDGRRDLINSVPDALGSTAAYLRKGGWT------PGVEWGFEVRLPQGYAGPSGRTR 259

Query: 270 ---IAYIAAH----IDGVPIGKG 285
              I + AA     +DG P+G G
Sbjct: 260 KEPIGHWAARGLVKVDGSPLGSG 282


>gi|84685464|ref|ZP_01013362.1| hypothetical protein 1099457000258_RB2654_11363 [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84666621|gb|EAQ13093.1| hypothetical protein RB2654_11363 [Rhodobacterales bacterium
           HTCC2654]
          Length = 397

 Score =  104 bits (259), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 70/220 (31%), Positives = 97/220 (44%), Gaps = 5/220 (2%)

Query: 26  PKKATTQFICSDTADRFGEWK---SAARARAVREGMSPKTAKHLFADLEYLDTTIARDRK 82
           P  A+ Q I +      G W       +  AV  G    T    FA       T+  DR 
Sbjct: 15  PVSASAQAIPAPLIQCGGSWSDFVGRMKELAVSRGYDRGTVDQFFASARQDGATLNADRG 74

Query: 83  MVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHF 142
                  +F D+   L S+  +  G A  +    +   ++  YGV  G+L A W  ET F
Sbjct: 75  QGFFQK-TFIDFSRSLISANRMQNGQANMQRYDAIFDQIESRYGVSRGVLTAFWAFETDF 133

Query: 143 GETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQF 201
           G   G    L++L TL++DCRR   F  Q   AL+L   G  S +   GA  GEIG  Q 
Sbjct: 134 GGFQGDFNTLNSLMTLSHDCRRPGLFQPQVLAALELYTHGDFSPTGTTGAWAGEIGMVQM 193

Query: 202 LPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
           LP ++++  +D D DG + L  S  DA+ S    L+ LGW
Sbjct: 194 LPADIIEAGVDGDGDGHVRLKTSAPDALMSGGHMLSNLGW 233


>gi|254720679|ref|ZP_05182490.1| Putative peptidoglycan binding domain 1 [Brucella sp. 83/13]
 gi|265985729|ref|ZP_06098464.1| lytic Murein transglycosylase [Brucella sp. 83/13]
 gi|306839369|ref|ZP_07472185.1| lytic murein transglycosylase [Brucella sp. NF 2653]
 gi|264664321|gb|EEZ34582.1| lytic Murein transglycosylase [Brucella sp. 83/13]
 gi|306405617|gb|EFM61880.1| lytic murein transglycosylase [Brucella sp. NF 2653]
          Length = 412

 Score =  104 bits (259), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 67/219 (30%), Positives = 112/219 (51%), Gaps = 18/219 (8%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTI---ARDRKMVTSPPVSFKDYLDGL 98
           F +W +  R  A++ G++P T    F  +   D  +   AR +   T P     +Y+D  
Sbjct: 40  FRQWIANFRPVAIKSGIAPSTFDRAFRGVNEPDPVVLEKARYQPEFTEP---VWNYIDNR 96

Query: 99  SSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLS----T 154
            + + +A G  + +   + L  ++  Y V   IL+A+W +E+++GE + +  ++     +
Sbjct: 97  VNEQSVAVGQNMARKWGQWLQRIEHHYSVDRHILLAIWSMESNYGEILKRDDVMRDAIRS 156

Query: 155 LATLAY-DCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAID 212
           LATLAY D RRAK+   Q   A+ +++ G I   H  G+  G +G  QF+P +   YA+D
Sbjct: 157 LATLAYADARRAKYGRTQLIAAMKILQTGDIERGHLSGSWAGALGHTQFIPTSYQAYAVD 216

Query: 213 ADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGE 251
            D +GK D+  S  DA+ +AA  L + GW      QPG 
Sbjct: 217 MDGNGKRDIWNSVPDALGTAANLLHRNGW------QPGR 249


>gi|62317029|ref|YP_222882.1| transglycosylase [Brucella abortus bv. 1 str. 9-941]
 gi|83269023|ref|YP_418314.1| peptidoglycan binding domain-containing protein [Brucella
           melitensis biovar Abortus 2308]
 gi|189022296|ref|YP_001932037.1| Putative peptidoglycan binding domain 1 [Brucella abortus S19]
 gi|254695217|ref|ZP_05157045.1| Putative peptidoglycan binding domain 1 [Brucella abortus bv. 3
           str. Tulya]
 gi|254698316|ref|ZP_05160144.1| Putative peptidoglycan binding domain 1 [Brucella abortus bv. 2
           str. 86/8/59]
 gi|254706370|ref|ZP_05168198.1| Putative peptidoglycan binding domain 1 [Brucella pinnipedialis
           M163/99/10]
 gi|254711340|ref|ZP_05173151.1| Putative peptidoglycan binding domain 1 [Brucella pinnipedialis
           B2/94]
 gi|254731759|ref|ZP_05190337.1| Putative peptidoglycan binding domain 1 [Brucella abortus bv. 4
           str. 292]
 gi|256014866|ref|YP_003104875.1| membrane-bound lytic murein transglycosylase B [Brucella microti
           CCM 4915]
 gi|256030031|ref|ZP_05443645.1| Putative peptidoglycan binding domain 1 [Brucella pinnipedialis
           M292/94/1]
 gi|256158203|ref|ZP_05456112.1| Putative peptidoglycan binding domain 1 [Brucella ceti M490/95/1]
 gi|256252855|ref|ZP_05458391.1| Putative peptidoglycan binding domain 1 [Brucella ceti B1/94]
 gi|256256672|ref|ZP_05462208.1| Putative peptidoglycan binding domain 1 [Brucella abortus bv. 9
           str. C68]
 gi|260166918|ref|ZP_05753729.1| membrane-bound lytic murein transglycosylase B [Brucella sp. F5/99]
 gi|260544265|ref|ZP_05820086.1| lytic murein transglycosylase [Brucella abortus NCTC 8038]
 gi|260759523|ref|ZP_05871871.1| lytic Murein transglycosylase [Brucella abortus bv. 4 str. 292]
 gi|260762767|ref|ZP_05875099.1| lytic Murein transglycosylase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260882916|ref|ZP_05894530.1| lytic Murein transglycosylase [Brucella abortus bv. 9 str. C68]
 gi|261215579|ref|ZP_05929860.1| lytic Murein transglycosylase [Brucella abortus bv. 3 str. Tulya]
 gi|261219942|ref|ZP_05934223.1| lytic Murein transglycosylase [Brucella ceti B1/94]
 gi|261313816|ref|ZP_05953013.1| lytic Murein transglycosylase [Brucella pinnipedialis M163/99/10]
 gi|261318943|ref|ZP_05958140.1| lytic Murein transglycosylase [Brucella pinnipedialis B2/94]
 gi|261756303|ref|ZP_06000012.1| lytic Murein transglycosylase [Brucella sp. F5/99]
 gi|265987053|ref|ZP_06099610.1| lytic Murein transglycosylase [Brucella pinnipedialis M292/94/1]
 gi|265996715|ref|ZP_06109272.1| lytic Murein transglycosylase [Brucella ceti M490/95/1]
 gi|294853097|ref|ZP_06793769.1| transglycosylase [Brucella sp. NVSL 07-0026]
 gi|297250027|ref|ZP_06933728.1| peptidoglycan binding domain-containing protein [Brucella abortus
           bv. 5 str. B3196]
 gi|62197222|gb|AAX75521.1| hypothetical transglycosylase [Brucella abortus bv. 1 str. 9-941]
 gi|82939297|emb|CAJ12235.1| Putative peptidoglycan binding domain 1 [Brucella melitensis biovar
           Abortus 2308]
 gi|189020870|gb|ACD73591.1| Putative peptidoglycan binding domain 1 [Brucella abortus S19]
 gi|255997526|gb|ACU49213.1| membrane-bound lytic murein transglycosylase B [Brucella microti
           CCM 4915]
 gi|260097536|gb|EEW81410.1| lytic murein transglycosylase [Brucella abortus NCTC 8038]
 gi|260669841|gb|EEX56781.1| lytic Murein transglycosylase [Brucella abortus bv. 4 str. 292]
 gi|260673188|gb|EEX60009.1| lytic Murein transglycosylase [Brucella abortus bv. 2 str. 86/8/59]
 gi|260872444|gb|EEX79513.1| lytic Murein transglycosylase [Brucella abortus bv. 9 str. C68]
 gi|260917186|gb|EEX84047.1| lytic Murein transglycosylase [Brucella abortus bv. 3 str. Tulya]
 gi|260918526|gb|EEX85179.1| lytic Murein transglycosylase [Brucella ceti B1/94]
 gi|261298166|gb|EEY01663.1| lytic Murein transglycosylase [Brucella pinnipedialis B2/94]
 gi|261302842|gb|EEY06339.1| lytic Murein transglycosylase [Brucella pinnipedialis M163/99/10]
 gi|261736287|gb|EEY24283.1| lytic Murein transglycosylase [Brucella sp. F5/99]
 gi|262551012|gb|EEZ07173.1| lytic Murein transglycosylase [Brucella ceti M490/95/1]
 gi|264659250|gb|EEZ29511.1| lytic Murein transglycosylase [Brucella pinnipedialis M292/94/1]
 gi|294818752|gb|EFG35752.1| transglycosylase [Brucella sp. NVSL 07-0026]
 gi|297173896|gb|EFH33260.1| peptidoglycan binding domain-containing protein [Brucella abortus
           bv. 5 str. B3196]
          Length = 412

 Score =  104 bits (259), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 67/219 (30%), Positives = 112/219 (51%), Gaps = 18/219 (8%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTI---ARDRKMVTSPPVSFKDYLDGL 98
           F +W +  R  A++ G++P T    F  +   D  +   AR +   T P     +Y+D  
Sbjct: 40  FRQWIANFRPVAIKSGIAPSTFDRAFRGVNEPDPVVLEKARYQPEFTEP---VWNYIDNR 96

Query: 99  SSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLS----T 154
            + + +A G  + +   + L  ++  Y V   IL+A+W +E+++GE + +  ++     +
Sbjct: 97  VNEQSVAVGQNMARKWGQWLQRIEHHYSVDRHILLAIWSMESNYGEILKRDDVMRDAIRS 156

Query: 155 LATLAY-DCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAID 212
           LATLAY D RRAK+   Q   A+ +++ G I   H  G+  G +G  QF+P +   YA+D
Sbjct: 157 LATLAYADARRAKYGRTQLIAAMKILQTGDIERGHLSGSWAGALGHTQFIPTSYQAYAVD 216

Query: 213 ADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGE 251
            D +GK D+  S  DA+ +AA  L + GW      QPG 
Sbjct: 217 MDGNGKRDIWNSVPDALGTAANLLHRNGW------QPGR 249


>gi|148558066|ref|YP_001257145.1| putative transglycosylase [Brucella ovis ATCC 25840]
 gi|148369351|gb|ABQ62223.1| putative transglycosylase [Brucella ovis ATCC 25840]
          Length = 412

 Score =  104 bits (259), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 67/219 (30%), Positives = 112/219 (51%), Gaps = 18/219 (8%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTI---ARDRKMVTSPPVSFKDYLDGL 98
           F +W +  R  A++ G++P T    F  +   D  +   AR +   T P     +Y+D  
Sbjct: 40  FRQWIANFRPVAIKSGIAPSTFDRAFRGVNEPDPVVLEKARYQPEFTEP---VWNYIDNR 96

Query: 99  SSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLS----T 154
            + + +A G  + +   + L  ++  Y V   IL+A+W +E+++GE + +  ++     +
Sbjct: 97  VNEQSVAVGQNMARKWGQWLQRIEHHYSVDRHILLAIWSMESNYGEILKRDDVMRDAIRS 156

Query: 155 LATLAY-DCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAID 212
           LATLAY D RRAK+   Q   A+ +++ G I   H  G+  G +G  QF+P +   YA+D
Sbjct: 157 LATLAYADARRAKYGRTQLIAAMKILQTGDIERGHLSGSWAGALGHTQFIPTSYQAYAVD 216

Query: 213 ADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGE 251
            D +GK D+  S  DA+ +AA  L + GW      QPG 
Sbjct: 217 MDGNGKRDIWNSVPDALGTAANLLHRNGW------QPGR 249


>gi|218673133|ref|ZP_03522802.1| probable membrane-bound lytic murein transglycosylase protein
           [Rhizobium etli GR56]
          Length = 294

 Score =  104 bits (259), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 49/127 (38%), Positives = 77/127 (60%), Gaps = 1/127 (0%)

Query: 118 LINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALD 177
           L   ++E+GVP G++ A W +ET FG   G     + L TL++DCRR + F  Q    ++
Sbjct: 5   LPRAEQEFGVPSGVITAFWAMETDFGAVQGDFNTRNALVTLSHDCRRPELFRPQLIALIE 64

Query: 178 LVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFL 236
           +V+ G +  +   GA  GEIGQ Q LP +++ Y +D D DG + L +S+ DA+ +AAKF+
Sbjct: 65  MVQHGDLDPATNTGAWAGEIGQVQMLPRDIIAYGMDGDGDGHVRLKQSSPDAVLTAAKFI 124

Query: 237 AKLGWTK 243
             LG+ +
Sbjct: 125 QHLGFER 131


>gi|254699386|ref|ZP_05161214.1| Putative peptidoglycan binding domain 1 [Brucella suis bv. 5 str.
           513]
 gi|261749835|ref|ZP_05993544.1| lytic Murein transglycosylase [Brucella suis bv. 5 str. 513]
 gi|261739588|gb|EEY27514.1| lytic Murein transglycosylase [Brucella suis bv. 5 str. 513]
          Length = 412

 Score =  104 bits (259), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 67/219 (30%), Positives = 112/219 (51%), Gaps = 18/219 (8%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTI---ARDRKMVTSPPVSFKDYLDGL 98
           F +W +  R  A++ G++P T    F  +   D  +   AR +   T P     +Y+D  
Sbjct: 40  FRQWIANFRPVAIKSGIAPSTFDRAFRGVNEPDPVVLEKARYQPEFTEP---VWNYIDNR 96

Query: 99  SSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLS----T 154
            + + +A G  + +   + L  ++  Y V   IL+A+W +E+++GE + +  ++     +
Sbjct: 97  VNEQSVAVGQNMARKWGQWLQRIEHHYSVDRHILLAIWSMESNYGEILKRDDVMRDAIRS 156

Query: 155 LATLAY-DCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAID 212
           LATLAY D RRAK+   Q   A+ +++ G I   H  G+  G +G  QF+P +   YA+D
Sbjct: 157 LATLAYADARRAKYGRTQLIAAMKILQTGDIERGHLSGSWAGALGHTQFIPTSYQAYAVD 216

Query: 213 ADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGE 251
            D +GK D+  S  DA+ +AA  L + GW      QPG 
Sbjct: 217 MDGNGKRDIWNSVPDALGTAANLLHRNGW------QPGR 249


>gi|168036664|ref|XP_001770826.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162677885|gb|EDQ64350.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 530

 Score =  104 bits (259), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 62/220 (28%), Positives = 109/220 (49%), Gaps = 16/220 (7%)

Query: 37  DTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPV--SFKDY 94
           +   +F EW    R+ A  +G+S +       ++E    ++     M   P V  +  DY
Sbjct: 207 EAMQKFKEWVKDVRSDAQSQGVSEEVLDWALENIELSKESLVHTESM---PEVKLTLDDY 263

Query: 95  LDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLST 154
           L  +   + +  G  L K N  LL  + +++GVP   L+A+WG+ET++G  MG   ++ +
Sbjct: 264 LKRMVDEKRVKIGAELMKENVELLTEVSQKFGVPTQFLVAIWGIETNYGSYMGNWDIIQS 323

Query: 155 LATLAYDCR---RAKFFTEQFFYALDLVKKGVIS--------SHALGATFGEIGQFQFLP 203
           LAT+++  +   R+ +F  +   AL +++KG           +   G+  G +GQ QF+P
Sbjct: 324 LATMSFTEKPASRSNYFRGELIEALLMLQKGTADRGRGPEGKTRLRGSWAGAMGQCQFMP 383

Query: 204 VNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTK 243
            +   YA+D D DG  D+ +S  D  AS A +  + GW +
Sbjct: 384 TSFRDYALDYDGDGHKDIWESKADVFASIANYFKEHGWKE 423


>gi|218682975|ref|ZP_03530576.1| membrane-bound lytic murein transglycosylase protein [Rhizobium
           etli CIAT 894]
          Length = 348

 Score =  103 bits (258), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 49/133 (36%), Positives = 79/133 (59%), Gaps = 1/133 (0%)

Query: 112 KANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQ 171
           K ++ +    ++E+GVP G++ A W +ET FG   G     + L TL++DCRR + F  Q
Sbjct: 134 KQHADVFARAEQEFGVPAGVITAFWAMETDFGAVQGDFNTRNALVTLSHDCRRPELFRPQ 193

Query: 172 FFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIA 230
               +++V+ G +  +   GA  GEIGQ Q LP +++ Y +D D DG I + +S  DA+ 
Sbjct: 194 LIALIEMVEHGDLDPATNTGAWAGEIGQVQMLPRDIIAYGMDGDGDGHIHVKQSGPDAVL 253

Query: 231 SAAKFLAKLGWTK 243
           +AAKF+  LG+ +
Sbjct: 254 TAAKFIQHLGFER 266


>gi|330994627|ref|ZP_08318550.1| Membrane-bound lytic murein transglycosylase B [Gluconacetobacter
           sp. SXCC-1]
 gi|329758268|gb|EGG74789.1| Membrane-bound lytic murein transglycosylase B [Gluconacetobacter
           sp. SXCC-1]
          Length = 337

 Score =  103 bits (258), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 66/196 (33%), Positives = 103/196 (52%), Gaps = 5/196 (2%)

Query: 50  RARAVREGMSPKTAKHLFADLEYLDT-TIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGI 108
           R  A+R+G++     H   DL   +T  IARDR       +++  Y   + +   I  G 
Sbjct: 50  RREAIRQGLTADAVSHAL-DLSAPNTQVIARDRNQ-PEFHLTWAQYRSRVLTQRKIDDGR 107

Query: 109 ALKKANSRLL-INLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKF 167
           A   A   +L   +   Y V  G +M +WGLE+ +G   GK  ++  L TLA++ RRA+F
Sbjct: 108 AAFAARRAILEQQVLTRYDVAAGAVMGIWGLESAYGTITGKFAVVDALCTLAFEGRRAQF 167

Query: 168 FTEQFFYALDLVKKGVISSHALGATF-GEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNI 226
           F ++ F+AL ++  G I+   +  ++ G +GQ QF+P   +KYA+D D DG+ D+  S  
Sbjct: 168 FHDELFHALTILNAGDITPELMTGSYAGAMGQPQFMPSAYLKYAVDIDGDGRRDIWHSMP 227

Query: 227 DAIASAAKFLAKLGWT 242
           D   S A +LA  GW 
Sbjct: 228 DIFGSIASYLAGSGWV 243


>gi|225628550|ref|ZP_03786584.1| lytic murein transglycosylase [Brucella ceti str. Cudo]
 gi|237816592|ref|ZP_04595584.1| lytic murein transglycosylase [Brucella abortus str. 2308 A]
 gi|225616396|gb|EEH13444.1| lytic murein transglycosylase [Brucella ceti str. Cudo]
 gi|237787405|gb|EEP61621.1| lytic murein transglycosylase [Brucella abortus str. 2308 A]
          Length = 429

 Score =  103 bits (258), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 67/219 (30%), Positives = 112/219 (51%), Gaps = 18/219 (8%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTI---ARDRKMVTSPPVSFKDYLDGL 98
           F +W +  R  A++ G++P T    F  +   D  +   AR +   T P     +Y+D  
Sbjct: 57  FRQWIANFRPVAIKSGIAPSTFDRAFRGVNEPDPVVLEKARYQPEFTEP---VWNYIDNR 113

Query: 99  SSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLS----T 154
            + + +A G  + +   + L  ++  Y V   IL+A+W +E+++GE + +  ++     +
Sbjct: 114 VNEQSVAVGQNMARKWGQWLQRIEHHYSVDRHILLAIWSMESNYGEILKRDDVMRDAIRS 173

Query: 155 LATLAY-DCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAID 212
           LATLAY D RRAK+   Q   A+ +++ G I   H  G+  G +G  QF+P +   YA+D
Sbjct: 174 LATLAYADARRAKYGRTQLIAAMKILQTGDIERGHLSGSWAGALGHTQFIPTSYQAYAVD 233

Query: 213 ADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGE 251
            D +GK D+  S  DA+ +AA  L + GW      QPG 
Sbjct: 234 MDGNGKRDIWNSVPDALGTAANLLHRNGW------QPGR 266


>gi|303253708|ref|ZP_07339845.1| membrane-bound lytic murein transglycosylase B [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
 gi|302647433|gb|EFL77652.1| membrane-bound lytic murein transglycosylase B [Actinobacillus
           pleuropneumoniae serovar 2 str. 4226]
          Length = 332

 Score =  103 bits (258), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 76/125 (60%), Gaps = 1/125 (0%)

Query: 118 LINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALD 177
           L +   +Y V    ++ALWG+E+ FG   G   +LS LATLA+D RR K FT++F  A+ 
Sbjct: 100 LTHASNKYNVQKEYILALWGMESSFGRYQGDFDVLSVLATLAFDGRREKLFTQEFVNAMK 159

Query: 178 LVKKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFL 236
           ++  G I+ +  LG+  G +GQ QF+P   + YA D + DGK D+  +  DA +S A +L
Sbjct: 160 MLDDGTINRYEMLGSWAGAMGQTQFMPTAYLNYAADGNGDGKKDIWNTEADAFSSIASYL 219

Query: 237 AKLGW 241
           + +GW
Sbjct: 220 STVGW 224


>gi|94496386|ref|ZP_01302963.1| Lytic murein transglycosylase [Sphingomonas sp. SKA58]
 gi|94424132|gb|EAT09156.1| Lytic murein transglycosylase [Sphingomonas sp. SKA58]
          Length = 338

 Score =  103 bits (258), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 70/229 (30%), Positives = 111/229 (48%), Gaps = 4/229 (1%)

Query: 19  LAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIA 78
           +A A      AT     + T+  F  +  + R +A   G+S  T   +F+DL      I 
Sbjct: 3   VAVATASVGAATPVPAVAQTSGDFRSYLESLRPQARAMGISDATLNGVFSDLTPNPRVIE 62

Query: 79  RDRKM----VTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMA 134
            D+        +P  +F+ Y      +  I++G    +AN   L  ++ E GVP  I++A
Sbjct: 63  LDQNQPGGGAYAPIPNFQPYRVKHVDAARISRGRTAYQANRARLARIEAETGVPEEIMVA 122

Query: 135 LWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFG 194
           ++G ET++G   G   L+ +LATLA++ RR   F  +    L ++  GV  S  +G+  G
Sbjct: 123 IFGHETNYGSYTGDFDLIRSLATLAWEGRRRTLFEPELLATLKMLDNGVPRSRLVGSWAG 182

Query: 195 EIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTK 243
             G  QFLP   ++ A D D DGK D+  S  DA+AS A +  + GW +
Sbjct: 183 ATGYPQFLPSVYLRLAKDGDGDGKADIWTSEADALASIANYFVQSGWRR 231


>gi|17988368|ref|NP_541001.1| membrane-bound lytic murein transglycosylase B [Brucella melitensis
           bv. 1 str. 16M]
 gi|256042995|ref|ZP_05445941.1| membrane-bound lytic murein transglycosylase B [Brucella melitensis
           bv. 1 str. Rev.1]
 gi|256112021|ref|ZP_05452966.1| membrane-bound lytic murein transglycosylase B [Brucella melitensis
           bv. 3 str. Ether]
 gi|260564228|ref|ZP_05834713.1| lytic murein transglycosylase [Brucella melitensis bv. 1 str. 16M]
 gi|265989432|ref|ZP_06101989.1| lytic Murein transglycosylase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265993467|ref|ZP_06106024.1| lytic Murein transglycosylase [Brucella melitensis bv. 3 str.
           Ether]
 gi|17984146|gb|AAL53265.1| membrane-bound lytic murein transglycosylase b [Brucella melitensis
           bv. 1 str. 16M]
 gi|260151871|gb|EEW86964.1| lytic murein transglycosylase [Brucella melitensis bv. 1 str. 16M]
 gi|262764337|gb|EEZ10369.1| lytic Murein transglycosylase [Brucella melitensis bv. 3 str.
           Ether]
 gi|263000101|gb|EEZ12791.1| lytic Murein transglycosylase [Brucella melitensis bv. 1 str.
           Rev.1]
          Length = 412

 Score =  103 bits (258), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 67/219 (30%), Positives = 112/219 (51%), Gaps = 18/219 (8%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTI---ARDRKMVTSPPVSFKDYLDGL 98
           F +W +  R  A++ G++P T    F  +   D  +   AR +   T P     +Y+D  
Sbjct: 40  FRQWIANFRPVAIKSGIAPSTFDRAFRGVNEPDPVVLEKARYQPEFTEP---VWNYIDNR 96

Query: 99  SSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLS----T 154
            + + +A G  + +   + L  ++  Y V   IL+A+W +E+++GE + +  ++     +
Sbjct: 97  VNEQSVAVGQNMARKWGQWLQRIEHHYSVDRHILLAIWSMESNYGEILKRDDVMRDAIRS 156

Query: 155 LATLAY-DCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAID 212
           LATLAY D RRAK+   Q   A+ +++ G I   H  G+  G +G  QF+P +   YA+D
Sbjct: 157 LATLAYADARRAKYGRTQLIAAMKILQTGDIERGHLSGSWAGALGHTQFIPTSYQAYAVD 216

Query: 213 ADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGE 251
            D +GK D+  S  DA+ +AA  L + GW      QPG 
Sbjct: 217 MDGNGKRDIWNSVPDALGTAANLLHRNGW------QPGR 249


>gi|332186023|ref|ZP_08387769.1| lytic murein transglycosylase family protein [Sphingomonas sp. S17]
 gi|332013838|gb|EGI55897.1| lytic murein transglycosylase family protein [Sphingomonas sp. S17]
          Length = 338

 Score =  103 bits (258), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 69/234 (29%), Positives = 111/234 (47%), Gaps = 7/234 (2%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVS----FKDYLDG 97
           F  +    R+ A+ +G+S  T   +   L      I  DR+    P  S    F  Y   
Sbjct: 26  FQSYLQQVRSTALAQGVSRATLDSVLPTLTLNSRVIELDRRQPGGPANSGFSPFAPYKAA 85

Query: 98  LSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLAT 157
              +  I++G +   A    L  ++++ GVP  I++A+WG ET++G   G   L+ +LA+
Sbjct: 86  HVDAARISRGRSKYLAQRPRLSRIERDTGVPESIMVAIWGHETNYGSYTGNFDLIRSLAS 145

Query: 158 LAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDG 217
           LAY+ RR   F  +F  A+ ++ +GV  S   G+  G  G  QFLP   ++ A D D DG
Sbjct: 146 LAYEGRRRPLFEGEFIAAMKMMDRGVSRSQLKGSWAGATGNPQFLPSIYLRLARDGDGDG 205

Query: 218 KIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASLNYNKTIA 271
           + D+  S  D +AS   +    GW   AG QP      +   +N S+  N+ ++
Sbjct: 206 RADIWNSEADTLASIGNYFVNAGWR--AG-QPWGFAVTVPAGFNRSMVQNRLVS 256


>gi|307546096|ref|YP_003898575.1| lytic murein transglycosylase [Halomonas elongata DSM 2581]
 gi|307218120|emb|CBV43390.1| lytic murein transglycosylase [Halomonas elongata DSM 2581]
          Length = 433

 Score =  103 bits (258), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 65/206 (31%), Positives = 102/206 (49%), Gaps = 8/206 (3%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFK---DYLDGL 98
           F  W +  R +A  EG+   T       L Y    I  D     S P   +   +YLD  
Sbjct: 65  FETWLANFRRQARGEGIDEATLARALDGLRYRPRVIELD----GSQPEFVRPIWEYLDSA 120

Query: 99  SSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATL 158
            S+  + +G          +  + + YGVP  +L+A+WG+E+ +G+ +G    L  LATL
Sbjct: 121 VSASRVKKGRERLAEYRDTVRQMTERYGVPGEVLVAIWGIESSYGDYLGDFSTLEALATL 180

Query: 159 AYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDG 217
           AYD RR  F   +   AL +++ G IS   + G+  G +G  QF+P + + +A+D D DG
Sbjct: 181 AYDGRRRDFARGELLAALRIIEAGDISPERMKGSWAGAMGHTQFIPSSFLAHAVDGDGDG 240

Query: 218 KIDLVKSNIDAIASAAKFLAKLGWTK 243
           + D+  S  D +AS A +L + GW +
Sbjct: 241 RRDIWNSIADVLASTANYLDEAGWRE 266


>gi|89899141|ref|YP_521612.1| lytic murein transglycosylase [Rhodoferax ferrireducens T118]
 gi|89343878|gb|ABD68081.1| Lytic murein transglycosylase [Rhodoferax ferrireducens T118]
          Length = 434

 Score =  103 bits (257), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 70/229 (30%), Positives = 108/229 (47%), Gaps = 7/229 (3%)

Query: 17  PMLAQAVTQPKKATTQFI-CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDT 75
           P    A   P  AT   +   + + +F  W +   A A   G+   T    F +  +L  
Sbjct: 41  PSTTSANPTPAGATPATLDAVENSQKFARWVAEFSATARTAGIDEATLHIAFDNARFLPR 100

Query: 76  TIARDRKM--VTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILM 133
            I  DR     T  P    DYLD   S+  + +G        + +  +   YGVP  +L+
Sbjct: 101 VIESDRAQPEFTRTP---WDYLDTAVSALRVTRGQDKLLQLRQQIDPIAVRYGVPTEVLL 157

Query: 134 ALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKK-GVISSHALGAT 192
           A+WG+E+ +G  +G  P +  LATL ++ RR  +   Q   AL +++   ++    +G+ 
Sbjct: 158 AIWGMESSYGSFVGDLPTIDALATLGFEGRREAWARNQLLVALKILQSHDIVRVQMVGSW 217

Query: 193 FGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
            G +GQ QFLP   + YA+DAD DG+ D+  S  D +AS A FL   GW
Sbjct: 218 AGAMGQTQFLPSVFLAYAVDADGDGRRDIWGSVPDVMASTANFLVGSGW 266


>gi|307249841|ref|ZP_07531817.1| Lytic murein transglycosylase [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|306858143|gb|EFM90223.1| Lytic murein transglycosylase [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
          Length = 362

 Score =  103 bits (257), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 76/125 (60%), Gaps = 1/125 (0%)

Query: 118 LINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALD 177
           L +   +Y V    ++ALWG+E+ FG   G   +LS LATLA+D RR K FT++F  A+ 
Sbjct: 130 LTHASNKYNVQKEYILALWGMESSFGRYQGDFDVLSVLATLAFDGRREKLFTQEFVNAMK 189

Query: 178 LVKKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFL 236
           ++  G I+ +  LG+  G +GQ QF+P   + YA D + DGK D+  +  DA +S A +L
Sbjct: 190 MLDDGTINRYEMLGSWAGAMGQTQFMPTAYLNYAADGNGDGKKDIWNTEADAFSSIASYL 249

Query: 237 AKLGW 241
           + +GW
Sbjct: 250 STVGW 254


>gi|307247612|ref|ZP_07529655.1| Lytic murein transglycosylase [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|306855882|gb|EFM88042.1| Lytic murein transglycosylase [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
          Length = 362

 Score =  103 bits (257), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 76/125 (60%), Gaps = 1/125 (0%)

Query: 118 LINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALD 177
           L +   +Y V    ++ALWG+E+ FG   G   +LS LATLA+D RR K FT++F  A+ 
Sbjct: 130 LTHASNKYNVQKEYILALWGMESSFGRYQGDFDVLSVLATLAFDGRREKLFTQEFVNAMK 189

Query: 178 LVKKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFL 236
           ++  G I+ +  LG+  G +GQ QF+P   + YA D + DGK D+  +  DA +S A +L
Sbjct: 190 MLDDGTINRYEMLGSWAGAMGQTQFMPTAYLNYAADGNGDGKKDIWNTEADAFSSIASYL 249

Query: 237 AKLGW 241
           + +GW
Sbjct: 250 STVGW 254


>gi|312882551|ref|ZP_07742292.1| membrane-bound lytic murein transglycosylase B [Vibrio
           caribbenthicus ATCC BAA-2122]
 gi|309369951|gb|EFP97462.1| membrane-bound lytic murein transglycosylase B [Vibrio
           caribbenthicus ATCC BAA-2122]
          Length = 323

 Score =  103 bits (257), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 59/202 (29%), Positives = 104/202 (51%), Gaps = 2/202 (0%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F  +    +  A   G+S +T +  FA + +    +  D+       ++  +Y+      
Sbjct: 24  FNSYIEGLKKEARSNGISERTIQEAFAGVSHRPKAVTADKNQ-PEKRLTLDEYIPRAVPD 82

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             + Q  AL + + + L ++   YGV P  ++ALWG+E++FG+  G   ++  L+TLA+D
Sbjct: 83  WKVKQAKALYEKHYQELQSIGLAYGVQPRFIVALWGVESNFGKFTGNYKVIDALSTLAFD 142

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR  FF ++   AL+++ +G I      G+  G +GQ QF+P + + +A D   DG+ D
Sbjct: 143 GRREAFFRKETMAALEILDQGHIKVEDFKGSWAGAMGQCQFMPSSFLSFAKDGSGDGRKD 202

Query: 221 LVKSNIDAIASAAKFLAKLGWT 242
           +  S  D  ASAA +L + GW 
Sbjct: 203 IWNSEADVFASAANYLHQSGWN 224


>gi|86137246|ref|ZP_01055824.1| hypothetical protein MED193_16267 [Roseobacter sp. MED193]
 gi|85826570|gb|EAQ46767.1| hypothetical protein MED193_16267 [Roseobacter sp. MED193]
          Length = 389

 Score =  103 bits (257), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 71/231 (30%), Positives = 105/231 (45%), Gaps = 9/231 (3%)

Query: 13  MMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEY 72
           M + P+   A+  P  A  Q  C  +   F  +  + +  A+  G    T    F     
Sbjct: 1   MRLLPLAFAALMMPATAFAQ--CGGS---FSGFVKSLKQEALTAGYDRTTVNGFFKGARQ 55

Query: 73  LDTTIARDR-KMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGI 131
               +  DR + V   P  F ++   L S   I +G ++ +        ++  YG+  G+
Sbjct: 56  DPKVLRADRAQGVFQKP--FIEFSRRLISQSRINRGRSMAEKYDSTFRRIETTYGIDRGV 113

Query: 132 LMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALG 190
           L+A W  ET +G   G       L TLA+DCRR + F  Q F AL+L K+G    +   G
Sbjct: 114 LLAFWAFETDYGSFQGDFNTRDALITLAHDCRRPELFRPQIFAALELYKRGNFDPARTTG 173

Query: 191 ATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
           A  GEIG  Q LP +++   +DAD DG + L  S  DA+ S  K L+ LGW
Sbjct: 174 AWAGEIGMVQMLPQDILDNGVDADGDGHVSLKTSAPDALMSGGKMLSHLGW 224


>gi|165976054|ref|YP_001651647.1| membrane-bound lytic murein transglycosylase B [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
 gi|165876155|gb|ABY69203.1| membrane-bound lytic murein transglycosylase B [Actinobacillus
           pleuropneumoniae serovar 3 str. JL03]
          Length = 362

 Score =  103 bits (257), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 76/125 (60%), Gaps = 1/125 (0%)

Query: 118 LINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALD 177
           L +   +Y V    ++ALWG+E+ FG   G   +LS LATLA+D RR K FT++F  A+ 
Sbjct: 130 LTHASNKYNVQKEYILALWGMESSFGRYQGDFDVLSVLATLAFDGRREKLFTQEFVNAMK 189

Query: 178 LVKKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFL 236
           ++  G I+ +  LG+  G +GQ QF+P   + YA D + DGK D+  +  DA +S A +L
Sbjct: 190 MLDDGTINRYEMLGSWAGAMGQTQFMPTAYLNYAADGNGDGKKDIWNTEADAFSSIASYL 249

Query: 237 AKLGW 241
           + +GW
Sbjct: 250 STVGW 254


>gi|319779802|ref|YP_004139278.1| lytic murein transglycosylase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317165690|gb|ADV09228.1| lytic murein transglycosylase [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 437

 Score =  103 bits (257), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 84/146 (57%), Gaps = 1/146 (0%)

Query: 103 IIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDC 162
           + A G A + AN+R L  ++K YGVP  +L+A+WG ET FG           L T A+  
Sbjct: 127 VTAGGRAREAANARTLAAIEKRYGVPGEVLLAIWGRETGFGAAKMPYDAFEVLGTKAFMS 186

Query: 163 RRAKFFTEQFFYALDLVKKGVISSHALGATF-GEIGQFQFLPVNVVKYAIDADEDGKIDL 221
            R  FF  +   AL++V++ +    A+ +++ G +GQ QF+P + +K+A+D D DG++D+
Sbjct: 187 TRKDFFRTELLAALEIVERRLAPVGAMKSSWAGALGQPQFMPTSFLKHAVDFDGDGRVDI 246

Query: 222 VKSNIDAIASAAKFLAKLGWTKCAGY 247
             S  D +AS A +L   GW K  G+
Sbjct: 247 WNSTPDVLASIANYLVHYGWVKGRGW 272


>gi|329850378|ref|ZP_08265223.1| lytic murein transglycosylase family protein [Asticcacaulis
           biprosthecum C19]
 gi|328840693|gb|EGF90264.1| lytic murein transglycosylase family protein [Asticcacaulis
           biprosthecum C19]
          Length = 452

 Score =  103 bits (256), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 64/202 (31%), Positives = 101/202 (50%), Gaps = 5/202 (2%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVT-SPPVSFKDYLDGLSS 100
           F +WK    ++A   G  P     +  +++ L   ++ D +    S P S   Y+    S
Sbjct: 73  FDQWKQNFISKAASRGFDPVFTSQVLENVQPLQNVLSSDNQQPEFSKPAS--SYMRQAVS 130

Query: 101 SEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAY 160
               A       AN  + + + K +GVP  +L  +W +E+  G   G   ++S LATLAY
Sbjct: 131 PTRAAAARTRLDANFNVPVIVTK-FGVPAHLLGGIWTMESDLGRVQGNIDVISALATLAY 189

Query: 161 DCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKI 219
           D RR  +  ++    L +++   IS   L G+  G +GQ QFLP N ++   D D DG +
Sbjct: 190 DGRRRVWAEDELIACLTILRDHKISRQTLKGSWAGAMGQTQFLPDNYLRLGADGDNDGVV 249

Query: 220 DLVKSNIDAIASAAKFLAKLGW 241
           D+ KS+ DA+AS+A  L+K GW
Sbjct: 250 DIWKSDSDALASSANLLSKAGW 271


>gi|328542465|ref|YP_004302574.1| Lytic murein transglycosylase subfamily [polymorphum gilvum
           SL003B-26A1]
 gi|326412212|gb|ADZ69275.1| Lytic murein transglycosylase subfamily, putative [Polymorphum
           gilvum SL003B-26A1]
          Length = 419

 Score =  103 bits (256), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 71/206 (34%), Positives = 107/206 (51%), Gaps = 17/206 (8%)

Query: 47  SAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQ 106
           SAA   AV  GMSP             DT    +R+     P+   DYL G  S   +  
Sbjct: 64  SAATYNAVFTGMSPDP-----------DTIRLMNRQSEFVKPIW--DYLAGAVSDTRVET 110

Query: 107 GIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDC-RRA 165
           G A+      +L  +++ YGV   +++A+WG+ET++G  MGK  ++  LATLAY   RR 
Sbjct: 111 GKAMLAQYGDVLRAIEQRYGVDRAVVLAVWGMETNYGGFMGKHNVIRALATLAYGAPRRQ 170

Query: 166 KFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKS 224
           +F+  +   AL +V+ G I     +G+  G +G  QF+P +  +YA D + DG+ D+  S
Sbjct: 171 EFWRSELVTALGIVQAGHIRHDQMIGSWAGAMGHTQFMPSSWKRYAADYNGDGRRDIWTS 230

Query: 225 NIDAIASAAKFLAKLGWT--KCAGYQ 248
             DA+AS A +L + GW   K  GY+
Sbjct: 231 IPDALASTANYLKEHGWQTGKTWGYE 256


>gi|260462014|ref|ZP_05810259.1| lytic murein transglycosylase [Mesorhizobium opportunistum WSM2075]
 gi|259032261|gb|EEW33527.1| lytic murein transglycosylase [Mesorhizobium opportunistum WSM2075]
          Length = 425

 Score =  103 bits (256), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 52/146 (35%), Positives = 85/146 (58%), Gaps = 1/146 (0%)

Query: 103 IIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDC 162
           + A G A + AN++ +  ++K YGVP  IL+A+WG ET FG           L T A+  
Sbjct: 115 VTAGGRARETANAKTIAAIEKRYGVPGEILLAIWGRETGFGAAKMPYDAFEVLGTKAFMS 174

Query: 163 RRAKFFTEQFFYALDLVKKGVISSHALGATF-GEIGQFQFLPVNVVKYAIDADEDGKIDL 221
            +  FF  +   AL++V++G+    A+ +++ G +GQ QF+P + +K+A+D D DG++D+
Sbjct: 175 TKKDFFRTELLAALEIVERGLAPVGAMKSSWAGALGQPQFMPTSFLKHAVDFDGDGRVDI 234

Query: 222 VKSNIDAIASAAKFLAKLGWTKCAGY 247
             S  D +AS A +L   GW K  G+
Sbjct: 235 WNSTPDVLASIANYLVHYGWVKGRGW 260


>gi|325293486|ref|YP_004279350.1| lytic murein transglycosylase [Agrobacterium sp. H13-3]
 gi|325061339|gb|ADY65030.1| lytic murein transglycosylase [Agrobacterium sp. H13-3]
          Length = 408

 Score =  103 bits (256), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 74/123 (60%), Gaps = 1/123 (0%)

Query: 122 KKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKK 181
           + E+G+P G++ A W +ET FG   G     + L TL++DCRR + F  Q    +++V+ 
Sbjct: 123 ENEFGIPAGVIAAFWAMETDFGAVQGDFNTRNALVTLSHDCRRPELFRPQLLALIEMVQH 182

Query: 182 GVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLG 240
           G +  +   GA  GEIGQ Q LP +++ + ID D DG +++  S  DAI +AAKF+  LG
Sbjct: 183 GDLDPTSNTGAWAGEIGQVQMLPKDIIAFGIDGDGDGHVNVKSSAPDAILTAAKFIQHLG 242

Query: 241 WTK 243
           + K
Sbjct: 243 FKK 245


>gi|58038512|ref|YP_190476.1| membrane-bound lytic murein transglycosylase [Gluconobacter oxydans
           621H]
 gi|58000926|gb|AAW59820.1| Membrane-bound lytic murein transglycosylase [Gluconobacter oxydans
           621H]
          Length = 331

 Score =  103 bits (256), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 58/201 (28%), Positives = 102/201 (50%), Gaps = 1/201 (0%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           +G +  + RA+A+ +G+S        +     + ++ +  +      +++  Y D +   
Sbjct: 34  YGAFLESVRAQALAQGLSSSIVSQALSLTTQPNASVLKLDRHQPEFTLTWAQYRDRVLPE 93

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
              A+G ++  A   ++  +   +G     +M +WGLE+ FG   G   ++  LATLA+D
Sbjct: 94  SRFAKGRSVYAAQQSVMSPVSARFGCDDRAVMGIWGLESGFGAHDGTYSVIDALATLAFD 153

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR+ FF  +   AL ++  G I+  A+ G+  G +GQ QF+P   ++YA D D DGK +
Sbjct: 154 GRRSAFFRNELMKALQILNDGDIAPAAMIGSYAGAMGQAQFMPSAYLRYAADGDGDGKRN 213

Query: 221 LVKSNIDAIASAAKFLAKLGW 241
           +  S  D  AS A +L K GW
Sbjct: 214 IWTSEADVFASIANYLGKCGW 234


>gi|163743807|ref|ZP_02151180.1| hypothetical protein RG210_08632 [Phaeobacter gallaeciensis 2.10]
 gi|161382956|gb|EDQ07352.1| hypothetical protein RG210_08632 [Phaeobacter gallaeciensis 2.10]
          Length = 358

 Score =  103 bits (256), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 62/194 (31%), Positives = 94/194 (48%), Gaps = 4/194 (2%)

Query: 50  RARAVREGMSPKTAKHLFADLEYLDTTIARDR-KMVTSPPVSFKDYLDGLSSSEIIAQGI 108
           +  A+  G    T    F ++      +  DR + V   P  F ++   L S   + +G 
Sbjct: 2   KEEALTGGYDSATVNRFFENVRQDPAVLKADRAQGVFQKP--FIEFSRRLISKSRLDRGQ 59

Query: 109 ALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFF 168
           A+ +        ++  YG+   +L+A W  ET +G   G    L+ L TLA+DCRR + F
Sbjct: 60  AMSRKYDATFRRIETTYGIDRSVLLAFWAFETDYGAVQGNFNTLNALVTLAHDCRRPELF 119

Query: 169 TEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNID 227
             Q F AL+L ++         GA  GEIG  Q LP ++++  +DAD DG + L  S  D
Sbjct: 120 RPQVFAALELFRQDNFDPRRTTGAWAGEIGMVQMLPSDILENGVDADGDGHVSLKTSAPD 179

Query: 228 AIASAAKFLAKLGW 241
           A+ S AK L+ LGW
Sbjct: 180 ALMSGAKMLSHLGW 193


>gi|56698058|ref|YP_168429.1| hypothetical protein SPO3226 [Ruegeria pomeroyi DSS-3]
 gi|56679795|gb|AAV96461.1| conserved hypothetical protein [Ruegeria pomeroyi DSS-3]
          Length = 387

 Score =  102 bits (255), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 71/231 (30%), Positives = 104/231 (45%), Gaps = 9/231 (3%)

Query: 13  MMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEY 72
           M + P +  A+     A +Q  C      F  +    +A AV  G         F     
Sbjct: 1   MRILPQIMAAIVLASPALSQ--CGGG---FSSFVDGLKAEAVSMGHDAALVDRFFQGAAQ 55

Query: 73  LDTTIARDR-KMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGI 131
               +  DR + V   P  F ++   L S   +  G A+ +    +   ++ EYGV  G+
Sbjct: 56  DAKVLKADRAQGVFQKP--FVEFSRRLISQNRLDTGKAMGRKYDAVFDRIEAEYGVSRGV 113

Query: 132 LMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALG 190
           L+A W  ET FG   G     + L TLA+DCRR + F  Q F A++L   G    +   G
Sbjct: 114 LLAFWAFETDFGGFQGDFNTRNALITLAHDCRRPELFRPQIFAAIELYSHGDFDPARTTG 173

Query: 191 ATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
           A  GEIG  Q LP ++++  +D D DG + L  S  DA+ S A+ L+ LGW
Sbjct: 174 AWAGEIGMVQMLPRDILENGVDGDGDGHVTLKTSAPDALMSGARMLSHLGW 224


>gi|15889403|ref|NP_355084.1| lytic murein transglycosylase [Agrobacterium tumefaciens str. C58]
 gi|15157257|gb|AAK87869.1| lytic murein transglycosylase [Agrobacterium tumefaciens str. C58]
          Length = 408

 Score =  102 bits (255), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 83/304 (27%), Positives = 124/304 (40%), Gaps = 69/304 (22%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
            G +    +A AV +G+     +   A  +     ++RDR       V  + +L+   S 
Sbjct: 44  LGAFLEGVKAEAVAKGVPAAAIEKALAGAQIDPKVLSRDRAQG----VFRQTFLE--FSQ 97

Query: 102 EIIAQG---IALKKAN--SRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLA 156
             ++Q    I  KK    S      + E+GVP G++ A W +ET FG   G     + L 
Sbjct: 98  RTVSQARLDIGRKKLQELSSTFARAENEFGVPAGVIAAFWAMETDFGAVQGDFNTRNALV 157

Query: 157 TLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADE 215
           TL++DCRR + F  Q    +++V+ G +  +   GA  GEIGQ Q LP +++ + +D D 
Sbjct: 158 TLSHDCRRPELFRPQLLALIEMVQHGDLDPATNTGAWAGEIGQVQMLPKDIIAFGVDGDG 217

Query: 216 DGKIDLVKSNIDAIASAAKFLAKLG------------------WTKCA------------ 245
           +G I++  S  DAI +AAKF+  LG                  W K              
Sbjct: 218 NGHINVKDSAPDAILTAAKFIQHLGFKKGEPWMQEVSVPENLPWEKSGLGGSLTAGDWFA 277

Query: 246 -GYQP--GEKNFAILK------------------------HWNASLNYNKTIAYIAAHID 278
            G  P  G KNFA L                          WN S  Y  + AY A  + 
Sbjct: 278 LGVTPRDGNKNFASLPAALIMPQGRKGPTFITYPNFNIYLEWNQSFIYTTSAAYFANRLM 337

Query: 279 GVPI 282
           G P+
Sbjct: 338 GAPV 341


>gi|315634108|ref|ZP_07889397.1| lytic transglycosylase [Aggregatibacter segnis ATCC 33393]
 gi|315477358|gb|EFU68101.1| lytic transglycosylase [Aggregatibacter segnis ATCC 33393]
          Length = 373

 Score =  102 bits (255), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 65/217 (29%), Positives = 108/217 (49%), Gaps = 12/217 (5%)

Query: 38  TADRFGEWKSAARARAVREGMS------PKTAKHLFADLEYLDTTIARDRKM-VTSPPV- 89
           T + F ++ +  + +A  EG+S           ++   ++  D    R RK    +PPV 
Sbjct: 50  TLENFNDYVNFLKGKAAAEGVSVEVLNAQNNINYIPKSVDLDDQQAGRIRKRDPNAPPVI 109

Query: 90  ---SFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETM 146
                 +YL+ + +   +    A        L    + +GVP   LMALWG+E+ FG   
Sbjct: 110 NPNGTTNYLNRVLTENKVETASARYWEQLPQLEKASQTFGVPKNYLMALWGMESSFGYYQ 169

Query: 147 GKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHA-LGATFGEIGQFQFLPVN 205
           G   +LS LATLA+D RR   F+++F  A+ ++++  I  H  LG+  G +GQ QF+P +
Sbjct: 170 GSYDVLSVLATLAFDGRREALFSKEFIAAMKMLQRDHIQRHKMLGSWAGAMGQTQFMPSS 229

Query: 206 VVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWT 242
            ++YA D + DG+ ++   + D  AS A +L   GW 
Sbjct: 230 YLRYAADGNGDGEKNIWTEHYDVFASIANYLHTEGWN 266


>gi|163844269|ref|YP_001621924.1| lytic murein transglycosylase [Brucella suis ATCC 23445]
 gi|163674992|gb|ABY39102.1| lytic murein transglycosylase [Brucella suis ATCC 23445]
          Length = 408

 Score =  102 bits (255), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 66/219 (30%), Positives = 111/219 (50%), Gaps = 18/219 (8%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTI---ARDRKMVTSPPVSFKDYLDGL 98
           F +W +  R  A++ G++P T    F  +   D  +   AR +   T P     +Y+D  
Sbjct: 40  FRQWIANFRPVAIKSGIAPSTFDRAFRGVNEPDPVVLEKARYQPEFTEP---VWNYIDNR 96

Query: 99  SSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLS----T 154
            + + +A G  + +   + L  ++  Y V   IL+A+W +E+++GE + +  ++     +
Sbjct: 97  VNEQSVAVGQNMARKWGQWLQRIEHHYSVDRHILLAIWSMESNYGEILKRDDVMRDAIRS 156

Query: 155 LATLAY-DCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAID 212
           LATLAY D RRAK+   Q   A+ +++ G I   H  G+  G +G  QF+P +   Y +D
Sbjct: 157 LATLAYADARRAKYGRTQLIAAMKILQTGDIERGHLSGSWAGALGHTQFIPTSYQAYTVD 216

Query: 213 ADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGE 251
            D +GK D+  S  DA+ +AA  L + GW      QPG 
Sbjct: 217 MDGNGKRDIWNSVPDALGTAANLLHRNGW------QPGR 249


>gi|329113405|ref|ZP_08242186.1| Membrane-bound lytic murein transglycosylase B [Acetobacter pomorum
           DM001]
 gi|326697230|gb|EGE48890.1| Membrane-bound lytic murein transglycosylase B [Acetobacter pomorum
           DM001]
          Length = 331

 Score =  102 bits (255), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 66/232 (28%), Positives = 112/232 (48%), Gaps = 11/232 (4%)

Query: 13  MMVYPMLAQ--AVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADL 70
           +   P+LA+  A T P  A +          +  + +  R  A+ +G+S        A  
Sbjct: 14  LFATPVLARTTAATTPHPAAS--------SSYATFLAGVRREAIGQGISASVVDQALALT 65

Query: 71  EYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPG 130
              +  + +  +      +++  Y D + + + I+ G+A     + LL  +   YGV  G
Sbjct: 66  TQPNAKVLKADRHQPEFTLTWAQYKDRILTEKKISDGLAAVGQRTALLNRISSTYGVNKG 125

Query: 131 ILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHAL 189
            +  +WGLE+ +G  MG   ++  LATLAYD RR+ FF  +   AL ++ +G I+ +  L
Sbjct: 126 AIAGIWGLESAYGTRMGTFHVIDALATLAYDGRRSAFFRSELMKALSILGQGDITPAGML 185

Query: 190 GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
           G+  G +GQ QF+P   ++YA    E G+ D+  +  D  AS A +LAK  W
Sbjct: 186 GSYAGAMGQPQFMPSAYLRYAASYPEGGRRDIWHNEADVFASIANYLAKCHW 237


>gi|153011588|ref|YP_001372802.1| lytic murein transglycosylase [Ochrobactrum anthropi ATCC 49188]
 gi|151563476|gb|ABS16973.1| lytic murein transglycosylase [Ochrobactrum anthropi ATCC 49188]
          Length = 412

 Score =  102 bits (254), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 71/233 (30%), Positives = 119/233 (51%), Gaps = 19/233 (8%)

Query: 29  ATTQFICSDTAD-RFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTI---ARDRKMV 84
           A+T    S  AD +F +W ++ R  A+  G+SP T    F  ++  D  +   AR +   
Sbjct: 26  ASTLTTGSALADAKFRQWVASFRPVAINAGVSPSTFDRAFRGVDAPDPVVLQKARYQPEF 85

Query: 85  TSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGE 144
           T P     +Y+D   +   ++ G  + +     L  +++ + V   IL+A+W +E+++GE
Sbjct: 86  TEP---VWNYVDNRVNEHSVSVGQNMARKWGPWLQRIEQRFSVDRNILLAIWSMESNYGE 142

Query: 145 TMGKTPLLS----TLATLAY-DCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQ 198
            + +  ++     +LATLAY D RRAK+   Q   A+ +++ G I   H  G+  G +G 
Sbjct: 143 ILKRDDVMRDAVRSLATLAYADQRRAKYGRTQLIAAMKILQTGDIDRGHLSGSWAGALGH 202

Query: 199 FQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGE 251
            QF+P +   YA+D D +GK D+  S  DA+ +AA  L + GW      QPG 
Sbjct: 203 TQFIPTSYQAYAVDMDGNGKRDIWNSIPDALGTAANLLHRNGW------QPGR 249


>gi|75677138|ref|YP_319559.1| lytic murein transglycosylase [Nitrobacter winogradskyi Nb-255]
 gi|74422008|gb|ABA06207.1| lytic murein transglycosylase [Nitrobacter winogradskyi Nb-255]
          Length = 470

 Score =  102 bits (254), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 73/221 (33%), Positives = 109/221 (49%), Gaps = 18/221 (8%)

Query: 45  WKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFK---DYLDGLSSS 101
           W  AAR    RE     TA  L  DL  +D        ++ S P   K   DYLD L   
Sbjct: 108 WPDAARRHITRENFERFTA-GLSPDLRIMD--------LMDSQPEFTKAIWDYLDILVKD 158

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             +A+G  +          ++K YGV    + A+WG+E+++   MG   +L + ATLA  
Sbjct: 159 ARLARGREILATYKPQFDAVEKAYGVDRYAIAAIWGIESNYSTQMGDRSVLQSTATLACV 218

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR K+F ++F  AL+++ +G +    L G+  G  G  QF+P    +YA+D D DG+ D
Sbjct: 219 GRRQKYFRDEFLAALEILNRGDLRPEQLRGSWAGAFGPTQFMPTAFKRYAVDGDGDGRRD 278

Query: 221 LVKSNIDAIASAAKFLAKLGWT--KCAGYQ---PGEKNFAI 256
           +V +  D IAS A  L K GW   +  GY+   P + N+ +
Sbjct: 279 VVDNPADLIASTANNLKKDGWQTGRTWGYEVVVPNDFNYML 319


>gi|163738213|ref|ZP_02145629.1| Lytic murein transglycosylase [Phaeobacter gallaeciensis BS107]
 gi|161388829|gb|EDQ13182.1| Lytic murein transglycosylase [Phaeobacter gallaeciensis BS107]
          Length = 390

 Score =  102 bits (254), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 62/194 (31%), Positives = 94/194 (48%), Gaps = 4/194 (2%)

Query: 50  RARAVREGMSPKTAKHLFADLEYLDTTIARDR-KMVTSPPVSFKDYLDGLSSSEIIAQGI 108
           +  A+  G    T    F ++      +  DR + V   P  F ++   L S   + +G 
Sbjct: 34  KEEALTGGYDSATVNRFFENVRQDPAVLKADRAQGVFQKP--FIEFSRRLISKSRLDRGQ 91

Query: 109 ALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFF 168
           A+ +        ++  YG+   +L+A W  ET +G   G    L+ L TLA+DCRR + F
Sbjct: 92  AMSRKYDATFRRIETTYGIDRSVLLAFWAFETDYGAVQGNFNTLNALVTLAHDCRRPELF 151

Query: 169 TEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNID 227
             Q F AL+L ++         GA  GEIG  Q LP ++++  +DAD DG + L  S  D
Sbjct: 152 RPQVFAALELFRQDNFDPRRTTGAWAGEIGMVQMLPGDILENGVDADGDGHVSLKTSAPD 211

Query: 228 AIASAAKFLAKLGW 241
           A+ S AK L+ LGW
Sbjct: 212 ALMSGAKMLSHLGW 225


>gi|284006965|emb|CBA72238.1| lipoprotein [Arsenophonus nasoniae]
          Length = 266

 Score =  102 bits (254), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 52/155 (33%), Positives = 86/155 (55%), Gaps = 2/155 (1%)

Query: 89  VSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGK 148
           V+ ++YL  +  S  I+  +     N   L    K +G+P   ++ALWGLE+ FG+  G+
Sbjct: 14  VNLENYLQKVLPSSRISMAVQQYHNNKHQLDITSKRFGIPVQYIVALWGLESKFGQIQGQ 73

Query: 149 TPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL--GATFGEIGQFQFLPVNV 206
             ++  L TL++D RR +FF++Q   AL ++  G +  +    G+  G +GQ QF+P + 
Sbjct: 74  EDVIFALVTLSFDGRRERFFSKQLMAALKIMDNGYVPKNRRLKGSWAGAMGQTQFMPASF 133

Query: 207 VKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
           + YAID   +G+ID+  +  D  AS A +L   GW
Sbjct: 134 LLYAIDGSGNGQIDIWHNKADVFASIANYLKYEGW 168


>gi|225685937|ref|YP_002733909.1| lytic murein transglycosylase [Brucella melitensis ATCC 23457]
 gi|256261850|ref|ZP_05464382.1| lytic Murein transglycosylase [Brucella melitensis bv. 2 str. 63/9]
 gi|225642042|gb|ACO01955.1| lytic murein transglycosylase [Brucella melitensis ATCC 23457]
 gi|263091326|gb|EEZ15862.1| lytic Murein transglycosylase [Brucella melitensis bv. 2 str. 63/9]
 gi|326410256|gb|ADZ67320.1| lytic murein transglycosylase [Brucella melitensis M28]
 gi|326553549|gb|ADZ88188.1| lytic murein transglycosylase [Brucella melitensis M5-90]
          Length = 412

 Score =  102 bits (254), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 66/219 (30%), Positives = 111/219 (50%), Gaps = 18/219 (8%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTI---ARDRKMVTSPPVSFKDYLDGL 98
           F +W +  R  A++ G++P T    F  +   D  +   AR +   T P     +Y+D  
Sbjct: 40  FRQWIANFRPVAIKSGIAPSTFDRAFRGVNEPDPVVLEKARYQPEFTEP---VWNYIDNR 96

Query: 99  SSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLS----T 154
            + + +A G  + +   + L  ++  Y V   IL+A+W +E+++GE + +  ++     +
Sbjct: 97  VNEQSVAVGQNMARKWGQWLQRIEHHYSVDRHILLAIWSMESNYGEILKRDDVMRDAIRS 156

Query: 155 LATLAY-DCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAID 212
           LAT AY D RRAK+   Q   A+ +++ G I   H  G+  G +G  QF+P +   YA+D
Sbjct: 157 LATFAYADARRAKYGRTQLIAAMKILQTGDIERGHLSGSWAGALGHTQFIPTSYQAYAVD 216

Query: 213 ADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGE 251
            D +GK D+  S  DA+ +AA  L + GW      QPG 
Sbjct: 217 MDGNGKRDIWNSVPDALGTAANLLHRNGW------QPGR 249


>gi|167644837|ref|YP_001682500.1| lytic murein transglycosylase [Caulobacter sp. K31]
 gi|167347267|gb|ABZ70002.1| lytic murein transglycosylase [Caulobacter sp. K31]
          Length = 429

 Score =  102 bits (254), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 60/168 (35%), Positives = 94/168 (55%), Gaps = 4/168 (2%)

Query: 81  RKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLET 140
           R+   S PV   DY+ G+ S + +A G   K+     L  ++  YGVP  IL+A+W +E+
Sbjct: 96  RQPEFSKPVG--DYIRGVISDDRVAVGRD-KRQTLTFLPEVESRYGVPRDILLAVWAMES 152

Query: 141 HFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQF 199
            FG+  G   ++ ++A+LA D RR  +   +   AL ++  G ++   L G+  G +GQ 
Sbjct: 153 AFGKLQGNFDVVRSMASLAADGRRRTWAEGELIAALKIIASGEVTRMQLKGSWAGAMGQT 212

Query: 200 QFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGY 247
           QFLP N +  A+D D DG+ D+  S+ D++ASAA  L K GW    G+
Sbjct: 213 QFLPSNYLTTAVDNDGDGRRDIWGSDSDSLASAANLLKKGGWKPGVGW 260


>gi|83941887|ref|ZP_00954349.1| peptidoglycan binding domain protein [Sulfitobacter sp. EE-36]
 gi|83847707|gb|EAP85582.1| peptidoglycan binding domain protein [Sulfitobacter sp. EE-36]
          Length = 419

 Score =  102 bits (254), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 66/202 (32%), Positives = 99/202 (49%), Gaps = 3/202 (1%)

Query: 44  EWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEI 103
           +W +A RARA+  G+           + Y    I RDR         +  YL+  +S   
Sbjct: 49  DWVTAFRARALAAGIDGAVFDRAMQTVRYDPQVIRRDRNQSEFTKTIWA-YLETATSDLR 107

Query: 104 IAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCR 163
           +  G       +  L  ++  YGV   I+ A+WGLE+ +G   G  P+LS+LATLAYD R
Sbjct: 108 VTNGKKALAEQADALSQIETRYGVEKEIVTAIWGLESAYGTFRGSDPVLSSLATLAYDGR 167

Query: 164 RAKFFTEQFFYALDLVKKG-VISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLV 222
           R  FF  +   AL +++ G    +   G+  G +G  QF+P +  +YA D   DGK D+ 
Sbjct: 168 RRAFFEGELLDALRILQAGDTTPARMQGSWAGAMGHTQFMPSSFQQYAEDFTGDGKRDIW 227

Query: 223 KSNI-DAIASAAKFLAKLGWTK 243
             +  DA+AS A +L   GW +
Sbjct: 228 SDDPRDALASTAAYLKHFGWVQ 249


>gi|207724810|ref|YP_002255207.1| membrane-bound lytic murein transglycosylase b protein [Ralstonia
           solanacearum MolK2]
 gi|206590035|emb|CAQ36996.1| membrane-bound lytic murein transglycosylase b protein [Ralstonia
           solanacearum MolK2]
          Length = 390

 Score =  102 bits (254), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 68/205 (33%), Positives = 109/205 (53%), Gaps = 6/205 (2%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVS--FKDYLDGLS 99
           F  W  + R +A+  G+S  T    F  +      +A D++    P  +    DYLD   
Sbjct: 19  FDAWVKSFRPKAMDAGISSSTFDAAFKQVTPDPEVVALDQRQ---PEFTTYIWDYLDKQI 75

Query: 100 SSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLA 159
           ++E + QG +L  +N  L   L+++YGV   +L A+WG+E+ +G  +GK  ++ +LATLA
Sbjct: 76  TAERVQQGQSLLTSNDALFQRLERDYGVDRHVLTAIWGIESQYGSEIGKRYVIRSLATLA 135

Query: 160 YDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGK 218
            D RR  +   Q   AL +++   +    L G+  G +GQ QF+P   + YA D D D K
Sbjct: 136 NDGRRKTYAENQLLAALQMLQNDRVPREQLVGSWAGAMGQTQFIPTTYLAYAADGDGDQK 195

Query: 219 IDLVKSNIDAIASAAKFLAKLGWTK 243
            D+  S+ DA+ASAA +L +  W +
Sbjct: 196 RDIWNSSADALASAANYLKEANWQR 220


>gi|218516104|ref|ZP_03512944.1| putative membrane-bound lytic murein transglycosylase protein
           [Rhizobium etli 8C-3]
          Length = 162

 Score =  102 bits (254), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 78/135 (57%), Gaps = 1/135 (0%)

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDY 94
           C +T+  F  W +  +  A   G+S       FA++ Y   TIA DR    S  +SF  +
Sbjct: 29  CGNTSAGFDAWVADFKQTAAANGVSQSVLSRAFANVNYNKPTIAADRGQ-KSFKLSFDAF 87

Query: 95  LDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLST 154
           +     + +I++G ++K AN  L  ++++ +GVP G L+A+WG+ET FG  MG    LS 
Sbjct: 88  MQKRGGAAVISRGRSMKAANQALFASIERRFGVPAGPLIAIWGMETGFGSYMGNQHTLSA 147

Query: 155 LATLAYDCRRAKFFT 169
           ++TLAYDCRR+ +FT
Sbjct: 148 VSTLAYDCRRSDYFT 162


>gi|222087083|ref|YP_002545618.1| membrane-bound lytic murein transglycosylase protein [Agrobacterium
           radiobacter K84]
 gi|221724531|gb|ACM27687.1| membrane-bound lytic murein transglycosylase protein [Agrobacterium
           radiobacter K84]
          Length = 407

 Score =  102 bits (253), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 76/261 (29%), Positives = 126/261 (48%), Gaps = 13/261 (4%)

Query: 34  ICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKD 93
           I ++    F +W +   + A + G++  T ++ FA +   D T+    +          D
Sbjct: 27  INANADPGFQKWIAGFYSTAAKSGITQSTYRNAFAGVTDPDPTVLEKAQYQPEFKSQIWD 86

Query: 94  YLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL- 152
           YLD   +   +  G  +       L +L++ +GV   I++A+W +E+++G  + K   L 
Sbjct: 87  YLDSRVNPYTVDVGRKMATKYGSTLRSLEQHFGVDRNIMLAIWSMESNYGAVLAKEEKLH 146

Query: 153 ---STLATLAY-DCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVV 207
                LATLAY D +RA +  +Q   AL +++ G IS   L G+  G +G  QF+P + +
Sbjct: 147 YVPRALATLAYADPKRANYAKKQLIAALKILQNGDISRKELTGSWAGAMGHTQFIPTSYL 206

Query: 208 KYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWT--KCAGYQPGEKNFAILKHWNASLN 265
            YA+DAD  G  D+  S  DA+A+ A  LAK GW+     GY+       +    +A   
Sbjct: 207 LYAVDADGSGHADIWNSIPDALATTANLLAKNGWSTGHTWGYE-----VTVPPGGSAQTG 261

Query: 266 YNKTIAYIAAHIDGVPIGKGY 286
             +T+A  AA     P GKG+
Sbjct: 262 KTRTLAQWAALGFARPSGKGF 282


>gi|83745679|ref|ZP_00942737.1| Membrane-bound lytic murein transglycosylase B [Ralstonia
           solanacearum UW551]
 gi|83727756|gb|EAP74876.1| Membrane-bound lytic murein transglycosylase B [Ralstonia
           solanacearum UW551]
          Length = 427

 Score =  102 bits (253), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 68/205 (33%), Positives = 109/205 (53%), Gaps = 6/205 (2%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVS--FKDYLDGLS 99
           F  W  + R +A+  G+S  T    F  +      +A D++    P  +    DYLD   
Sbjct: 56  FDAWVKSFRPKAMDAGISSSTFDAAFKQVTPDPEVVALDQRQ---PEFTTYIWDYLDKQI 112

Query: 100 SSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLA 159
           ++E + QG +L  +N  L   L+++YGV   +L A+WG+E+ +G  +GK  ++ +LATLA
Sbjct: 113 TAERVQQGQSLLTSNDALFQRLERDYGVDRHVLTAIWGIESQYGSEIGKRYVIRSLATLA 172

Query: 160 YDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGK 218
            D RR  +   Q   AL +++   +    L G+  G +GQ QF+P   + YA D D D K
Sbjct: 173 NDGRRKTYAENQLLAALQMLQNDRVPREQLVGSWAGAMGQTQFIPTTYLAYAADGDGDQK 232

Query: 219 IDLVKSNIDAIASAAKFLAKLGWTK 243
            D+  S+ DA+ASAA +L +  W +
Sbjct: 233 RDIWNSSADALASAANYLKEANWQR 257


>gi|307946570|ref|ZP_07661905.1| lytic murein transglycosylase [Roseibium sp. TrichSKD4]
 gi|307770234|gb|EFO29460.1| lytic murein transglycosylase [Roseibium sp. TrichSKD4]
          Length = 401

 Score =  102 bits (253), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 70/231 (30%), Positives = 109/231 (47%), Gaps = 17/231 (7%)

Query: 22  AVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDR 81
           A++QP  A    + S             + +A+  G+ P  A+++ A   Y D  + R  
Sbjct: 24  ALSQPASAIENCVAS------------LKKQAIASGVKPSVAENMLAKATY-DKKVVRFS 70

Query: 82  KMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETH 141
           K          DY+  L   + I  G A  K +   L +++K YGV   +++A+WG+E+ 
Sbjct: 71  KSQPEYKTPIWDYMAFLVDPKRIEDGKARLKQHRSTLSSIEKRYGVSGNVVVAVWGIESD 130

Query: 142 FGETMGKTPLLSTLATL-AYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQF 199
           FG+  G       LA L     RR+K+F  +    L +  +G + +    G+  G  GQ 
Sbjct: 131 FGQFRGDFYTPHALANLVCAGGRRSKYFRGELIKTLQIASRGDVPARDFRGSWAGAFGQT 190

Query: 200 QFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW--TKCAGYQ 248
           QF+P    K A+D D DG+ DLV S  DA+AS A FL   GW  ++  GY+
Sbjct: 191 QFMPTTYTKLAVDHDRDGRKDLVNSVPDALASTANFLKDAGWRNSRPWGYE 241


>gi|258542236|ref|YP_003187669.1| lytic murein transglycosylase B [Acetobacter pasteurianus IFO
           3283-01]
 gi|256633314|dbj|BAH99289.1| lytic murein transglycosylase B [Acetobacter pasteurianus IFO
           3283-01]
 gi|256636373|dbj|BAI02342.1| lytic murein transglycosylase B [Acetobacter pasteurianus IFO
           3283-03]
 gi|256639426|dbj|BAI05388.1| lytic murein transglycosylase B [Acetobacter pasteurianus IFO
           3283-07]
 gi|256642482|dbj|BAI08437.1| lytic murein transglycosylase B [Acetobacter pasteurianus IFO
           3283-22]
 gi|256645537|dbj|BAI11485.1| lytic murein transglycosylase B [Acetobacter pasteurianus IFO
           3283-26]
 gi|256648590|dbj|BAI14531.1| lytic murein transglycosylase B [Acetobacter pasteurianus IFO
           3283-32]
 gi|256651643|dbj|BAI17577.1| lytic murein transglycosylase B [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256654634|dbj|BAI20561.1| lytic murein transglycosylase B [Acetobacter pasteurianus IFO
           3283-12]
          Length = 331

 Score =  102 bits (253), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 66/232 (28%), Positives = 112/232 (48%), Gaps = 11/232 (4%)

Query: 13  MMVYPMLAQ--AVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADL 70
           +   P+LA+  A T P  A +          +  + +  R  A+ +G+S        A  
Sbjct: 14  LFATPVLARTTAATTPHPAAS--------SSYATFLAGVRREAIGQGISASVVDQALALT 65

Query: 71  EYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPG 130
              +  + +  +      +++  Y D + + + I+ G+A     + LL  +   YGV  G
Sbjct: 66  TQPNAKVLKADRHQPEFTLTWAQYKDRVLTEKKISDGLAAVGQRAALLNRISSTYGVDKG 125

Query: 131 ILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHAL 189
            +  +WGLE+ +G  MG   ++  LATLAYD RR+ FF  +   AL ++ +G I+ +  L
Sbjct: 126 AIAGIWGLESAYGTRMGTFHVIDALATLAYDGRRSAFFRSELMKALSILGQGDITPAGML 185

Query: 190 GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
           G+  G +GQ QF+P   ++YA    E G+ D+  +  D  AS A +LAK  W
Sbjct: 186 GSYAGAMGQPQFMPSAYLRYAASYPEGGRRDIWHNEADVFASIANYLAKCHW 237


>gi|83855364|ref|ZP_00948894.1| peptidoglycan binding domain protein [Sulfitobacter sp. NAS-14.1]
 gi|83843207|gb|EAP82374.1| peptidoglycan binding domain protein [Sulfitobacter sp. NAS-14.1]
          Length = 426

 Score =  102 bits (253), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 66/202 (32%), Positives = 99/202 (49%), Gaps = 3/202 (1%)

Query: 44  EWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEI 103
           +W +A RARA+  G+           + Y    I RDR         +  YL+  +S   
Sbjct: 56  DWVTAFRARALAAGIDGAVFDRAMQTVRYDPQVIRRDRNQSEFTKTIWA-YLETATSDLR 114

Query: 104 IAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCR 163
           +  G       +  L  ++  YGV   I+ A+WGLE+ +G   G  P+LS+LATLAYD R
Sbjct: 115 VTNGKKALAEQADALSQIETRYGVEKEIVTAIWGLESAYGTFRGSDPVLSSLATLAYDGR 174

Query: 164 RAKFFTEQFFYALDLVKKG-VISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLV 222
           R  FF  +   AL +++ G    +   G+  G +G  QF+P +  +YA D   DGK D+ 
Sbjct: 175 RRAFFEGELLDALRILQAGDTTPARMQGSWAGAMGHTQFMPSSFQQYAEDFTGDGKRDIW 234

Query: 223 KSNI-DAIASAAKFLAKLGWTK 243
             +  DA+AS A +L   GW +
Sbjct: 235 SDDPRDALASTAAYLKHFGWVQ 256


>gi|332969801|gb|EGK08812.1| type III effector HopAJ2 [Psychrobacter sp. 1501(2011)]
          Length = 466

 Score =  102 bits (253), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 90/160 (56%), Gaps = 7/160 (4%)

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
           DYL  L   E +  GI   +  + +L  ++ EYGV    ++ +WG+E+ FG  +GK  ++
Sbjct: 72  DYLASLVDEERVIDGINASEKYADILARIESEYGVNRYDVLGVWGVESDFGTKLGKKDVV 131

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAI 211
            +LATL+   RR  +F  ++  AL ++K+G I+     G+  G  GQ QF+P   ++ A 
Sbjct: 132 DSLATLSCFGRRQSYFRGEYVSALKILKQGDIAKADFKGSWAGAFGQTQFMPSTFLQLAQ 191

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGE 251
           D D DG+ DLV S  DA+AS A FL      K +GY+P +
Sbjct: 192 DFDGDGRKDLVNSQADALASTANFL------KNSGYKPNQ 225


>gi|95108222|emb|CAD18391.2| putative membrane-bound lytic murein transglycosylase b protein
           [Ralstonia solanacearum GMI1000]
          Length = 427

 Score =  102 bits (253), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 69/209 (33%), Positives = 109/209 (52%), Gaps = 2/209 (0%)

Query: 36  SDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYL 95
           S T   F  W +  R +A+  G+   T    F  +      +  DR+       +  DYL
Sbjct: 50  SGTDATFDAWVTGFRQKAIDAGIPAGTFDSAFKQVTPDPEVVELDRQQPEFT-TAIWDYL 108

Query: 96  DGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTL 155
           D   ++E I QG +L   +  +   L+++YGV   IL A+W +E+ +G  +GK  ++ +L
Sbjct: 109 DKRITAERIQQGQSLLGMHDAMFQRLERDYGVDRHILTAIWAIESQYGSEIGKRYIIRSL 168

Query: 156 ATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDAD 214
           ATLA D RR  +   Q   +L +++K  I    L G+  G +GQ QF+P   + YA+D D
Sbjct: 169 ATLANDGRRKTYAENQLLASLQILQKDRIPREQLVGSWAGAMGQTQFIPTTYLAYAVDGD 228

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTK 243
            D K D+  S+ DA+ASAA +L + GW +
Sbjct: 229 GDQKRDIWNSSADALASAANYLKEAGWQR 257


>gi|85715994|ref|ZP_01046971.1| lytic murein transglycosylase [Nitrobacter sp. Nb-311A]
 gi|85697192|gb|EAQ35073.1| lytic murein transglycosylase [Nitrobacter sp. Nb-311A]
          Length = 420

 Score =  102 bits (253), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 59/159 (37%), Positives = 87/159 (54%), Gaps = 7/159 (4%)

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
           DYL   S + + A+G  L + N   L  +++ +GVP  I++A+WG ET +G        L
Sbjct: 97  DYLKESSIARLAAEGQRLMRKNQSTLNEIERRFGVPATIILAIWGRETDYGRYTLPYDAL 156

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATF-GEIGQFQFLPVNVVKYAI 211
             LAT AY  RR   + ++F   L L+++G +S     A++ G  G  QFLP  + K+ +
Sbjct: 157 RVLATQAYVGRRKDQYRKEFIEGLLLLQRGAVSRKNFRASWGGATGLTQFLPSELAKHGV 216

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPG 250
           D D DG+ID+  S  DA+ASAA+ L   GW      QPG
Sbjct: 217 DFDGDGRIDIWSSVPDALASAAQQLVNKGW------QPG 249


>gi|209886161|ref|YP_002290018.1| lytic murein transglycosylase [Oligotropha carboxidovorans OM5]
 gi|209874357|gb|ACI94153.1| lytic murein transglycosylase [Oligotropha carboxidovorans OM5]
          Length = 400

 Score =  102 bits (253), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 72/218 (33%), Positives = 108/218 (49%), Gaps = 13/218 (5%)

Query: 31  TQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVS 90
           TQFI S        W  AA+A   R   + +T   L  D +  D  +    K        
Sbjct: 20  TQFISS-------LWPEAAKAGVSRAVFARETGG-LEPDYKLPDLLLPGRPKTGAPSQAE 71

Query: 91  F----KDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETM 146
           F     DYL   S + + + G  L + ++  L  +++ +GVP  I++A+WG ET FG   
Sbjct: 72  FVQVPADYLREASIARLASHGRTLMQQHAATLRAIEQRFGVPGPIILAIWGRETDFGRHR 131

Query: 147 GKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATF-GEIGQFQFLPVN 205
                +  LAT AY  RR + +  +   AL L++ GV++   L A++ G +G  QFLP  
Sbjct: 132 LPYDAVRVLATQAYVGRRKEQYRGELIAALQLLQSGVVTRKDLRASWGGAVGLTQFLPSE 191

Query: 206 VVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTK 243
           V K+ +D D DG++DL  S  DA+ASAA+ L   GW +
Sbjct: 192 VTKHGVDFDGDGRVDLWHSVPDALASAAQQLVNKGWQR 229


>gi|220920095|ref|YP_002495396.1| lytic murein transglycosylase [Methylobacterium nodulans ORS 2060]
 gi|219944701|gb|ACL55093.1| lytic murein transglycosylase [Methylobacterium nodulans ORS 2060]
          Length = 398

 Score =  102 bits (253), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 75/235 (31%), Positives = 112/235 (47%), Gaps = 25/235 (10%)

Query: 53  AVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFK----DYLDGLSSSEIIAQGI 108
           A   G+SP T +   A + Y D  I    ++  + P  FK    DY+  L   E +  G 
Sbjct: 39  AAAHGISPSTFQSATAGIVYDDKVI----ELSQAQP-EFKTPIWDYIAALVDEERVEDGR 93

Query: 109 ALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDC-RRAKF 167
           A  +  +  L   +  + V    + A+WG+E++FG+ +GK PL+ +LATLA    RRA F
Sbjct: 94  AAMRQYASALAQAEARFNVDRYTIAAVWGVESNFGKNLGKMPLVQSLATLACSSNRRAGF 153

Query: 168 FTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNI 226
           F  +    L ++ +G I +  L G+  G  GQ QF+P    + A+D D DG+ D+V S  
Sbjct: 154 FKGELMATLKIIDRGDIEASRLTGSWAGAFGQTQFMPSTYQRLAVDLDGDGRRDVVDSVA 213

Query: 227 DAIASAAKFLAKLGWTKCA--GYQ-----------PGEKNFAILKHWNASLNYNK 268
           DA+ S A FL    W      GY+            G K+   + HW ASL   +
Sbjct: 214 DAVGSTANFLRVAKWQNGLPWGYEVRLPRGFNLAAAGRKSKRPVSHW-ASLGVTR 267


>gi|300697764|ref|YP_003748425.1| membrane-bound lytic murein transglycosylase b protein [Ralstonia
           solanacearum CFBP2957]
 gi|299074488|emb|CBJ54039.1| membrane-bound lytic murein transglycosylase b protein [Ralstonia
           solanacearum CFBP2957]
          Length = 390

 Score =  102 bits (253), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 67/205 (32%), Positives = 109/205 (53%), Gaps = 6/205 (2%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVS--FKDYLDGLS 99
           F  W  + R +A+  G+   T    F  +      +A D++    P  +    DYLD   
Sbjct: 19  FDAWVKSFRPKAMDAGIGSSTFDAAFKQVTPDPEVVALDQRQ---PEFTTYIWDYLDKQI 75

Query: 100 SSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLA 159
           ++E + QG +L ++N  L   L+++YGV   +L A+WG+E+ +G  +GK  ++ +LATLA
Sbjct: 76  TAERVQQGQSLLRSNDALFQRLERDYGVDRHVLTAIWGIESQYGSEIGKRYVIRSLATLA 135

Query: 160 YDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGK 218
            D RR  +   Q   AL +++   +    L G+  G +GQ QF+P   + YA D D D K
Sbjct: 136 NDGRRKTYAENQLLAALQMLQNDRVPREQLVGSWAGAMGQTQFIPTTYLAYAADGDGDQK 195

Query: 219 IDLVKSNIDAIASAAKFLAKLGWTK 243
            D+  S+ DA+ASAA +L +  W +
Sbjct: 196 RDIWNSSADALASAANYLKEANWQR 220


>gi|207739480|ref|YP_002257873.1| membrane-bound lytic murein transglycosylase b protein [Ralstonia
           solanacearum IPO1609]
 gi|206592857|emb|CAQ59763.1| probable membrane-bound lytic murein transglycosylase b protein
           [Ralstonia solanacearum IPO1609]
          Length = 342

 Score =  102 bits (253), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 68/205 (33%), Positives = 109/205 (53%), Gaps = 6/205 (2%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVS--FKDYLDGLS 99
           F  W  + R +A+  G+S  T    F  +      +A D++    P  +    DYLD   
Sbjct: 56  FDAWVKSFRPKAMDAGISSSTFDAAFKQVTPDPEVVALDQRQ---PEFTTYIWDYLDKQI 112

Query: 100 SSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLA 159
           ++E + QG +L  +N  L   L+++YGV   +L A+WG+E+ +G  +GK  ++ +LATLA
Sbjct: 113 TAERVQQGQSLLTSNDALFQRLERDYGVDRHVLTAIWGIESQYGSEIGKRYVIRSLATLA 172

Query: 160 YDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGK 218
            D RR  +   Q   AL +++   +    L G+  G +GQ QF+P   + YA D D D K
Sbjct: 173 NDGRRKTYAENQLLAALQMLQNDRVPREQLVGSWAGAMGQTQFIPTTYLAYAADGDGDQK 232

Query: 219 IDLVKSNIDAIASAAKFLAKLGWTK 243
            D+  S+ DA+ASAA +L +  W +
Sbjct: 233 RDIWNSSADALASAANYLKEANWQR 257


>gi|160875019|ref|YP_001554335.1| lytic murein transglycosylase [Shewanella baltica OS195]
 gi|160860541|gb|ABX49075.1| lytic murein transglycosylase [Shewanella baltica OS195]
 gi|315267251|gb|ADT94104.1| lytic murein transglycosylase [Shewanella baltica OS678]
          Length = 370

 Score =  102 bits (253), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 67/208 (32%), Positives = 99/208 (47%), Gaps = 2/208 (0%)

Query: 36  SDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYL 95
           SD    F ++    +  A  +G+S  T    F  ++      A D  + T    +   YL
Sbjct: 64  SDEKISFSDYLIQLKQEARLQGISQTTLDLAFPQIKLFKKARATD-SLQTEKTHNLDTYL 122

Query: 96  DGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTL 155
                   +     L K + + L  +  +Y V P  L+ALWGL + FGE  G  P+LS  
Sbjct: 123 ADTVPEWKVDTARVLFKEHEQQLNAIASQYSVQPRFLVALWGLVSDFGEASGDYPVLSVT 182

Query: 156 ATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATF-GEIGQFQFLPVNVVKYAIDAD 214
           A+LA+   R  FF ++F  AL ++ K  I   AL + + G +GQ Q +P + + Y  D D
Sbjct: 183 ASLAFSGEREAFFKKEFIAALSIMDKDHIGFQALKSRWNGAMGQTQLMPTDYLAYGQDGD 242

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWT 242
            DGK D+  +  DA ASAA  L +LGW 
Sbjct: 243 GDGKKDIWHNTQDAFASAAYLLQQLGWN 270


>gi|218708885|ref|YP_002416506.1| putative lytic murein transglycosylase [Vibrio splendidus LGP32]
 gi|218321904|emb|CAV17894.1| putative lytic murein transglycosylase [Vibrio splendidus LGP32]
          Length = 332

 Score =  101 bits (252), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 67/239 (28%), Positives = 117/239 (48%), Gaps = 14/239 (5%)

Query: 4   KKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTA 63
           K  L +S L++V  +   +V   + +  Q++           K   + RA  EG+S    
Sbjct: 6   KTILAVSALLLVNSLTIGSVQAEELSFEQYVE----------KLKQQGRA--EGISETII 53

Query: 64  KHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKK 123
              F  + +    +  D+       ++  +Y+        + Q  +L K +   L  +  
Sbjct: 54  DQAFDGVTFKPRAVKADKNQ-PEKKLTLDEYIPRAVPDWKVKQARSLYKKHYSALKRIGD 112

Query: 124 EYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGV 183
           EYGV P  ++ALWG+E++FG+  G   ++  L T+AY+ RR  FF  +   AL ++ +G 
Sbjct: 113 EYGVQPRFIVALWGVESNFGKFTGNYSVIDALTTMAYEGRREAFFRSEAMAALKILDQGH 172

Query: 184 ISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
           I+   + G+  G +GQ QF+P + + YA D + DGK D+  +  D  ASAA +L++ GW
Sbjct: 173 IAPQEMKGSWAGAMGQPQFMPSSFLAYAADGNGDGKKDIWGTEEDVFASAANYLSQSGW 231


>gi|17549461|ref|NP_522801.1| putative transglycosylase protein [Ralstonia solanacearum GMI1000]
          Length = 390

 Score =  101 bits (252), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 69/209 (33%), Positives = 109/209 (52%), Gaps = 2/209 (0%)

Query: 36  SDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYL 95
           S T   F  W +  R +A+  G+   T    F  +      +  DR+       +  DYL
Sbjct: 13  SGTDATFDAWVTGFRQKAIDAGIPAGTFDSAFKQVTPDPEVVELDRQQPEFT-TAIWDYL 71

Query: 96  DGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTL 155
           D   ++E I QG +L   +  +   L+++YGV   IL A+W +E+ +G  +GK  ++ +L
Sbjct: 72  DKRITAERIQQGQSLLGMHDAMFQRLERDYGVDRHILTAIWAIESQYGSEIGKRYIIRSL 131

Query: 156 ATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDAD 214
           ATLA D RR  +   Q   +L +++K  I    L G+  G +GQ QF+P   + YA+D D
Sbjct: 132 ATLANDGRRKTYAENQLLASLQILQKDRIPREQLVGSWAGAMGQTQFIPTTYLAYAVDGD 191

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWTK 243
            D K D+  S+ DA+ASAA +L + GW +
Sbjct: 192 GDQKRDIWNSSADALASAANYLKEAGWQR 220


>gi|152979003|ref|YP_001344632.1| lytic murein transglycosylase [Actinobacillus succinogenes 130Z]
 gi|150840726|gb|ABR74697.1| lytic murein transglycosylase [Actinobacillus succinogenes 130Z]
          Length = 376

 Score =  101 bits (252), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 70/238 (29%), Positives = 113/238 (47%), Gaps = 14/238 (5%)

Query: 17  PMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTT 76
           P + QA   P      +    T D F ++    + +A  +G+S KT  +    + Y+DT 
Sbjct: 35  PRIIQADLSPLSIDATYNAPRTLDNFNDYVIFLKRKAAGQGVS-KTILNQQNYIRYIDTA 93

Query: 77  IARDRK---MVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRL---------LINLKKE 124
           +  D+K   +            +    +  IA+ +   K +            L    ++
Sbjct: 94  VRLDQKQAGLAERRKNQPPLPPNPNGVTNYIAKHLTQAKVDKAEENYWDVRAPLQKASRQ 153

Query: 125 YGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVI 184
           Y VP   L+ALWG+E+ FG   G   +LS LATLA+D RR   F ++F  AL +++ G +
Sbjct: 154 YDVPQEYLLALWGMESSFGYYQGDYDVLSVLATLAFDGRRENLFGKEFINALKMLEAGHL 213

Query: 185 S-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
           + +  LG+  G +GQ QF+P + + YA D D DG  D+  +  D  AS A +L  +GW
Sbjct: 214 NRAQMLGSWAGAMGQTQFMPSSYLNYAADGDGDGIKDIWTNEYDVFASIANYLHSVGW 271


>gi|116253819|ref|YP_769657.1| peptidoglycan binding protein [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115258467|emb|CAK09571.1| putative peptidoglycan binding protein [Rhizobium leguminosarum bv.
           viciae 3841]
          Length = 407

 Score =  101 bits (251), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 70/218 (32%), Positives = 114/218 (52%), Gaps = 12/218 (5%)

Query: 41  RFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFK--DYLDGL 98
           RF +W +     A + G+S  T +  F+ +   D T+    K    P  + K  DY+D  
Sbjct: 34  RFQKWIADFYQTAAQSGISKATYQKAFSGVSEPDPTVLE--KAAYQPEFTSKIWDYVDSR 91

Query: 99  SSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL----ST 154
            +   +  G  +   ++R L  +++ +GV   IL+A+W +E+++G  + K   L      
Sbjct: 92  VNPYTVKIGREMAAKHARTLAAIEQRFGVDKTILLAIWSMESNYGAVLDKDDRLHYVPRA 151

Query: 155 LATLAY-DCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAID 212
           LATLAY D  RAKF  +Q   AL +++ G + +  + G+  G +G  QF+P + + YAID
Sbjct: 152 LATLAYADPSRAKFAKKQLVAALKILQNGDVPAREMTGSWAGAMGHTQFIPTSYLLYAID 211

Query: 213 ADEDGKIDLVKSNIDAIASAAKFLAKLGWT--KCAGYQ 248
           AD +G  D+  S  DA+A++A  L K GW   K  GY+
Sbjct: 212 ADGNGHRDIWNSIPDALATSANLLMKNGWDTGKTWGYE 249


>gi|300694252|ref|YP_003750225.1| membrane-bound lytic murein transglycosylase b protein [Ralstonia
           solanacearum PSI07]
 gi|299076289|emb|CBJ35602.2| membrane-bound lytic murein transglycosylase b protein [Ralstonia
           solanacearum PSI07]
          Length = 404

 Score =  101 bits (251), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 67/203 (33%), Positives = 107/203 (52%), Gaps = 2/203 (0%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F  W +  R +A+  G+   T    F  +      +  DR+       +  DYLD   ++
Sbjct: 33  FDAWVTGFRQKAMDAGIPSGTFDSAFKQVTPDPEVVELDRRQPEFT-TAIWDYLDKRITT 91

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
           E I QG +L   +  +   L+++YGV   IL A+W +E+ +G  +GK  ++ +LATLA D
Sbjct: 92  ERIQQGQSLLGMHDAMFQRLERDYGVDRHILTAIWAIESQYGSEIGKRYIIRSLATLAND 151

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR  +   Q   +L +++K  I    L G+  G +GQ QF+P   + YA+D D D K D
Sbjct: 152 GRRKTYAENQLLASLQMLQKDRIPREQLVGSWAGAMGQTQFIPTTYLAYAVDGDGDQKRD 211

Query: 221 LVKSNIDAIASAAKFLAKLGWTK 243
           +  S+ DA+ASAA +L + GW +
Sbjct: 212 VWNSSADALASAANYLKEAGWQR 234


>gi|90418886|ref|ZP_01226797.1| transglycosylase [Aurantimonas manganoxydans SI85-9A1]
 gi|90336966|gb|EAS50671.1| transglycosylase [Aurantimonas manganoxydans SI85-9A1]
          Length = 426

 Score =  101 bits (251), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 67/215 (31%), Positives = 109/215 (50%), Gaps = 8/215 (3%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F  W +   + A   G+S    +  F  +   D  +    +       +  DYLD   + 
Sbjct: 52  FQRWIADFESVAASNGISRDVYRAAFKGVTSPDPDVVEKARYQPEFRSTVWDYLDNRVND 111

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL----STLAT 157
           E +A+G  +       L  ++K +GV   IL+A+W +ET++G  + +  ++     +LAT
Sbjct: 112 EQVAKGRQMAAKYKDWLDRIEKRFGVDRNILLAIWSMETNYGAILARDDVMKNLPRSLAT 171

Query: 158 LAY-DCRRAKFFTEQFFYALDLVKKGVISSHALGATF-GEIGQFQFLPVNVVKYAIDADE 215
           LAY D RRAKF  +Q   AL +V+ G ++   L +++ G +G  QF+P + + YA D D 
Sbjct: 172 LAYLDKRRAKFARQQLIAALKIVQAGHVAPGDLTSSWAGAMGHTQFIPTSYLAYAADIDG 231

Query: 216 DGKIDLVKSNIDAIASAAKFLAKLGWT--KCAGYQ 248
           DG  ++  S  DA+A+AA  L K GW   K  GY+
Sbjct: 232 DGHPNIWGSIPDALATAANLLRKNGWQTGKTWGYE 266


>gi|323136902|ref|ZP_08071982.1| lytic murein transglycosylase [Methylocystis sp. ATCC 49242]
 gi|322397663|gb|EFY00185.1| lytic murein transglycosylase [Methylocystis sp. ATCC 49242]
          Length = 391

 Score =  101 bits (251), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 61/194 (31%), Positives = 104/194 (53%), Gaps = 4/194 (2%)

Query: 50  RARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIA 109
           R  A   G+S +T       LE  D     D++   + PV   DY+ GL   E + +G A
Sbjct: 32  RHSAAGAGVSQQTIVSATDGLEPNDAVSFMDKQPEFTTPV--WDYVAGLVDEERVEEGRA 89

Query: 110 LKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDC-RRAKFF 168
           +   ++  L   +  +GV P  ++A+WG+E+ FG++ GK P++ +LATLA +  RR  ++
Sbjct: 90  MLHKHAAALHAAESRFGVDPATVVAVWGVESDFGKSFGKRPVVQSLATLACEAPRRNDYW 149

Query: 169 TEQFFYALDLVKKGVISSHA-LGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNID 227
            ++F  AL ++  G I +   +G+  G  G  QF+P   +  A+D D DG+ ++  S  D
Sbjct: 150 RKEFVAALKILDSGDIRADEFMGSWAGAFGHTQFMPSTFLGAAVDHDGDGRRNIASSAAD 209

Query: 228 AIASAAKFLAKLGW 241
           ++ S A +L + GW
Sbjct: 210 SLGSTANYLRRSGW 223


>gi|294141236|ref|YP_003557214.1| membrane-bound lytic murein transglycosylase B [Shewanella violacea
           DSS12]
 gi|293327705|dbj|BAJ02436.1| membrane-bound lytic murein transglycosylase B, putative
           [Shewanella violacea DSS12]
          Length = 325

 Score =  101 bits (251), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 67/230 (29%), Positives = 112/230 (48%), Gaps = 4/230 (1%)

Query: 13  MMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEY 72
           ++  P+L  + +    + T F  + +A  F  + +  R  A   G+   T    F  ++ 
Sbjct: 3   LLAIPLLMMSSSGVLASETSF-STRSAISFNAYLTQLRQEANALGIDKTTIDTAFPQIKR 61

Query: 73  LDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGIL 132
              +     K   + P S + YL    S   +    A  K +   L  L ++YGV P  +
Sbjct: 62  FKQSTPS--KQTPNLPASLETYLPISVSEANVITARAYFKEHKDELERLGEKYGVQPRFI 119

Query: 133 MALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GA 191
           +ALWG+E+++G      P+LS  A+LAY+ R    +  +FF AL+++ +  ++   L G+
Sbjct: 120 LALWGIESNYGAHTVSYPVLSVTASLAYESREPSIYKSEFFAALNILSQKRMAFDDLRGS 179

Query: 192 TFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
             G +GQ QF P   + YA D + DG  D+  + +DA+ASAA FL   GW
Sbjct: 180 RTGGMGQIQFSPSMYLDYAQDGNSDGNKDIWNNTLDALASAADFLKHRGW 229


>gi|323494739|ref|ZP_08099840.1| putative lytic murein transglycosylase [Vibrio brasiliensis LMG
           20546]
 gi|323310999|gb|EGA64162.1| putative lytic murein transglycosylase [Vibrio brasiliensis LMG
           20546]
          Length = 323

 Score =  101 bits (251), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 58/201 (28%), Positives = 104/201 (51%), Gaps = 2/201 (0%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F E+    +  A + G+S    +  F ++ +    +  D+       ++  +Y+      
Sbjct: 24  FEEYVEGLKDEARQNGISELVIEQAFDNVTHKPRAVKADKNQ-PEKKLTLDEYIPRAVPD 82

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             + Q  +L + +   L  +   YGV P  ++ALWG+E++FG+  G   ++  L+T+AYD
Sbjct: 83  WKVKQAKSLYQKHYADLKEIGDAYGVQPRFIVALWGVESNFGKFTGNYRVIDALSTMAYD 142

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR  FF ++   AL ++++G I+     G+  G +GQ QF+P + + +A D   DGK D
Sbjct: 143 GRREDFFRKETMAALQILEQGHIAVEDFKGSWAGAMGQCQFMPSSFLAFAADGSGDGKKD 202

Query: 221 LVKSNIDAIASAAKFLAKLGW 241
           +  S  D  ASAA +L++ GW
Sbjct: 203 IWNSEADVFASAANYLSQSGW 223


>gi|13474594|ref|NP_106163.1| transglycolase [Mesorhizobium loti MAFF303099]
 gi|14025348|dbj|BAB51949.1| probable transglycolase [Mesorhizobium loti MAFF303099]
          Length = 415

 Score =  101 bits (251), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 50/146 (34%), Positives = 84/146 (57%), Gaps = 1/146 (0%)

Query: 103 IIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDC 162
           + + G   + AN++ L  ++K YGVP  IL+A+WG ET FG           L T A+  
Sbjct: 105 VTSGGRTREAANAKTLAAIEKRYGVPGEILLAIWGRETGFGAAKMPYDAFEVLGTKAFMS 164

Query: 163 RRAKFFTEQFFYALDLVKKGVISSHALGATF-GEIGQFQFLPVNVVKYAIDADEDGKIDL 221
            +  FF  +   AL++V++G+    A+ +++ G +GQ QF+P + +K+A+D D DG++D+
Sbjct: 165 TKQDFFRTELLAALEIVQRGLAPVGAMKSSWAGALGQPQFMPTSFLKHAVDFDGDGRVDI 224

Query: 222 VKSNIDAIASAAKFLAKLGWTKCAGY 247
             S  D +AS A +L   GW +  G+
Sbjct: 225 WNSTPDVLASIANYLVHYGWVRGRGW 250


>gi|218461119|ref|ZP_03501210.1| probable membrane-bound lytic murein transglycosylase protein
           [Rhizobium etli Kim 5]
          Length = 309

 Score =  100 bits (250), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 69/218 (31%), Positives = 114/218 (52%), Gaps = 12/218 (5%)

Query: 41  RFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFK--DYLDGL 98
           RF +W +     A + G+S  T +  F+ +   D T+    K    P  + K  DY+D  
Sbjct: 34  RFQKWIADFYQTAAQSGISKATYQKAFSGVSEPDPTVLE--KAAYQPEFTSKIWDYVDSR 91

Query: 99  SSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL----ST 154
            +   +  G  +   ++R L  +++ +GV   IL+A+W +E+++G  + K   L      
Sbjct: 92  VNPYTVRIGREMAAKHARTLNAIEQRFGVDKSILLAIWSMESNYGAILDKDDRLHYVPRA 151

Query: 155 LATLAY-DCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAID 212
           LATLAY D  RAKF  +Q   AL +++ G + +  + G+  G +G  QF+P + + YA+D
Sbjct: 152 LATLAYADPSRAKFAKKQLVAALKILQNGDVPAREMTGSWAGAMGHTQFIPTSYLLYAVD 211

Query: 213 ADEDGKIDLVKSNIDAIASAAKFLAKLGWT--KCAGYQ 248
           AD +G  D+  S  DA+A++A  L K GW   K  GY+
Sbjct: 212 ADGNGHRDIWNSVPDALATSANLLMKNGWDTGKTWGYE 249


>gi|254487251|ref|ZP_05100456.1| peptidoglycan binding domain protein [Roseobacter sp. GAI101]
 gi|214044120|gb|EEB84758.1| peptidoglycan binding domain protein [Roseobacter sp. GAI101]
          Length = 404

 Score =  100 bits (250), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 73/240 (30%), Positives = 116/240 (48%), Gaps = 8/240 (3%)

Query: 7   LLISLLMM-VYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKH 65
           +L +LL +   P+ AQA      A T    +        W +  R+RAV  G+  +    
Sbjct: 1   MLAALLGVGAMPVFAQA----SGAATAMAHAGNDAGLQTWLAGFRSRAVTAGIDAQVFDA 56

Query: 66  LFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEY 125
               + Y    I RDR   +    +  +YL   +S   IA G      N   L  ++K Y
Sbjct: 57  AMTGVRYDADVIQRDRNQ-SEFTKTIWEYLKTATSDLRIANGKKALADNRAALEQIEKTY 115

Query: 126 GVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVIS 185
           GV   +++A+WGLE+ +G   G   +L++LA+LAYD RR  FF  +   AL +++ G   
Sbjct: 116 GVEKEVVVAIWGLESAYGTFRGGDNVLTSLASLAYDGRRRDFFESELLDALRILQAGDTQ 175

Query: 186 SHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSN-IDAIASAAKFLAKLGWTK 243
              + G+  G +G  QF+P +  ++A+D   D K D+   +  DA+AS A +L   GWT+
Sbjct: 176 PDQMKGSWAGAMGHTQFMPSSFQRHAVDFTGDAKRDIWGDDPRDALASTAAYLKHFGWTQ 235


>gi|241206300|ref|YP_002977396.1| lytic murein transglycosylase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240860190|gb|ACS57857.1| lytic murein transglycosylase [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 407

 Score =  100 bits (250), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 69/218 (31%), Positives = 114/218 (52%), Gaps = 12/218 (5%)

Query: 41  RFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFK--DYLDGL 98
           RF +W +     A + G+S  T +  F+ +   D T+    K    P  + K  DY+D  
Sbjct: 34  RFQKWIADFYQTAAQSGISKATYQKAFSGVSEPDPTVLE--KAAYQPEFTSKIWDYVDSR 91

Query: 99  SSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL----ST 154
            +   +  G  +   ++R L  +++ +GV   IL+A+W +E+++G  + K   L      
Sbjct: 92  VNPYTVKIGREMAAKHARTLAAIEQRFGVDKTILLAIWSMESNYGAVLDKDDRLHYVPRA 151

Query: 155 LATLAY-DCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAID 212
           LATLAY D  RAKF  +Q   AL +++ G + +  + G+  G +G  QF+P + + YA+D
Sbjct: 152 LATLAYADPSRAKFAKKQLVAALKILQNGDVPARKMTGSWAGAMGHTQFIPTSYLLYAVD 211

Query: 213 ADEDGKIDLVKSNIDAIASAAKFLAKLGWT--KCAGYQ 248
           AD +G  D+  S  DA+A++A  L K GW   K  GY+
Sbjct: 212 ADGNGHRDIWNSIPDALATSANLLMKNGWDTGKTWGYE 249


>gi|118588409|ref|ZP_01545818.1| Lytic murein transglycosylase [Stappia aggregata IAM 12614]
 gi|118439115|gb|EAV45747.1| Lytic murein transglycosylase [Stappia aggregata IAM 12614]
          Length = 439

 Score =  100 bits (250), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 76/236 (32%), Positives = 122/236 (51%), Gaps = 24/236 (10%)

Query: 22  AVTQPKKATTQFICSDTADRF--GEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIAR 79
           AV+ P +A   F       RF  G W +A  A     G+S +T   +F  ++  + T+  
Sbjct: 56  AVSLPAQADQGF------SRFVSGFWPTARAA-----GISSQTYNAVFTGMQPDEDTL-- 102

Query: 80  DRKMVTSPPVSFK---DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALW 136
             ++++      K   DYLD   S   + +G  + K  S++L  ++  YGV    ++A+W
Sbjct: 103 --RLMSKQSEFVKPIWDYLDSAVSDTRVEKGREMLKEYSQVLAVIENRYGVDREAVLAIW 160

Query: 137 GLETHFGETMGKTPLLSTLATLAYDC-RRAKFFTEQFFYALDLVKKGVISSHAL-GATFG 194
           G+ET++G  MG+  ++  LATLAY   RR  F+ ++   AL +V+ G +    + G+  G
Sbjct: 161 GMETNYGGFMGRHNVIQALATLAYAAPRRKSFWEKELVTALAIVQAGHVRFQDMEGSWAG 220

Query: 195 EIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWT--KCAGYQ 248
            +G  QF+P +   YA D D DG+ D+  S  DA+AS A +L K GW   K  GY+
Sbjct: 221 AMGHTQFMPSSWKAYAADYDGDGRRDIWTSIPDALASTAAYLQKHGWQTGKTWGYE 276


>gi|86146077|ref|ZP_01064403.1| lytic murein transglycosylase, putative [Vibrio sp. MED222]
 gi|85836024|gb|EAQ54156.1| lytic murein transglycosylase, putative [Vibrio sp. MED222]
          Length = 332

 Score =  100 bits (250), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 57/187 (30%), Positives = 97/187 (51%), Gaps = 2/187 (1%)

Query: 56  EGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANS 115
           EG+S       F  + +    +  D+       ++  +Y+        + Q  +L K + 
Sbjct: 46  EGISETIIDQAFDGVTFKPRAVKADKNQ-PEKKLTLDEYIPRAVPDWKVKQARSLYKKHY 104

Query: 116 RLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYA 175
             L  +  EYGV P  ++ALWG+E++FG+  G   ++  L T+AY+ RR  FF  +   A
Sbjct: 105 SALKRIGDEYGVQPRFIVALWGVESNFGKFTGNYSVIDALTTMAYEGRREAFFRSEAMAA 164

Query: 176 LDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAK 234
           L ++ +G I+   + G+  G +GQ QF+P + + YA D + DGK D+  +  D  ASAA 
Sbjct: 165 LKILDQGHIAPQEMKGSWAGAMGQPQFMPSSFLAYAADGNGDGKKDIWGTEEDVFASAAN 224

Query: 235 FLAKLGW 241
           +L++ GW
Sbjct: 225 YLSQSGW 231


>gi|312112960|ref|YP_004010556.1| lytic murein transglycosylase [Rhodomicrobium vannielii ATCC 17100]
 gi|311218089|gb|ADP69457.1| lytic murein transglycosylase [Rhodomicrobium vannielii ATCC 17100]
          Length = 429

 Score =  100 bits (250), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 70/232 (30%), Positives = 111/232 (47%), Gaps = 13/232 (5%)

Query: 18  MLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSP----KTAKHLFADLEYL 73
           +LA +V  P +A        T D F  W ++ R  A+  G+ P    +T + L AD    
Sbjct: 23  LLAVSVALPVRA-----AEATQDGFRAWIASFRQSAIDAGVKPEVYDRTTRPLTADFSLP 77

Query: 74  DTTIARDRKMVTSPPV--SFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGI 131
           D  I   +     P    + + Y+     + ++ +G  L   + + L +LK  Y V P I
Sbjct: 78  DLDIGNRKSQGEQPEFVRTPEQYVSEKQMANLLVKGRDLAARHEKTLADLKSRYAVDPYI 137

Query: 132 LMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGA 191
           ++ LWG ET FG        L  LAT AY  RRA+ F +QF  AL +V+ G ++      
Sbjct: 138 MLGLWGRETAFGTQHDGYSGLRVLATQAYIGRRAELFQKQFIDALKMVQIGAVTPENFKT 197

Query: 192 TF-GEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWT 242
           ++ G  G  QF+P + +KYA++ D   K+D+     DA+ + A+ L  +GW 
Sbjct: 198 SWAGAFGLVQFMPTDYLKYAVEPDGR-KLDIWTKVPDALTALARNLHAIGWN 248


>gi|148257490|ref|YP_001242075.1| putative transglycosylase [Bradyrhizobium sp. BTAi1]
 gi|146409663|gb|ABQ38169.1| putative transglycosylase [Bradyrhizobium sp. BTAi1]
          Length = 393

 Score =  100 bits (250), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 58/150 (38%), Positives = 82/150 (54%), Gaps = 1/150 (0%)

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
           DY+   S + + A G  L +     L  +++ +GVP  I++A+WG ET FG        L
Sbjct: 71  DYIKEASIARLAAHGQKLIQQYRPALAEIERRFGVPGPIVLAIWGRETDFGRYALPYDAL 130

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATF-GEIGQFQFLPVNVVKYAI 211
             LAT AY  RR   +  +F  AL ++  GV++   L A++ G +G  QFLP    K+ +
Sbjct: 131 RVLATQAYVGRRKDQYRTEFIMALKMLSDGVVTRRDLRASWGGAVGLTQFLPSEYYKHGV 190

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
           D D DGK+DL  S  DA+ SAAK LA  GW
Sbjct: 191 DLDGDGKVDLWHSVPDALGSAAKQLANKGW 220


>gi|150397906|ref|YP_001328373.1| lytic murein transglycosylase [Sinorhizobium medicae WSM419]
 gi|150029421|gb|ABR61538.1| lytic murein transglycosylase [Sinorhizobium medicae WSM419]
          Length = 405

 Score =  100 bits (250), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 79/257 (30%), Positives = 123/257 (47%), Gaps = 17/257 (6%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFK--DYLDGLS 99
           F  W +   A A + G+S  T +  FA ++  D  +    K    P    K  +Y+D   
Sbjct: 33  FQNWINNFYATAAKSGISQATYRKAFAGVKTPDQAVLE--KAAYQPEFKHKIWEYIDARV 90

Query: 100 SSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL----STL 155
           +      G  +   ++R L  L++ YGV   +L+A+W +E+++G  + K   L      L
Sbjct: 91  NPYTKRTGQEMAAKHARTLNALERHYGVDKSVLLAIWSMESNYGAILEKDDRLHYVPRAL 150

Query: 156 ATLAY-DCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDA 213
           ATLAY D +RAKF   Q   AL +++ G I+   L G+  G +G  QF+P + + YA+D 
Sbjct: 151 ATLAYADKKRAKFARTQLIAALKILQSGDITPRELTGSWAGAMGHTQFIPTSYLLYAVDV 210

Query: 214 DEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEKNFAILKHWNASL--NYNKTIA 271
           D +G  D+  S  DA+A+AA  L K GW     +      + I+   NA+      KT+ 
Sbjct: 211 DGNGHRDIWNSVPDALATAANLLRKNGWRSGETW-----GYEIVPPANAAQYSGQTKTLG 265

Query: 272 YIAAHIDGVPIGKGYDT 288
             AA     P GKG+  
Sbjct: 266 QWAALGFARPNGKGFSN 282


>gi|146342573|ref|YP_001207621.1| putative transglycosylase [Bradyrhizobium sp. ORS278]
 gi|146195379|emb|CAL79404.1| putative transglycosylase [Bradyrhizobium sp. ORS278]
          Length = 412

 Score =  100 bits (250), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 82/150 (54%), Gaps = 1/150 (0%)

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
           DY+   S + + A G  L       L  +++ +GVP  I++A+WG ET FG        L
Sbjct: 90  DYIKEASIARLAAHGQTLILQYRPALAEIERRFGVPGPIVLAIWGRETDFGRYALPYDAL 149

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATF-GEIGQFQFLPVNVVKYAI 211
             LAT AY  RR + +  +F  AL ++  GV+S   L A++ G +G  QFLP    K+ +
Sbjct: 150 RVLATQAYVGRRKEQYRTEFIMALKMLSDGVVSRRDLRASWGGAVGLTQFLPSEYYKHGV 209

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
           D D DGK+DL  S  DA+ SAAK LA  GW
Sbjct: 210 DLDGDGKVDLWHSVPDALGSAAKQLANKGW 239


>gi|126740197|ref|ZP_01755886.1| transglycosylase, putative [Roseobacter sp. SK209-2-6]
 gi|126718652|gb|EBA15365.1| transglycosylase, putative [Roseobacter sp. SK209-2-6]
          Length = 438

 Score =  100 bits (249), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 59/168 (35%), Positives = 90/168 (53%), Gaps = 8/168 (4%)

Query: 79  RDRKMVTSPPVSF--KDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALW 136
           R R+   S P  +  +  LDG +     AQG  + + +   L   ++  GVP  IL+A+W
Sbjct: 106 RQRQAEFSAPAKYFSRGSLDGTT-----AQGKRMAQQHRTALRRAEQATGVPGRILLAIW 160

Query: 137 GLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATF-GE 195
           G E+ FG           L T  +  RRA++FTE+   AL +   G +S  A+ +++ G 
Sbjct: 161 GRESAFGRAKIPHNAFQVLGTKGFMGRRAEYFTEELLAALQIADAGHVSPGAMKSSWAGA 220

Query: 196 IGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTK 243
           +GQ QF+P N +K+A D + DG+ D+ KS  D + S A FLA+ GW K
Sbjct: 221 LGQPQFMPGNFLKFARDGNGDGRADIWKSEADTLMSIAHFLAQHGWQK 268


>gi|261883926|ref|ZP_06007965.1| Putative peptidoglycan binding domain 1 [Campylobacter fetus subsp.
           venerealis str. Azul-94]
          Length = 225

 Score =  100 bits (249), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 61/181 (33%), Positives = 89/181 (49%), Gaps = 4/181 (2%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLF-ADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSS 100
           FG+W       A   G+  K    L  A ++     + RDRK  T   ++F ++   L S
Sbjct: 48  FGQWMENLTREAREAGVGEKGIAELHKASIDQ--KVLGRDRKQ-TVFNLTFTEFSKRLIS 104

Query: 101 SEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAY 160
              + +G       + +   ++  YGVP  +L A WGLET +G   G    L+ L TL+Y
Sbjct: 105 EARLKKGQENLVKYADVFKKVEDAYGVPGPVLAAFWGLETDYGAIQGDFDTLNALVTLSY 164

Query: 161 DCRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
           DCRR   F  Q    L L  +GV+ ++  GA  GEIG  Q LP + ++  +D D DGK+D
Sbjct: 165 DCRRPDLFRPQLIALLKLFDQGVVDANTTGAWAGEIGMMQLLPKDYLERGVDGDGDGKVD 224

Query: 221 L 221
           L
Sbjct: 225 L 225


>gi|93005492|ref|YP_579929.1| lytic murein transglycosylase [Psychrobacter cryohalolentis K5]
 gi|92393170|gb|ABE74445.1| Lytic murein transglycosylase [Psychrobacter cryohalolentis K5]
          Length = 433

 Score =  100 bits (249), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 64/208 (30%), Positives = 105/208 (50%), Gaps = 9/208 (4%)

Query: 40  DRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFK---DYLD 96
           + F +WKS    RA+  G    T + L  D  YL+  +     + +  P   K   +Y+D
Sbjct: 65  NSFSDWKSDFSMRAISSGHDAATVRRLL-DSAYLNQQVI---SLDSGQPEFSKMPWEYVD 120

Query: 97  GLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLA 156
              S   ++ G          L  L+ +YGV   I+ A+WG+E+ +G   G + + S+LA
Sbjct: 121 SAVSDGRVSTGKRKFAEQRTYLSQLQSQYGVNAEIIAAIWGMESSYGVVTGNSSIPSSLA 180

Query: 157 TLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADE 215
           +LAYD RR +F   Q      L+++G +S   L G+  G +GQ QF+P   +K+ +D D 
Sbjct: 181 SLAYDGRRQEFAETQLLSLATLLQRGDVSWSQLDGSWAGGMGQTQFIPDTWLKHGVDGDG 240

Query: 216 DGKIDLVKSNIDAIASAAKFLAKLGWTK 243
           +G  +   +  DA+AS A +L+  GW +
Sbjct: 241 NGHRNPWSTG-DALASTANYLSNSGWVR 267


>gi|23499837|ref|NP_699277.1| transglycosylase [Brucella suis 1330]
 gi|161620160|ref|YP_001594046.1| lytic murein transglycosylase [Brucella canis ATCC 23365]
 gi|254702504|ref|ZP_05164332.1| lytic murein transglycosylase [Brucella suis bv. 3 str. 686]
 gi|260568590|ref|ZP_05839059.1| lytic murein transglycosylase [Brucella suis bv. 4 str. 40]
 gi|261753077|ref|ZP_05996786.1| lytic Murein transglycosylase [Brucella suis bv. 3 str. 686]
 gi|23463407|gb|AAN33282.1| transglycosylase, putative [Brucella suis 1330]
 gi|161336971|gb|ABX63275.1| lytic murein transglycosylase [Brucella canis ATCC 23365]
 gi|260155255|gb|EEW90336.1| lytic murein transglycosylase [Brucella suis bv. 4 str. 40]
 gi|261742830|gb|EEY30756.1| lytic Murein transglycosylase [Brucella suis bv. 3 str. 686]
          Length = 408

 Score =  100 bits (248), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 65/219 (29%), Positives = 110/219 (50%), Gaps = 18/219 (8%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTI---ARDRKMVTSPPVSFKDYLDGL 98
           F +W +  R  A++ G++P T    F  +   D  +   AR +   T P     +Y+D  
Sbjct: 40  FRQWIANFRPVAIKSGIAPSTFDRAFRGVNEPDPVVLEKARYQPEFTEP---VWNYIDNR 96

Query: 99  SSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLS----T 154
            + + +A    + +   + L  ++  Y V   IL+A+W +E+++GE + +  ++     +
Sbjct: 97  VNEQSVAVSQNMARKWGQWLQRIEHHYSVDRHILLAIWSMESNYGEILKRDDVMRDAIRS 156

Query: 155 LATLAY-DCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAID 212
           LATLAY D RRAK+   Q   A+ +++ G I   H  G+  G +G  QF+P +   Y +D
Sbjct: 157 LATLAYADARRAKYGRTQLIAAMKILQTGDIERGHLSGSWAGALGHTQFIPTSYQAYTVD 216

Query: 213 ADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGE 251
            D +GK D+  S  DA+ +AA  L + GW      QPG 
Sbjct: 217 MDGNGKRDIWNSVPDALGTAANLLHRNGW------QPGR 249


>gi|190893390|ref|YP_001979932.1| membrane-bound lytic murein transglycosylase [Rhizobium etli CIAT
           652]
 gi|190698669|gb|ACE92754.1| probable membrane-bound lytic murein transglycosylase protein
           [Rhizobium etli CIAT 652]
 gi|327189616|gb|EGE56766.1| putative membrane-bound lytic murein transglycosylase protein
           [Rhizobium etli CNPAF512]
          Length = 407

 Score =  100 bits (248), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 69/218 (31%), Positives = 113/218 (51%), Gaps = 12/218 (5%)

Query: 41  RFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFK--DYLDGL 98
           RF +W       A + G+S  T +  F+ +   D T+    K    P  + K  DY+D  
Sbjct: 34  RFQKWIGDFYQTAAQSGISKATYQKAFSGVSEPDPTVLE--KAAYQPEFTSKIWDYIDSR 91

Query: 99  SSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL----ST 154
            +   +  G  +   ++R L  +++ +GV   IL+A+W +E+++G  + K   L      
Sbjct: 92  VNPYTVKIGREMAAKHARTLNAIEQRFGVDKTILLAIWSMESNYGAILDKDDRLHYVPRA 151

Query: 155 LATLAY-DCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAID 212
           LATLAY D  RAKF  +Q   AL +++ G + +  + G+  G +G  QF+P + + YA+D
Sbjct: 152 LATLAYADPSRAKFAKKQLVAALKILQNGDVPAREMTGSWAGAMGHTQFIPTSYLLYAVD 211

Query: 213 ADEDGKIDLVKSNIDAIASAAKFLAKLGWT--KCAGYQ 248
           AD +G  D+  S  DA+A++A  L K GW   K  GY+
Sbjct: 212 ADGNGHRDIWNSVPDALATSANLLMKNGWDTGKTWGYE 249


>gi|148978267|ref|ZP_01814785.1| lytic murein transglycosylase, putative [Vibrionales bacterium
           SWAT-3]
 gi|145962568|gb|EDK27845.1| lytic murein transglycosylase, putative [Vibrionales bacterium
           SWAT-3]
          Length = 332

 Score =  100 bits (248), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 57/201 (28%), Positives = 103/201 (51%), Gaps = 2/201 (0%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F ++    + +   EG+S       F  + +    +  D+       ++  +Y+      
Sbjct: 32  FEQYVEKLKQQGREEGISEAIIDEAFDGVTFKPRAVKADKNQ-PEKKLTLDEYIPRAVPD 90

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             + Q  +L K + + L  +  EYGV P  ++ALWG+E++FG+  G   ++  L T+AY+
Sbjct: 91  WKVKQARSLYKKHYKALKRIGDEYGVQPRFIVALWGVESNFGKFTGNYSVIDALTTMAYE 150

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR  FF  +   AL ++ +G I+   + G+  G +GQ QF+P + + +A D + DGK D
Sbjct: 151 GRREAFFRSEAMAALTILDQGHITPKEMKGSWAGAMGQPQFMPSSFLAFAADGNGDGKKD 210

Query: 221 LVKSNIDAIASAAKFLAKLGW 241
           +  +  D  ASAA +L++ GW
Sbjct: 211 IWGTEEDVFASAANYLSQSGW 231


>gi|301156383|emb|CBW15854.1| unnamed protein product [Haemophilus parainfluenzae T3T1]
          Length = 370

 Score =  100 bits (248), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 72/120 (60%), Gaps = 1/120 (0%)

Query: 123 KEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKG 182
           + YGV    ++ALWG+E+ FG   G   +LS LATLA+D RR   F+++F  A+ ++++ 
Sbjct: 143 QRYGVQQEYILALWGMESSFGHYQGSYDVLSALATLAFDGRREALFSKEFVNAMKMLERD 202

Query: 183 VISSH-ALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
            I  H  LG+  G +GQ QF+P   + YA D + DG  D+  +  DA AS A +L  +GW
Sbjct: 203 HIQRHRMLGSWAGAMGQTQFMPSAFLNYAADGNNDGVKDIWTNQFDAFASIANYLHTVGW 262


>gi|299069644|emb|CBJ40917.1| membrane-bound lytic murein transglycosylase b protein [Ralstonia
           solanacearum CMR15]
          Length = 427

 Score = 99.8 bits (247), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 67/205 (32%), Positives = 107/205 (52%), Gaps = 6/205 (2%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVS--FKDYLDGLS 99
           F  W +  R +A+  G+   T    F  +      +  DR+    P  +    DYLD   
Sbjct: 56  FDAWVTGFRQKAIDAGIPADTFDSAFKQVTPDPEVVELDRQQ---PEFTTYIWDYLDKRI 112

Query: 100 SSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLA 159
           ++E I QG +L   +  +   L+++YGV   IL A+W +E+ +G  +GK  ++ +LATLA
Sbjct: 113 TAERIQQGQSLLGQHDAMFQRLERDYGVDRHILTAIWAIESQYGSEIGKRYIIRSLATLA 172

Query: 160 YDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGK 218
            D RR  +   Q   +L +++   I    L G+  G +GQ QF+P   + YA+D D D K
Sbjct: 173 NDGRRKTYAENQLLASLQILQNDRIPREQLVGSWAGAMGQTQFIPTTYLAYAVDGDGDQK 232

Query: 219 IDLVKSNIDAIASAAKFLAKLGWTK 243
            D+  S+ DA+ASAA +L + GW +
Sbjct: 233 RDVWNSSADALASAANYLKEAGWQR 257


>gi|328543501|ref|YP_004303610.1| Lytic murein transglycosylase subfamily [polymorphum gilvum
           SL003B-26A1]
 gi|326413245|gb|ADZ70308.1| Lytic murein transglycosylase subfamily [Polymorphum gilvum
           SL003B-26A1]
          Length = 398

 Score = 99.8 bits (247), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 79/247 (31%), Positives = 116/247 (46%), Gaps = 24/247 (9%)

Query: 50  RARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIA 109
           RA A R G+   TA+ L     Y D  + R  +          DY+  L   + I  GIA
Sbjct: 37  RAEAGRAGVDTATAEALLGGAVY-DEKVIRFSQSQPEYETPIWDYMAFLVDEKRIRDGIA 95

Query: 110 LKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLA-YDCRRAKFF 168
           L + +   L  ++K YGV   +++A+WG+E+ +G+  G       LA LA    RRA +F
Sbjct: 96  LLQKHRTTLAAVEKAYGVERHVVLAVWGIESDYGQFRGDFYTPHALANLACAGGRRAAYF 155

Query: 169 TEQFFYALDLVKKG-VISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNID 227
            ++    L +  +G V ++   G+  G  GQ QF+P   ++ A+D D DG+ DLV S  D
Sbjct: 156 RDELIKTLKIAARGDVPAADFRGSWAGAFGQTQFMPTTYLRLAVDFDRDGRKDLVNSVPD 215

Query: 228 AIASAAKFLAKLGWTKC----------AGYQ--PGEKNFAILKHWNASLNYNKTIAYIAA 275
           A+AS A FL   GW +           AGY+   G +  A L  W AS           A
Sbjct: 216 ALASTANFLKDAGWQQGRPWGYEVKLPAGYKGPTGRRQRASLSTW-ASRGL--------A 266

Query: 276 HIDGVPI 282
            +DG P+
Sbjct: 267 RLDGKPL 273


>gi|75676663|ref|YP_319084.1| lytic murein transglycosylase [Nitrobacter winogradskyi Nb-255]
 gi|74421533|gb|ABA05732.1| lytic murein transglycosylase [Nitrobacter winogradskyi Nb-255]
          Length = 419

 Score = 99.8 bits (247), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 57/159 (35%), Positives = 87/159 (54%), Gaps = 7/159 (4%)

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
           DYL   S + + A+G  L + +   L  ++K +GVP  I++A+WG ET +G        +
Sbjct: 97  DYLKEGSIARLAAEGQRLMRKHESTLKAIEKRFGVPATIILAIWGRETDYGRYALPYDAM 156

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATF-GEIGQFQFLPVNVVKYAI 211
             LAT AY  RR   +  +F   L L+++G +S     A++ G +G  QFLP  + K+ +
Sbjct: 157 RVLATQAYVGRRKDQYRNEFIEGLLLLQRGAVSRRNFRASWGGAVGLTQFLPSELAKHGV 216

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPG 250
           D D DG++D+  S  DA+ASAA+ L   GW      QPG
Sbjct: 217 DFDGDGRVDIWSSVPDALASAAQQLVNKGW------QPG 249


>gi|260574959|ref|ZP_05842961.1| lytic murein transglycosylase [Rhodobacter sp. SW2]
 gi|259022964|gb|EEW26258.1| lytic murein transglycosylase [Rhodobacter sp. SW2]
          Length = 389

 Score = 99.8 bits (247), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 57/153 (37%), Positives = 76/153 (49%), Gaps = 1/153 (0%)

Query: 90  SFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKT 149
           +F ++   L S   I+ G A  +  + +      +YGV  GIL+A W  ET FG   G  
Sbjct: 73  TFLEFSQSLISKNRISNGAANAERYAEVFERAASDYGVSRGILLAFWAFETDFGAVQGDF 132

Query: 150 PLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSH-ALGATFGEIGQFQFLPVNVVK 208
              + L TLA DCRR + F  Q   A+ L  +G        GA  GEIG  Q LP ++++
Sbjct: 133 NTRNALVTLANDCRRPELFQPQVLAAIKLHAQGSFDPDTTTGAWAGEIGMVQMLPKDILE 192

Query: 209 YAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
             +D D DG+I L  S  DAI S A  L  LGW
Sbjct: 193 RGVDGDGDGRISLKTSVPDAILSGAHMLESLGW 225


>gi|240849841|ref|YP_002971229.1| membrane-bound lytic murein transglycosylase [Bartonella grahamii
           as4aup]
 gi|240266964|gb|ACS50552.1| membrane-bound lytic murein transglycosylase [Bartonella grahamii
           as4aup]
          Length = 418

 Score = 99.8 bits (247), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 62/216 (28%), Positives = 108/216 (50%), Gaps = 7/216 (3%)

Query: 33  FICSDTADR-FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSF 91
           F+    AD  F  W    +  A+   ++P T    F  +  +D  + +            
Sbjct: 36  FVSLSYADSGFKHWIKEFKKIAIAHNITPSTFHMAFKGVNAIDPEVLKSAAYQPEFVAPS 95

Query: 92  KDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPL 151
            +Y D       I +G    +  ++ L+ ++K +GV   IL+A+W +E+++G+ +    +
Sbjct: 96  WNYFDNRVHDIAIVEGRRQTQKWNKWLLQIEKRFGVDRNILLAIWSMESNYGKVLANKSV 155

Query: 152 LS----TLATLAY-DCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVN 205
           +     +LATLAY D +RAK+   Q   A+ +++ G I    L G+  G +G  QF+P +
Sbjct: 156 MRDTIRSLATLAYADKKRAKYAYTQLIAAMKILQSGEIKRSQLTGSWAGALGHTQFIPSS 215

Query: 206 VVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
            + YA+D D+DG+ D+  S  DA+A+AA  L K GW
Sbjct: 216 YLAYAVDMDQDGRRDIWNSVPDALATAANLLHKNGW 251


>gi|304393409|ref|ZP_07375337.1| lytic murein transglycosylase [Ahrensia sp. R2A130]
 gi|303294416|gb|EFL88788.1| lytic murein transglycosylase [Ahrensia sp. R2A130]
          Length = 475

 Score = 99.4 bits (246), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 73/245 (29%), Positives = 115/245 (46%), Gaps = 10/245 (4%)

Query: 3   FKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKT 62
           F K   +SLL+     +   +      T  F  +    +F +W +     A R G+    
Sbjct: 66  FAKRFFMSLLIRSAMAVICCIALLSTTTPSFASA----KFRKWIAEFENVAARNGVKRSV 121

Query: 63  AKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLK 122
            +  F  +   D  +    +           Y D   + E IA+G+  K+  +  L  ++
Sbjct: 122 YRKAFKGIRSPDPEVLELARFQPEFRQKLWMYFDTRVNEEGIARGLQEKQKWAPWLSRIE 181

Query: 123 KEYGVPPGILMALWGLETHFGETMGK----TPLLSTLATLAY-DCRRAKFFTEQFFYALD 177
           K+YGV   IL+ +W +ET FGE + K      ++ +LATLAY D RR KF   Q   A+ 
Sbjct: 182 KKYGVDRDILLGIWSMETGFGEALKKGSATRSIVRSLATLAYQDRRRRKFARSQLIAAMK 241

Query: 178 LVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFL 236
           +V+ G +S   L G+  G +G  QF+P +   Y  D D DG+ ++  S  DA+A+AA+ L
Sbjct: 242 IVQAGHVSVEGLQGSWAGAMGHTQFIPTSYRAYGQDMDGDGRKNIWTSVPDALATAAQLL 301

Query: 237 AKLGW 241
            K GW
Sbjct: 302 RKNGW 306


>gi|209550890|ref|YP_002282807.1| lytic murein transglycosylase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|209536646|gb|ACI56581.1| lytic murein transglycosylase [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 407

 Score = 99.4 bits (246), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 68/218 (31%), Positives = 113/218 (51%), Gaps = 12/218 (5%)

Query: 41  RFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFK--DYLDGL 98
           RF +W +     A + G+S  T +  F+ +   D T+    K    P  + K  DY+D  
Sbjct: 34  RFQKWIADFYQTAAQSGISKATYQKAFSGVSEPDPTVLE--KAAYQPEFTSKIWDYVDSR 91

Query: 99  SSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL----ST 154
            +   +  G  +   ++R L  +++ +GV   IL+A+W +E+++G  + K   L      
Sbjct: 92  VNPYTVKIGREMAVKHARTLAAIEQRFGVDKTILLAIWSMESNYGAILDKDDRLHYVPRA 151

Query: 155 LATLAY-DCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAID 212
           LATL Y D  RAKF  +Q   AL +++ G + +  + G+  G +G  QF+P + + YA+D
Sbjct: 152 LATLGYADPSRAKFAKKQLIAALKILQNGDVPAREMTGSWAGAMGHTQFIPTSYLLYAVD 211

Query: 213 ADEDGKIDLVKSNIDAIASAAKFLAKLGWT--KCAGYQ 248
           AD +G  D+  S  DA+A++A  L K GW   K  GY+
Sbjct: 212 ADGNGHRDIWNSVPDALATSANLLMKNGWDTGKTWGYE 249


>gi|84394408|ref|ZP_00993126.1| lytic murein transglycosylase, putative [Vibrio splendidus 12B01]
 gi|84374977|gb|EAP91906.1| lytic murein transglycosylase, putative [Vibrio splendidus 12B01]
          Length = 332

 Score = 99.4 bits (246), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 58/201 (28%), Positives = 101/201 (50%), Gaps = 2/201 (0%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F ++    + +   EG+S       F  + +    +  D+       ++  +Y+      
Sbjct: 32  FEQYVEKLKQQGREEGISEAIIDEAFDGVTFKPRAVKADKNQ-PEKKLTLDEYIPRAVPD 90

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             + Q  +L K +   L  +  EYGV P  ++ALWG+E++FG+  G   ++  L T+AY+
Sbjct: 91  WKVKQARSLYKKHYTALKRIGDEYGVQPRFIVALWGVESNFGKFTGNYSVIDALTTMAYE 150

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR  FF  +   AL ++ +G I+   + G+  G +GQ QF+P + + YA D   DGK D
Sbjct: 151 GRREAFFRSEAMAALKILDQGHIAPKEMKGSWAGAMGQPQFMPSSFLAYAADGSGDGKKD 210

Query: 221 LVKSNIDAIASAAKFLAKLGW 241
           +  +  D  ASAA +L++ GW
Sbjct: 211 IWGTEEDVFASAANYLSQSGW 231


>gi|86359153|ref|YP_471045.1| membrane-bound lytic murein transglycosylase protein [Rhizobium
           etli CFN 42]
 gi|86283255|gb|ABC92318.1| probable membrane-bound lytic murein transglycosylase protein
           [Rhizobium etli CFN 42]
          Length = 407

 Score = 99.4 bits (246), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 69/218 (31%), Positives = 113/218 (51%), Gaps = 12/218 (5%)

Query: 41  RFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFK--DYLDGL 98
           RF +W +     A   G+S  T +  F+ +   D T+    K    P  + K  DY+D  
Sbjct: 34  RFQKWIADFYQTAAESGISKATYQKAFSGVSEPDPTVLE--KAAYQPEFTSKIWDYIDSR 91

Query: 99  SSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL----ST 154
            +   +  G  +   ++R L  +++ +GV   IL+A+W +E+++G  + K   L      
Sbjct: 92  VNPYTVRIGREMAVKHARTLNAIEQRFGVDKTILLAIWSMESNYGAILDKDDRLHYVPRA 151

Query: 155 LATLAY-DCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAID 212
           LATLAY D  RAKF  +Q   AL +++ G + +  + G+  G +G  QF+P + + YA+D
Sbjct: 152 LATLAYADPSRAKFAKKQLVAALKILQNGDVPARQMTGSWAGAMGHTQFIPTSYLLYAVD 211

Query: 213 ADEDGKIDLVKSNIDAIASAAKFLAKLGWT--KCAGYQ 248
           AD +G  D+  S  DA+A++A  L K GW   K  GY+
Sbjct: 212 ADGNGHRDIWNSVPDALATSANLLMKNGWDTGKTWGYE 249


>gi|303280509|ref|XP_003059547.1| glycoside hydrolase family 103 protein [Micromonas pusilla
           CCMP1545]
 gi|226459383|gb|EEH56679.1| glycoside hydrolase family 103 protein [Micromonas pusilla
           CCMP1545]
          Length = 470

 Score = 99.4 bits (246), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 88/161 (54%), Gaps = 6/161 (3%)

Query: 94  YLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLS 153
           YL  +   E + +G  +  A+  LL  +++EYGVP  I++A+WG+E+ FG  MG T  + 
Sbjct: 203 YLKKIVCRERVERGAEMLNAHRALLGEVEREYGVPAEIIVAIWGIESSFGGFMGNTDAIR 262

Query: 154 TLATLAYDCR-RAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAI 211
            LATL ++ R +  +F  +F  A+ ++ KG      L G+  G +GQ QF+P N   YA+
Sbjct: 263 ALATLGWETRAKDDYFRNEFIEAVRIIDKGHAKHGGLVGSWDGGLGQCQFMPSNFHVYAV 322

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAK-LGW---TKCAGYQ 248
           D D DG  D+  S  D  AS   F++    W    + AGY+
Sbjct: 323 DKDGDGVADIWNSLPDVFASMGNFISSYCDWDSKVRAAGYK 363


>gi|316932437|ref|YP_004107419.1| lytic murein transglycosylase [Rhodopseudomonas palustris DX-1]
 gi|315600151|gb|ADU42686.1| lytic murein transglycosylase [Rhodopseudomonas palustris DX-1]
          Length = 473

 Score = 99.0 bits (245), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 73/235 (31%), Positives = 118/235 (50%), Gaps = 18/235 (7%)

Query: 45  WKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPV--SFKDYLDGLSSSE 102
           W  AAR    RE  +  TA  L  DL  +D        M + P    S  DYLD L +  
Sbjct: 111 WPDAARRGISRESFARFTAG-LSPDLRLMDL-------MDSQPEFTKSIWDYLDILVNDT 162

Query: 103 IIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDC 162
            +A+G  +          +++ YGV   I+ ++WG+E+++   +G   ++++ ATLA   
Sbjct: 163 RLAKGREILARYKAEFDAVERAYGVDRYIIASIWGIESNYSTQIGDRSVVNSTATLACVG 222

Query: 163 RRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDL 221
           RR  +F ++F  AL+++ +G +    L G+  G  G  QF+P +  ++A+DAD DG+ D+
Sbjct: 223 RRQNYFKDEFLTALEILHRGDLRPEQLRGSWAGAFGPTQFMPTSFKRFAVDADGDGRRDV 282

Query: 222 VKSNIDAIASAAKFLAKLGWT--KCAGYQPGEKNFAILKHWNASLNYNKTIAYIA 274
           V +  D IAS A  L K GW   +  GY+      A+ K +N  L   + I  +A
Sbjct: 283 VDNPYDLIASTANNLKKDGWQSGETWGYE-----VAVPKGFNYMLADRRRIQSLA 332


>gi|110636416|ref|YP_676624.1| lytic murein transglycosylase [Mesorhizobium sp. BNC1]
 gi|110287400|gb|ABG65459.1| lytic murein transglycosylase [Chelativorans sp. BNC1]
          Length = 411

 Score = 99.0 bits (245), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 52/157 (33%), Positives = 89/157 (56%), Gaps = 6/157 (3%)

Query: 88  PVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMG 147
           P ++  ++DG     +++ G +  K ++  L  ++K +GVP G+L+A+WG E+ FG    
Sbjct: 91  PSAYFAHIDG-----VVSGGRSRAKTHAATLAAIEKRFGVPSGVLLAIWGRESGFGSAKI 145

Query: 148 KTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATF-GEIGQFQFLPVNV 206
                  L T A+   R + F ++   AL +V KG +    + +++ G +GQ QF+P + 
Sbjct: 146 PYNAFEVLGTKAFLATRKEMFRQEVLAALAMVDKGRVPPETMRSSWAGAMGQPQFMPTSY 205

Query: 207 VKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTK 243
           +KYA+D D DG+ D+  S  DA+AS A +LA  GW +
Sbjct: 206 LKYAVDFDGDGRADIWNSVPDALASIANYLAGHGWVQ 242


>gi|325578523|ref|ZP_08148623.1| lytic transglycosylase [Haemophilus parainfluenzae ATCC 33392]
 gi|325159759|gb|EGC71889.1| lytic transglycosylase [Haemophilus parainfluenzae ATCC 33392]
          Length = 379

 Score = 99.0 bits (245), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 72/120 (60%), Gaps = 1/120 (0%)

Query: 123 KEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKG 182
           + YGV    ++ALWG+E+ FG   G   +LS LATLA+D RR   F+++F  A+ ++++ 
Sbjct: 152 QRYGVQQEYILALWGMESSFGYYQGSYDVLSALATLAFDGRREALFSKEFVNAMKMLERD 211

Query: 183 VISSH-ALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
            I  H  LG+  G +GQ QF+P   + YA D + DG  D+  +  DA AS A +L  +GW
Sbjct: 212 HIQRHRMLGSWAGAMGQTQFMPSAFLNYAADGNNDGVKDIWTNQFDAFASIANYLHTVGW 271


>gi|298485427|ref|ZP_07003514.1| Hrp-associated lytic transglycosylase [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|298160047|gb|EFI01081.1| Hrp-associated lytic transglycosylase [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
          Length = 413

 Score = 99.0 bits (245), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 60/202 (29%), Positives = 104/202 (51%), Gaps = 3/202 (1%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F +W +  R+ A  +G+   T    F ++  LD T+ +          +  DYL    + 
Sbjct: 43  FQQWLATFRSNATTKGIDTATLDLAFQNIT-LDPTVHQLDMAQPEFTTAIWDYLSERLTP 101

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
           + I QG  L +    +L  +++ YGV   I+ A+W +E+ +G+ +G   ++ +LATLAY 
Sbjct: 102 KNIQQGQELLQKEP-VLNEVERHYGVDAKIIAAIWCIESGYGKDIGSRDVIRSLATLAYK 160

Query: 162 CRRAKFFTEQFFYALDLVK-KGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR  +   Q   AL +V+ K +  +  +G+  G +GQ QF+P   + YA+D + D + D
Sbjct: 161 GRRMDYGATQLMAALHIVQNKDIARAQLIGSWAGAMGQTQFIPTTYLDYAVDFNHDNRRD 220

Query: 221 LVKSNIDAIASAAKFLAKLGWT 242
           +  S  DA+AS A +L +  W 
Sbjct: 221 VWSSRADALASTASYLQRSAWN 242


>gi|28868073|ref|NP_790692.1| type III helper protein HopAJ1 [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|28851309|gb|AAO54387.1| type III helper protein HopAJ1 [Pseudomonas syringae pv. tomato
           str. DC3000]
          Length = 413

 Score = 99.0 bits (245), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 60/202 (29%), Positives = 104/202 (51%), Gaps = 3/202 (1%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F +W +  R+ A  +G+   T    F ++  LD T+ +          +  DYL    + 
Sbjct: 43  FQQWLATFRSNATTKGIDTATLDLAFQNIT-LDPTVHQLDMAQPEFTTAIWDYLSERLTP 101

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
           + I QG  L +    +L  +++ YGV   I+ A+W +E+ +G+ +G   ++ +LATLAY 
Sbjct: 102 KNIQQGQELLQKEP-VLNEVERHYGVDAKIIAAIWCIESGYGKDIGSRDVIRSLATLAYK 160

Query: 162 CRRAKFFTEQFFYALDLVK-KGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR  +   Q   AL +V+ K +  +  +G+  G +GQ QF+P   + YA+D + D + D
Sbjct: 161 GRRMDYGATQLMAALHIVQNKDIARAQLIGSWAGAMGQTQFIPTTYLDYAVDFNHDNRRD 220

Query: 221 LVKSNIDAIASAAKFLAKLGWT 242
           +  S  DA+AS A +L +  W 
Sbjct: 221 VWSSRADALASTASYLQRSAWN 242


>gi|220924707|ref|YP_002500009.1| lytic murein transglycosylase [Methylobacterium nodulans ORS 2060]
 gi|219949314|gb|ACL59706.1| lytic murein transglycosylase [Methylobacterium nodulans ORS 2060]
          Length = 429

 Score = 99.0 bits (245), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 73/250 (29%), Positives = 117/250 (46%), Gaps = 16/250 (6%)

Query: 7   LLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWK----SAARARAVREGMSPKT 62
           L++ L+    P   Q    P  AT   +  D    F   K    + ARAR V + +   +
Sbjct: 21  LILGLVWPGLPAHGQTAAPPDTATA--VSPDEQAAFDRCKQDLAAEARARGVAQAVVASS 78

Query: 63  AKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLK 122
            + L  D + L  T +R +     P     DY+D   +   I  G A       +L  ++
Sbjct: 79  LQDLSPDPQVL--TASRQQAEFEKP---LWDYIDAAVTETAIVDGRAKLGEWEPVLAAIE 133

Query: 123 KEYGVPPGILMALWGLETHFGETMGKT----PLLSTLATLAYDCRRAKFFTEQFFYALDL 178
             YGV   +L A+WG+E+ +G  + K     P++ +LATLA    RA ++ ++   AL +
Sbjct: 134 TAYGVDRFVLAAIWGIESGYGAVLDKPTKVRPVIRSLATLACGGERAPYWRDELLAALQI 193

Query: 179 VKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLA 237
             +G I    L G+  G +G  QF+P   +++A+D D DG+ D+  S  DA+AS A  L 
Sbjct: 194 ADRGGIPLDQLTGSWAGAMGHTQFMPTTYLRHAVDFDGDGRRDIWHSVPDALASTANDLK 253

Query: 238 KLGWTKCAGY 247
            +GW    G+
Sbjct: 254 AMGWRAGEGW 263


>gi|182680540|ref|YP_001834686.1| lytic murein transglycosylase [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182636423|gb|ACB97197.1| lytic murein transglycosylase [Beijerinckia indica subsp. indica
           ATCC 9039]
          Length = 419

 Score = 99.0 bits (245), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 82/151 (54%), Gaps = 1/151 (0%)

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
           DYL GL   E +  G ++ + +++     ++ + V   ++ A+WG+E+ FG   G  P++
Sbjct: 101 DYLSGLVDQERVDDGRSMMQRHAQAFATAEQRFSVDRAVIAAVWGVESDFGRGFGTRPVI 160

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAI 211
            +L TL+    R  +F  +   AL +V+ G I  S   G+  G  G  QF+P   ++ A+
Sbjct: 161 RSLTTLSCAGPRQSYFRSELLAALKIVQNGDIEPSQFNGSWAGAFGHTQFMPSTFLRTAV 220

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGWT 242
           D D DG+ DL+ S  DA+ S A +L K GWT
Sbjct: 221 DLDGDGRRDLINSVPDALGSTAAYLRKGGWT 251


>gi|170738408|ref|YP_001767063.1| lytic murein transglycosylase [Methylobacterium sp. 4-46]
 gi|168192682|gb|ACA14629.1| lytic murein transglycosylase [Methylobacterium sp. 4-46]
          Length = 398

 Score = 98.6 bits (244), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 79/250 (31%), Positives = 119/250 (47%), Gaps = 34/250 (13%)

Query: 56  EGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFK----DYLDGLSSSEIIAQGIALK 111
            G+SP   +   A + Y D  I    ++  + P  FK    DY+  L   E +  G A  
Sbjct: 42  RGISPAAFQAATAGIVYDDKVI----ELSQAQP-EFKTPIWDYMAALVDDERVEDGRAAM 96

Query: 112 KANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD-CRRAKFFTE 170
           + ++  L   +  + V    + A+WG+E++FG+ +GK PL+ +LATLA    RRA +F  
Sbjct: 97  RQHAAALAEAEARFHVDRYTIAAVWGVESNFGKNLGKMPLIQSLATLACSPNRRAGYFRG 156

Query: 171 QFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAI 229
           +    L ++ +G I+   L G+  G  GQ QF+P    + A+D D DG+ D+V S  DA+
Sbjct: 157 ELMATLKIIDRGDIAPDRLTGSWAGAFGQTQFMPSTYQRLAVDLDGDGRRDVVDSVADAV 216

Query: 230 ASAAKFLAKLGWTKCA--GYQ-----------PGEKNFAILKHWNASLNYNKTIAYIAAH 276
            S A FL    W      GY+            G KN   + HW ASL          A 
Sbjct: 217 GSTANFLRAAKWQNGLPWGYEVRLPRGFSVAAAGRKNKRPIAHW-ASLGV--------AR 267

Query: 277 IDGVPI-GKG 285
           +DG P+ G+G
Sbjct: 268 VDGRPLSGEG 277


>gi|157375652|ref|YP_001474252.1| lytic murein transglycosylase [Shewanella sediminis HAW-EB3]
 gi|157318026|gb|ABV37124.1| lytic murein transglycosylase [Shewanella sediminis HAW-EB3]
          Length = 333

 Score = 98.6 bits (244), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 64/207 (30%), Positives = 100/207 (48%), Gaps = 2/207 (0%)

Query: 36  SDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYL 95
           S  +  F E+  A +  A  +G+  +    +F  ++     +    K    P  S + YL
Sbjct: 27  SQKSPSFVEYLDALKLEAKEQGIENEIVARVFPKIKPFKRAVFTG-KTQAEPKTSLETYL 85

Query: 96  DGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTL 155
                   + +  +L K +   L  + K+YGV P  ++ALWG+   FG   G  PLLS L
Sbjct: 86  PTTVPEWKVEKARSLFKTHRAELEAIGKKYGVQPRFIIALWGIIADFGAESGHLPLLSVL 145

Query: 156 ATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDAD 214
           A+ AY+  +  FF ++FF AL+++ +  I    L GA  G +GQ  F P   + +A D D
Sbjct: 146 ASSAYEGSKEAFFRDEFFAALNIIAQDNIDFDDLQGAWTGHMGQTHFTPSQYLLFARDGD 205

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGW 241
            DGK D+  +  D  AS A +L + GW
Sbjct: 206 GDGKKDIWNNTQDTFASLAYYLQQAGW 232


>gi|114571066|ref|YP_757746.1| lytic murein transglycosylase [Maricaulis maris MCS10]
 gi|114341528|gb|ABI66808.1| lytic murein transglycosylase [Maricaulis maris MCS10]
          Length = 406

 Score = 98.6 bits (244), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 64/204 (31%), Positives = 99/204 (48%), Gaps = 8/204 (3%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFK---DYLDGL 98
           F +W+   R R +  G    TA  +   L+     I RDR    S P   +    YLD  
Sbjct: 28  FADWRGGFRERLIASGAEEATAAAMLDGLQPEMRIIERDR----SQPEFVRPLWSYLDIA 83

Query: 99  SSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATL 158
           +S   I  G      N   +  +   +GV   IL+A+WGLE+ +G   G   ++  LATL
Sbjct: 84  ASDLRIRNGRDAFAGNRDDVDAVAAHFGVRAEILIAIWGLESSYGAIPGNNDIVQALATL 143

Query: 159 AYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDG 217
           A++ RR  +   Q     ++++ G  +   L G+  G +GQ QF+P   ++ A D D DG
Sbjct: 144 AWEGRRRDWAEAQLIAVAEMLESGYATRQQLTGSWAGAMGQMQFIPTTYLERAHDWDGDG 203

Query: 218 KIDLVKSNIDAIASAAKFLAKLGW 241
           + D+  +  DA+ASAA  L++ GW
Sbjct: 204 RRDIWTNPADALASAANLLSRAGW 227


>gi|126174096|ref|YP_001050245.1| lytic murein transglycosylase [Shewanella baltica OS155]
 gi|125997301|gb|ABN61376.1| lytic murein transglycosylase [Shewanella baltica OS155]
          Length = 370

 Score = 98.6 bits (244), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 66/208 (31%), Positives = 97/208 (46%), Gaps = 2/208 (0%)

Query: 36  SDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYL 95
           SD    F ++    +  A  +G+S  T    F  ++      A D    T    +   YL
Sbjct: 64  SDEKISFSDYLIQLKQEARLQGISQATLDLAFPQIKLFKKARATDSPQ-TDKTHNLDTYL 122

Query: 96  DGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTL 155
                   +     L K + + L  +  +Y V P  L+ALWGL + FGE  G  P+LS  
Sbjct: 123 ADTVPEWKVDTARVLFKEHEQQLNAIASQYSVQPRFLVALWGLVSDFGEASGDYPVLSVT 182

Query: 156 ATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATF-GEIGQFQFLPVNVVKYAIDAD 214
           A+LA+   R  FF ++F  AL ++ K  I    L + + G +GQ Q +P + + Y  D D
Sbjct: 183 ASLAFGGEREAFFKKEFIVALSIMDKDHIGFQDLKSRWNGAMGQTQLMPTDYLAYGQDGD 242

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGWT 242
            DGK D+  +  DA ASAA  L +LGW 
Sbjct: 243 GDGKKDIWHNTQDAFASAAYLLQQLGWN 270


>gi|254503200|ref|ZP_05115351.1| lytic murein transglycosylase subfamily [Labrenzia alexandrii
           DFL-11]
 gi|222439271|gb|EEE45950.1| lytic murein transglycosylase subfamily [Labrenzia alexandrii
           DFL-11]
          Length = 385

 Score = 98.6 bits (244), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 71/231 (30%), Positives = 111/231 (48%), Gaps = 27/231 (11%)

Query: 50  RARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFK----DYLDGLSSSEIIA 105
           + +A+  G+ P+ A+ + +  +Y +  I    +  T+ P  FK    DY+  L   + I 
Sbjct: 24  KQQAISAGVRPEVAQKMLSGAKYDEKVI----RFSTAQP-EFKTEIWDYMAFLVDPQRIQ 78

Query: 106 QGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDC--- 162
            G A  K ++R L  ++K YGV   I++A+WG+E+ +G   G       LA L   C   
Sbjct: 79  DGKANLKKHARTLDAVEKRYGVDKHIVLAVWGVESDYGNFRGDFYTPHALANLV--CAGK 136

Query: 163 RRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDL 221
           RR K+F  +    L +  +G +      G+  G  GQ QF+P      A+D D DG+ DL
Sbjct: 137 RRQKYFRGELMKTLQIASRGDVRMEDFKGSWAGAFGQTQFMPTTFASLAVDFDGDGRKDL 196

Query: 222 VKSNIDAIASAAKFLAKLGW--TKCAGYQ----------PGEKNFAILKHW 260
           V S  DA+AS A FL   GW  ++  G++           G KN+A +  W
Sbjct: 197 VNSVPDALASTANFLKNAGWRNSRLWGFEVKVPKGYSGPSGRKNYASMSTW 247


>gi|162147579|ref|YP_001602040.1| membrane-bound lytic murein transglycosylase B [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209542212|ref|YP_002274441.1| lytic murein transglycosylase [Gluconacetobacter diazotrophicus PAl
           5]
 gi|161786156|emb|CAP55738.1| putative membrane-bound lytic murein transglycosylase B precursor
           [Gluconacetobacter diazotrophicus PAl 5]
 gi|209529889|gb|ACI49826.1| lytic murein transglycosylase [Gluconacetobacter diazotrophicus PAl
           5]
          Length = 330

 Score = 98.6 bits (244), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 63/200 (31%), Positives = 101/200 (50%), Gaps = 8/200 (4%)

Query: 47  SAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPP---VSFKDYLDGLSSSEI 103
           +  RA AV  G+S        A    L+   AR  ++    P   +++  Y   + + + 
Sbjct: 41  AGVRAEAVSHGLSAAIVDRALA----LEAPNARVLQLDQHQPEFTLTWAQYRQRVLTPKK 96

Query: 104 IAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCR 163
           +A G     A   LL  + + +GV P  LM +WGLE+ +G   G   +   LATLAYD R
Sbjct: 97  VADGRVAAGARRALLAEVGRHFGVDPQPLMGIWGLESAYGTRTGTFQIPDALATLAYDGR 156

Query: 164 RAKFFTEQFFYALDLVKKGVISSHALGATF-GEIGQFQFLPVNVVKYAIDADEDGKIDLV 222
           RA FF  +   AL ++  G ++  ++  ++ G +GQ QF+P   ++YA+D    G+ D+ 
Sbjct: 157 RASFFRGELMNALRILDHGDVTPDSMTGSYAGAMGQPQFMPSAYLRYAVDYTGSGRRDIW 216

Query: 223 KSNIDAIASAAKFLAKLGWT 242
            S  D  AS A +LA+ GW+
Sbjct: 217 TSEPDVFASIANYLARCGWS 236


>gi|148359414|ref|YP_001250621.1| membrane bound lytic murein transglycosylase [Legionella
           pneumophila str. Corby]
 gi|148281187|gb|ABQ55275.1| membrane bound lytic murein transglycosylase [Legionella
           pneumophila str. Corby]
          Length = 302

 Score = 98.6 bits (244), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 54/155 (34%), Positives = 90/155 (58%), Gaps = 2/155 (1%)

Query: 94  YLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLS 153
           Y +   + + +  G+     N + L  +++ YGV P I++A+ G+ET +GE  G+  +L 
Sbjct: 42  YRELFLTQKRLKSGLQFWAENQKTLEKIQRRYGVSPEIIIAILGVETMYGERQGEYRVLD 101

Query: 154 TLATLAYDC-RRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAI 211
           TLATLA++  +R+ FFT++      L ++  +S +   G+  G IG+ QF+P +   YA+
Sbjct: 102 TLATLAFNYPKRSAFFTKELKEFFLLCREQHVSPTQYKGSYAGAIGKPQFMPSSYRYYAV 161

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAG 246
           D + +G+ DLV  N D+IAS A +L K GW    G
Sbjct: 162 DFNNNGRRDLVNDNGDSIASIANYLHKHGWNLNQG 196


>gi|54294758|ref|YP_127173.1| hypothetical protein lpl1835 [Legionella pneumophila str. Lens]
 gi|53754590|emb|CAH16074.1| hypothetical protein lpl1835 [Legionella pneumophila str. Lens]
          Length = 338

 Score = 98.6 bits (244), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 54/155 (34%), Positives = 90/155 (58%), Gaps = 2/155 (1%)

Query: 94  YLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLS 153
           Y +   + + +  G+     N + L  +++ YGV P I++A+ G+ET +GE  G+  +L 
Sbjct: 78  YRELFLTQKRLKSGLQFWSENQKTLEKIQRRYGVSPEIIIAILGVETMYGERQGEYRVLD 137

Query: 154 TLATLAYDC-RRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAI 211
           TLATLA++  +R+ FFT++      L ++  +S +   G+  G IG+ QF+P +   YA+
Sbjct: 138 TLATLAFNYPKRSAFFTKELKEFFLLCREQHVSPTQYKGSYAGAIGKPQFMPSSYRYYAV 197

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAG 246
           D + +G+ DLV  N D+IAS A +L K GW    G
Sbjct: 198 DFNNNGRRDLVNDNGDSIASIANYLHKHGWNLNQG 232


>gi|92116710|ref|YP_576439.1| lytic murein transglycosylase [Nitrobacter hamburgensis X14]
 gi|91799604|gb|ABE61979.1| Lytic murein transglycosylase [Nitrobacter hamburgensis X14]
          Length = 481

 Score = 98.6 bits (244), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 68/210 (32%), Positives = 103/210 (49%), Gaps = 15/210 (7%)

Query: 45  WKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFK---DYLDGLSSS 101
           W  AAR    R+     TA  L  DL  +D        ++ S P   K   DYLD L + 
Sbjct: 119 WPDAARRHVTRQNFERFTAG-LSPDLRIMD--------LMDSQPEFTKAIWDYLDILVND 169

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             +A+G  +           ++ YGV    + A+WG+E+++   MG   +L + ATLA  
Sbjct: 170 ARLARGREILATYKPQFDAAERAYGVDRYAIAAIWGIESNYSTRMGDRSVLQSTATLACV 229

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR K+F ++F  AL+++ +G +    + G+  G  G  QF+P    ++A+D D DG+ D
Sbjct: 230 GRRQKYFRDEFLAALEILNRGDLRPEQMRGSWAGAFGPTQFMPTAFKRFAVDGDGDGRRD 289

Query: 221 LVKSNIDAIASAAKFLAKLGWT--KCAGYQ 248
           +V    D IAS A  L K GW   K  GY+
Sbjct: 290 VVDDPADLIASTANNLRKDGWQTGKTWGYE 319


>gi|87119260|ref|ZP_01075158.1| membrane-bound lytic murein transglycosylase B [Marinomonas sp.
           MED121]
 gi|86165651|gb|EAQ66918.1| membrane-bound lytic murein transglycosylase B [Marinomonas sp.
           MED121]
          Length = 374

 Score = 98.6 bits (244), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 72/227 (31%), Positives = 109/227 (48%), Gaps = 8/227 (3%)

Query: 67  FADLEYLDTTIAR--DRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKE 124
           FA ++    TI++  ++  V +P   +  Y      S  I +G    K + + L   +K+
Sbjct: 100 FAKIQARTKTISKSDNQPEVITP---YYKYRTRFVESSRIREGKKFVKKHQKWLAKAQKD 156

Query: 125 YGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDC-RRAKFFTEQFFYALDLVKKGV 183
           YGV P I+ AL G+ET +G   GK  + ++LATL++D  RRAK+F  +    L L ++  
Sbjct: 157 YGVNPEIIAALIGVETFYGRITGKKDVFTSLATLSFDYPRRAKYFQSELEAYLLLARENQ 216

Query: 184 IS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWT 242
               +  G+  G +G  QF+P N  K A+D D+DGK+DL  S  DAI S A +L   GW 
Sbjct: 217 WQIGNTKGSYSGALGMTQFMPSNYRKLAVDYDKDGKVDLWGSVPDAIGSVANYLRHHGWQ 276

Query: 243 KCAGY-QPGEKNFAILKHWNASLNYNKTIAYIAAHIDGVPIGKGYDT 288
              G       N A    W   +N  +  A        + +GK   T
Sbjct: 277 DDRGVIVATSTNGATKDKWQEWINKGRKPAKSLPEWQAMGVGKDIKT 323


>gi|54297787|ref|YP_124156.1| hypothetical protein lpp1838 [Legionella pneumophila str. Paris]
 gi|53751572|emb|CAH12990.1| hypothetical protein lpp1838 [Legionella pneumophila str. Paris]
          Length = 338

 Score = 98.2 bits (243), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 54/155 (34%), Positives = 90/155 (58%), Gaps = 2/155 (1%)

Query: 94  YLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLS 153
           Y +   + + +  G+     N + L  +++ YGV P I++A+ G+ET +GE  G+  +L 
Sbjct: 78  YRELFLTQKRLKSGLQFWAENQKTLEKIQRRYGVSPEIIIAILGVETMYGERQGEYRVLD 137

Query: 154 TLATLAYDC-RRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAI 211
           TLATLA++  +R+ FFT++      L ++  +S +   G+  G IG+ QF+P +   YA+
Sbjct: 138 TLATLAFNYPKRSAFFTKELKEFFLLCREQHVSPTQYKGSYAGAIGKPQFMPSSYRYYAV 197

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAG 246
           D + +G+ DLV  N D+IAS A +L K GW    G
Sbjct: 198 DFNNNGRRDLVNDNGDSIASIANYLHKHGWNLNQG 232


>gi|307610574|emb|CBX00162.1| hypothetical protein LPW_19071 [Legionella pneumophila 130b]
          Length = 338

 Score = 98.2 bits (243), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 54/155 (34%), Positives = 90/155 (58%), Gaps = 2/155 (1%)

Query: 94  YLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLS 153
           Y +   + + +  G+     N + L  +++ YGV P I++A+ G+ET +GE  G+  +L 
Sbjct: 78  YRELFLTQKRLKSGLQFWAENQKTLEKIQRRYGVSPEIIIAILGVETMYGERQGEYRVLD 137

Query: 154 TLATLAYDC-RRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAI 211
           TLATLA++  +R+ FFT++      L ++  +S +   G+  G IG+ QF+P +   YA+
Sbjct: 138 TLATLAFNYPKRSAFFTKELKEFFLLCREQHVSPTQYKGSYAGAIGKPQFMPSSYRYYAV 197

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAG 246
           D + +G+ DLV  N D+IAS A +L K GW    G
Sbjct: 198 DFNNNGRRDLVNDNGDSIASIANYLHKHGWNLNQG 232


>gi|304411364|ref|ZP_07392978.1| lytic murein transglycosylase [Shewanella baltica OS183]
 gi|307305314|ref|ZP_07585062.1| lytic murein transglycosylase [Shewanella baltica BA175]
 gi|304350219|gb|EFM14623.1| lytic murein transglycosylase [Shewanella baltica OS183]
 gi|306911617|gb|EFN42042.1| lytic murein transglycosylase [Shewanella baltica BA175]
          Length = 370

 Score = 98.2 bits (243), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 64/202 (31%), Positives = 96/202 (47%), Gaps = 2/202 (0%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F ++    +  A  +G+S  T    F  ++      A D  + T    +   YL      
Sbjct: 70  FSDYLIQLKQEASLQGISQTTLDLAFPQIKLFKKARATD-SLQTDKTHNLDTYLADTVPE 128

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             +     L K + + L  +  +Y V P  L+ALWGL + FGE  G  P+LS  A+LA+ 
Sbjct: 129 WKVDTARVLFKEHEQQLNAIASQYAVQPRFLVALWGLVSDFGEASGDYPVLSVTASLAFG 188

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHALGATF-GEIGQFQFLPVNVVKYAIDADEDGKID 220
             R  FF ++F  AL ++ K  I    L + + G +GQ Q +P + + Y  D D DGK D
Sbjct: 189 GEREAFFKKEFMAALSIMDKDHIGFQDLKSRWNGAMGQTQLMPTDYLAYGQDGDGDGKKD 248

Query: 221 LVKSNIDAIASAAKFLAKLGWT 242
           +  +  DA ASAA  L +LGW 
Sbjct: 249 IWHNTQDAFASAAYLLQQLGWN 270


>gi|296107460|ref|YP_003619161.1| membrane bound lytic murein transglycosylase [Legionella
           pneumophila 2300/99 Alcoy]
 gi|295649362|gb|ADG25209.1| membrane bound lytic murein transglycosylase [Legionella
           pneumophila 2300/99 Alcoy]
          Length = 286

 Score = 98.2 bits (243), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 54/155 (34%), Positives = 90/155 (58%), Gaps = 2/155 (1%)

Query: 94  YLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLS 153
           Y +   + + +  G+     N + L  +++ YGV P I++A+ G+ET +GE  G+  +L 
Sbjct: 26  YRELFLTQKRLKSGLQFWAENQKTLEKIQRRYGVSPEIIIAILGVETMYGERQGEYRVLD 85

Query: 154 TLATLAYDC-RRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAI 211
           TLATLA++  +R+ FFT++      L ++  +S +   G+  G IG+ QF+P +   YA+
Sbjct: 86  TLATLAFNYPKRSAFFTKELKEFFLLCREQHVSPTQYKGSYAGAIGKPQFMPSSYRYYAV 145

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAG 246
           D + +G+ DLV  N D+IAS A +L K GW    G
Sbjct: 146 DFNNNGRRDLVNDNGDSIASIANYLHKHGWNLNQG 180


>gi|52842094|ref|YP_095893.1| membrane bound lytic murein transglycosylase [Legionella
           pneumophila subsp. pneumophila str. Philadelphia 1]
 gi|52629205|gb|AAU27946.1| membrane bound lytic murein transglycosylase [Legionella
           pneumophila subsp. pneumophila str. Philadelphia 1]
          Length = 347

 Score = 97.8 bits (242), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 54/155 (34%), Positives = 90/155 (58%), Gaps = 2/155 (1%)

Query: 94  YLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLS 153
           Y +   + + +  G+     N + L  +++ YGV P I++A+ G+ET +GE  G+  +L 
Sbjct: 87  YRELFLTQKRLKSGLQFWAENQKTLEKIQRRYGVSPEIIIAILGVETMYGERQGEYRVLD 146

Query: 154 TLATLAYDC-RRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAI 211
           TLATLA++  +R+ FFT++      L ++  +S +   G+  G IG+ QF+P +   YA+
Sbjct: 147 TLATLAFNYPKRSAFFTKELKEFFLLCREQHVSPTQYKGSYAGAIGKPQFMPSSYRYYAV 206

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAG 246
           D + +G+ DLV  N D+IAS A +L K GW    G
Sbjct: 207 DFNNNGRRDLVNDNGDSIASIANYLHKHGWNLNQG 241


>gi|296272860|ref|YP_003655491.1| membrane-bound lytic murein transglycosylase [Arcobacter
           nitrofigilis DSM 7299]
 gi|296097034|gb|ADG92984.1| membrane-bound lytic murein transglycosylase [Arcobacter
           nitrofigilis DSM 7299]
          Length = 326

 Score = 97.8 bits (242), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 66/205 (32%), Positives = 102/205 (49%), Gaps = 14/205 (6%)

Query: 50  RARAVREGMSPKTAKHLFADLE----YLDTTIARDRKMVTSPP--VSFK-----DYLDGL 98
           + ++V+E  S    +H F + E    + +  I +D     + P    +K     DY    
Sbjct: 22  KIKSVKEFKSYMIKEHKFNEKELSKLFSNVKIQKDSLWFYTKPHKTDYKTHYWTDYSKNF 81

Query: 99  SSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATL 158
            S + +  G+   K N+  L    KEY +P   ++A+ G+E+++G  MGK P   TL+TL
Sbjct: 82  LSEKKVQAGVDFLKKNNEALYKAYKEYKIPSAYIVAIIGIESNYGGFMGKNPTFDTLSTL 141

Query: 159 AY-DCRRAKFFTEQFFYALDLVKKGVISSHALGATF-GEIGQFQFLPVNVVKYAIDADED 216
           A+   RR  FF ++    L + KK  +    +  +F G IG  QF+P N  K A+D DE+
Sbjct: 142 AFKKNRRNSFFKKELEAYLVMTKKERVDPKEIKGSFAGAIGYCQFMPSNFKKVAVDLDEN 201

Query: 217 GKIDLVKSNIDAIASAAKFLAKLGW 241
            +I L K N DAI S A +L   GW
Sbjct: 202 NQIRLDKPN-DAIGSVANYLRMSGW 225


>gi|227824064|ref|YP_002828037.1| putative lytic murein transglycosylase [Sinorhizobium fredii
           NGR234]
 gi|227343066|gb|ACP27284.1| putative lytic murein transglycosylase [Sinorhizobium fredii
           NGR234]
          Length = 488

 Score = 97.8 bits (242), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 55/165 (33%), Positives = 90/165 (54%), Gaps = 1/165 (0%)

Query: 78  ARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWG 137
           A++RK   +   S   Y        + A G  L  A++  L  +++ YGVP  +++A+WG
Sbjct: 153 AKERKQSQAEFSSPGSYFSEKRLQGLAASGRGLASAHASTLKRIERTYGVPGPVVLAIWG 212

Query: 138 LETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKG-VISSHALGATFGEI 196
            E+ FG      P++  LAT A+   R + F  +   AL +++ G V  +   G+  G +
Sbjct: 213 RESGFGRAKIPHPIMDVLATKAFMSTRPELFRRELIAALTILESGDVKEAEMRGSWAGAM 272

Query: 197 GQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
           GQ QFLP + +KYA+D D DG+ D+  S  D++AS A +L++ GW
Sbjct: 273 GQPQFLPSSFLKYAVDFDGDGRRDIWNSVPDSLASIANYLSEKGW 317


>gi|258546167|ref|ZP_05706401.1| type III effector HopAJ2 [Cardiobacterium hominis ATCC 15826]
 gi|258518592|gb|EEV87451.1| type III effector HopAJ2 [Cardiobacterium hominis ATCC 15826]
          Length = 320

 Score = 97.8 bits (242), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 53/151 (35%), Positives = 84/151 (55%), Gaps = 2/151 (1%)

Query: 94  YLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLS 153
           YLDG  S++ I +G A       LL  L+ + GV    ++A+WG+E+ +G   G   L+ 
Sbjct: 5   YLDGAVSADRIQKGRAKLAQYRGLLQQLENQSGVSAPYIVAIWGMESAYGTNTGNIDLIQ 64

Query: 154 TLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAID 212
            L+TLAY+ RR  F  +Q    L L+++G +    L G+  G +G  QF+P   ++Y +D
Sbjct: 65  ALSTLAYEGRRRDFAEQQLIALLQLIERGDVRWDELRGSWAGGMGHTQFIPTTFLQYGVD 124

Query: 213 ADEDGKIDLVKSNIDAIASAAKFLAKLGWTK 243
            + DG+ D  +   DA+AS A +L K GW +
Sbjct: 125 GNGDGRRDPWQIE-DALASTANYLGKSGWQR 154


>gi|254473060|ref|ZP_05086458.1| lytic murein transglycosylase [Pseudovibrio sp. JE062]
 gi|211957781|gb|EEA92983.1| lytic murein transglycosylase [Pseudovibrio sp. JE062]
          Length = 405

 Score = 97.8 bits (242), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 65/218 (29%), Positives = 112/218 (51%), Gaps = 15/218 (6%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPP---VSFKDYLDGL 98
           F +W +  +  AV +G+SP+    +F  +    T   R +K   + P    +   YLD  
Sbjct: 29  FQKWIAGFKRTAVAQGVSPQLYDRVFKGM----TPDPRIKKSAENQPEFTRAIWQYLDSA 84

Query: 99  SSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLST---- 154
            S + +  G  +    +  L  ++ +YGV   +++A+WG+E+ +G  +    ++ +    
Sbjct: 85  VSQDRVLHGRRMVDEWAGWLDKIESKYGVNRHVVLAIWGMESSYGRILDNKAIVRSTPRA 144

Query: 155 LATLAYDC-RRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAID 212
           LATLAY+  RR K+  +Q   AL +++ G +S   + G+  G +G  QF+P     YA+D
Sbjct: 145 LATLAYNGGRRGKYARKQLVAALKILQNGDVSPQQMQGSWAGAMGHTQFIPTTYQAYAVD 204

Query: 213 ADEDGKIDLVKSNIDAIASAAKFLAKLGWT--KCAGYQ 248
              DGK D+  S  DA+AS A +L K+GW   +  GY+
Sbjct: 205 ITGDGKRDIWNSIPDALASTAAYLNKMGWQSGQTWGYE 242


>gi|85708664|ref|ZP_01039730.1| lytic murein transglycosylase [Erythrobacter sp. NAP1]
 gi|85690198|gb|EAQ30201.1| lytic murein transglycosylase [Erythrobacter sp. NAP1]
          Length = 349

 Score = 97.8 bits (242), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 72/245 (29%), Positives = 116/245 (47%), Gaps = 7/245 (2%)

Query: 1   MSFKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSP 60
           M+ K +  +++L+     L+ A T P  A  Q +  D  D F  +    +ARA  EG+S 
Sbjct: 1   MTLKHFTSLAILIAASFGLSSAST-PTPAQAQ-VARDGID-FDAYLERIKARARGEGVSQ 57

Query: 61  KTAKHLFADLEYLDTTIARDRKMVTSPP----VSFKDYLDGLSSSEIIAQGIALKKANSR 116
            T   + A L      I  D+    +P      +   Y+    +   IA G  + +A+  
Sbjct: 58  STIDRMTAGLTPNPRVIRLDQGQPGTPTRRGYPAMAPYIRTHVNPTRIAGGQRVYRAHVG 117

Query: 117 LLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYAL 176
            L  +++EYGVP  I++A++G ET +G   G   L  +LATLA++ RR + F  ++   +
Sbjct: 118 QLRAVEREYGVPGEIIVAIFGHETSYGAITGNFDLSRSLATLAWEGRRRELFEGEWVALM 177

Query: 177 DLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFL 236
            +  KG      +G+  G  G  QFLP   ++ A D D DG+ D+  +  D  AS A + 
Sbjct: 178 KVADKGYSRGTLVGSYAGAFGNPQFLPSVYLRLAADGDGDGRADIFNNRADTFASIANYF 237

Query: 237 AKLGW 241
              GW
Sbjct: 238 RDAGW 242


>gi|39933976|ref|NP_946252.1| lytic murein transglycosylase [Rhodopseudomonas palustris CGA009]
 gi|39647823|emb|CAE26343.1| putative transglycolase [Rhodopseudomonas palustris CGA009]
          Length = 465

 Score = 97.8 bits (242), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 68/209 (32%), Positives = 106/209 (50%), Gaps = 13/209 (6%)

Query: 45  WKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPV--SFKDYLDGLSSSE 102
           W  AAR    RE     TA  L  DL  +D        M + P    S  DYLD L +  
Sbjct: 103 WPDAARRGISRESFERYTAG-LSPDLRLMDL-------MDSQPEFTKSIWDYLDILVNDT 154

Query: 103 IIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDC 162
            +A+G  +          +++ YGV   I+ ++WG+E+++   MG   ++++ ATLA   
Sbjct: 155 RLAKGREILAQYKPQFDAVERAYGVDRYIIASIWGIESNYSTQMGDRYVVNSTATLACVG 214

Query: 163 RRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDL 221
           RR  +F ++F  AL+++ +G +    L G+  G  G  QF+P    ++A+DAD DG+ D+
Sbjct: 215 RRQAYFKDEFLTALEILHRGDLRPEQLRGSWAGAFGPTQFMPTAFKRFAVDADGDGRRDV 274

Query: 222 VKSNIDAIASAAKFLAKLGWT--KCAGYQ 248
           V +  D IAS A  L K GW   +  GY+
Sbjct: 275 VDNPYDLIASTANNLKKDGWQTGQTWGYE 303


>gi|170740072|ref|YP_001768727.1| lytic murein transglycosylase [Methylobacterium sp. 4-46]
 gi|168194346|gb|ACA16293.1| lytic murein transglycosylase [Methylobacterium sp. 4-46]
          Length = 391

 Score = 97.8 bits (242), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 73/204 (35%), Positives = 107/204 (52%), Gaps = 11/204 (5%)

Query: 50  RARAVREGMSPKTAKHLFADLEYLDTTI-ARDRKMVT-SPPVSFKDYLDGLSSSEIIAQG 107
           R  A   G++ +T    F ++   D  + AR R+    S PV   +YL G  S+  +A+G
Sbjct: 32  RPLATARGVARETFDAAFREVTAPDPAVLARLRRQGEFSRPV--WEYLAGSVSTARVARG 89

Query: 108 IALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKF 167
            A     + LL  L+  YGVP  +L+A+WG+E+ FG   G  P +  LATLA    R   
Sbjct: 90  RAEAARRAELLAGLEARYGVPGPVLLAVWGMESDFGTGTGSVPTVRALATLAQAGHRGDL 149

Query: 168 FTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNI 226
           F ++   ALD+++   +    L G+  G +GQ QFLP   ++ A+D D DG+ D+  S  
Sbjct: 150 FRDELLAALDILQHHDVGPEGLKGSWAGAMGQTQFLPSVYLRAAVDFDGDGRRDIWNSAP 209

Query: 227 DAIASAAKFLAKLGWTKCAGYQPG 250
           DA+AS A FL + GW      QPG
Sbjct: 210 DALASIANFLRQAGW------QPG 227


>gi|192289396|ref|YP_001990001.1| lytic murein transglycosylase [Rhodopseudomonas palustris TIE-1]
 gi|192283145|gb|ACE99525.1| lytic murein transglycosylase [Rhodopseudomonas palustris TIE-1]
          Length = 461

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 68/209 (32%), Positives = 106/209 (50%), Gaps = 13/209 (6%)

Query: 45  WKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPV--SFKDYLDGLSSSE 102
           W  AAR    RE     TA  L  DL  +D        M + P    S  DYLD L +  
Sbjct: 99  WPDAARRGISRESFERYTAG-LSPDLRLMDL-------MDSQPEFTKSIWDYLDILVNDT 150

Query: 103 IIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDC 162
            +A+G  +          +++ YGV   I+ ++WG+E+++   MG   ++++ ATLA   
Sbjct: 151 RLAKGREILAQYKPQFDAVERAYGVDRYIIASIWGIESNYSTQMGDRYVVNSTATLACVG 210

Query: 163 RRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDL 221
           RR  +F ++F  AL+++ +G +    L G+  G  G  QF+P    ++A+DAD DG+ D+
Sbjct: 211 RRQAYFKDEFLTALEILHRGDLRPEQLRGSWAGAFGPTQFMPTAFKRFAVDADGDGRRDV 270

Query: 222 VKSNIDAIASAAKFLAKLGWT--KCAGYQ 248
           V +  D IAS A  L K GW   +  GY+
Sbjct: 271 VDNPYDLIASTANNLKKDGWQTGQTWGYE 299


>gi|163867469|ref|YP_001608668.1| peptidoglycan-binding protein [Bartonella tribocorum CIP 105476]
 gi|161017115|emb|CAK00673.1| peptidoglycan-binding protein [Bartonella tribocorum CIP 105476]
          Length = 418

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 61/209 (29%), Positives = 107/209 (51%), Gaps = 12/209 (5%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARD---RKMVTSPPVSFKDYLDGL 98
           F  W    +  A+   ++P T    F  +  +D  + +    +    +PP    +Y D  
Sbjct: 46  FKRWIKEFKKTAIAHNITPSTFHMAFKGVNAIDPEVLKSAAYQPEFVAPPW---NYFDNR 102

Query: 99  SSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLS----T 154
                I +G    K  ++ L+ +++ +GV   IL+A+W +E+++G+ +    ++     +
Sbjct: 103 VHDIAILEGRRQAKKWNKWLLQIEERFGVDHNILLAIWSMESNYGKILTNKSVMRDTIRS 162

Query: 155 LATLAY-DCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAID 212
           LATLAY D +R K+   Q   A+ +++ G I    L G+  G +G  QF+P + + YAID
Sbjct: 163 LATLAYADKKRTKYAHTQLISAMKILQSGEIQRSQLTGSWAGALGHTQFIPSSYLAYAID 222

Query: 213 ADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
            D+DG+ D+  S  DA+A+AA  L K GW
Sbjct: 223 MDKDGRRDIWTSVPDALATAANLLHKNGW 251


>gi|15963987|ref|NP_384340.1| putative transglycosylase transmembrane protein [Sinorhizobium
           meliloti 1021]
 gi|307306399|ref|ZP_07586143.1| lytic murein transglycosylase [Sinorhizobium meliloti BL225C]
 gi|15073163|emb|CAC41671.1| Membrane-bound lytic murein transglycosylase B [Sinorhizobium
           meliloti 1021]
 gi|306902241|gb|EFN32838.1| lytic murein transglycosylase [Sinorhizobium meliloti BL225C]
          Length = 412

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 82/140 (58%), Gaps = 1/140 (0%)

Query: 103 IIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDC 162
           + A G +L  A++  L  +++ YGVP  I++A+WG E+ FG      P++  LAT A+  
Sbjct: 102 LAATGRSLASAHASTLKRIERTYGVPGQIVLAIWGKESGFGRAKIPHPIMDVLATKAFMS 161

Query: 163 RRAKFFTEQFFYALDLVKKG-VISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDL 221
            R + F  +   AL ++  G V  +   G+  G +GQ QFLP + +KYA+D D DG+ D+
Sbjct: 162 TRPELFRRELIAALHILDSGDVKEAQMRGSWAGAMGQPQFLPSSFLKYAVDFDGDGRRDI 221

Query: 222 VKSNIDAIASAAKFLAKLGW 241
             S  D++AS A +LA+ GW
Sbjct: 222 WNSVPDSLASIANYLAQKGW 241


>gi|85715262|ref|ZP_01046245.1| lytic murein transglycosylase [Nitrobacter sp. Nb-311A]
 gi|85697908|gb|EAQ35782.1| lytic murein transglycosylase [Nitrobacter sp. Nb-311A]
          Length = 478

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 67/210 (31%), Positives = 104/210 (49%), Gaps = 15/210 (7%)

Query: 45  WKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFK---DYLDGLSSS 101
           W  AAR    RE     TA  L  DL  +D        ++ S P   K   DYLD L + 
Sbjct: 116 WPDAARRHITRENFERFTAG-LSPDLRIMD--------LMDSQPEFTKAIWDYLDILVND 166

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             +A+G  +          ++K YG+    + A+WG+E+++   +G   +L + ATLA  
Sbjct: 167 ARLARGREILATYKPQFDAVEKAYGIDRYAIAAIWGIESNYSTRIGDRSVLQSTATLACV 226

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR  +F ++F  AL+++ +G +    + G+  G  G  QF+P    +YA+D D DG+ D
Sbjct: 227 GRRQTYFRDEFLAALEILNRGDLRPEQMRGSWAGAFGPTQFMPTAFKRYAVDGDGDGRRD 286

Query: 221 LVKSNIDAIASAAKFLAKLGWT--KCAGYQ 248
           +V +  D IAS A  L K GW   +  GY+
Sbjct: 287 VVDNPADLIASTANNLKKDGWQTGRTWGYE 316


>gi|307319286|ref|ZP_07598715.1| lytic murein transglycosylase [Sinorhizobium meliloti AK83]
 gi|306895122|gb|EFN25879.1| lytic murein transglycosylase [Sinorhizobium meliloti AK83]
          Length = 412

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 82/140 (58%), Gaps = 1/140 (0%)

Query: 103 IIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDC 162
           + A G +L  A++  L  +++ YGVP  I++A+WG E+ FG      P++  LAT A+  
Sbjct: 102 LAATGRSLASAHASTLKRIERTYGVPGQIVLAIWGKESGFGRAKIPHPIMDVLATKAFMS 161

Query: 163 RRAKFFTEQFFYALDLVKKG-VISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDL 221
            R + F  +   AL ++  G V  +   G+  G +GQ QFLP + +KYA+D D DG+ D+
Sbjct: 162 TRPELFRRELIAALHILDSGDVKEAQMRGSWAGAMGQPQFLPSSFLKYAVDFDGDGRRDI 221

Query: 222 VKSNIDAIASAAKFLAKLGW 241
             S  D++AS A +LA+ GW
Sbjct: 222 WNSVPDSLASIANYLAQKGW 241


>gi|160871614|ref|ZP_02061746.1| lytic murein transglycosylase B [Rickettsiella grylli]
 gi|159120413|gb|EDP45751.1| lytic murein transglycosylase B [Rickettsiella grylli]
          Length = 338

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 56/183 (30%), Positives = 100/183 (54%), Gaps = 8/183 (4%)

Query: 69  DLEYLDTTIARDRKMVTS-----PPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKK 123
            L+ L  TI   R ++TS       +++ +Y     +++    G+    A++++L   +K
Sbjct: 51  QLQQLFNTIKPHRSIITSFITPKERLTWSEYQSIFVTTKRAQMGVNFWNAHAKILAEAEK 110

Query: 124 EYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD-CRRAKFFTEQFFYALDLVKKG 182
            YGVP  I++A+ G+ET +GE  GK  ++ +L+TL+++  RR+ FF ++    L L ++ 
Sbjct: 111 RYGVPASIIVAILGVETRYGEVTGKYRVIDSLSTLSFNTTRRSHFFKQELTQFLLLSREN 170

Query: 183 VISSHAL--GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLG 240
            + +  L  G+  G IG+ QF+P N    ++DA   G  DL+ +  DAI S A +L   G
Sbjct: 171 PVINPQLTKGSYAGAIGKVQFMPSNYRHLSVDATHKGYSDLIHNTDDAILSIANYLKFFG 230

Query: 241 WTK 243
           W +
Sbjct: 231 WIR 233


>gi|323136782|ref|ZP_08071863.1| lytic murein transglycosylase [Methylocystis sp. ATCC 49242]
 gi|322398099|gb|EFY00620.1| lytic murein transglycosylase [Methylocystis sp. ATCC 49242]
          Length = 405

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 57/154 (37%), Positives = 87/154 (56%), Gaps = 1/154 (0%)

Query: 89  VSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGK 148
           +S   YL G  ++  +A+G ++    +  L      +GV P I++A+ G+E++FG   G 
Sbjct: 86  ISIPAYLAGTVTNSRVARGRSVAAELAGPLRRASARHGVQPEIIVAILGVESNFGTATGA 145

Query: 149 TPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVV 207
              L  LATLA+   RA+ F E+F  AL +++KG  +   L G+  G +GQ QF+P   +
Sbjct: 146 ADALRVLATLAWKGHRAETFIEEFVAALVMLEKGYATRGQLRGSWAGAMGQPQFMPSAYL 205

Query: 208 KYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
           KYA   D     D+ +S+ DA+AS A FLAK GW
Sbjct: 206 KYAESDDGSSAPDIWRSHADAVASIANFLAKSGW 239


>gi|270156959|ref|ZP_06185616.1| lytic murein transglycosylase B [Legionella longbeachae D-4968]
 gi|289164617|ref|YP_003454755.1| membrane-bound lytic murein transglycosylase B [Legionella
           longbeachae NSW150]
 gi|269988984|gb|EEZ95238.1| lytic murein transglycosylase B [Legionella longbeachae D-4968]
 gi|288857790|emb|CBJ11634.1| membrane-bound lytic murein transglycosylase B [Legionella
           longbeachae NSW150]
          Length = 340

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 56/155 (36%), Positives = 89/155 (57%), Gaps = 2/155 (1%)

Query: 94  YLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLS 153
           Y D   +   +  G+    AN + L   +K+YGVPP I++A+ G+ET +GE  G+  +L 
Sbjct: 80  YRDIFLTPARLNSGLNYWVANRKALEKAQKKYGVPPEIIVAILGVETLYGEKQGEYRVLD 139

Query: 154 TLATLAYDC-RRAKFFTEQFFYALDLVKK-GVISSHALGATFGEIGQFQFLPVNVVKYAI 211
            LATLA++  +R+ +FT++    L L ++ GV ++   G+  G IGQ QF+P +   +A+
Sbjct: 140 ALATLAFNYPKRSPYFTKELKEYLLLCREHGVPATQYKGSYAGAIGQPQFMPSSYRNFAV 199

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAG 246
           D +  GK DLV +N D+I S A +    GW    G
Sbjct: 200 DFNNKGKRDLVTNNDDSIGSIANYFYHHGWKSNDG 234


>gi|227823392|ref|YP_002827365.1| putative peptidoglycan-binding protein [Sinorhizobium fredii
           NGR234]
 gi|227342394|gb|ACP26612.1| putative peptidoglycan-binding protein [Sinorhizobium fredii
           NGR234]
          Length = 405

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 67/208 (32%), Positives = 107/208 (51%), Gaps = 10/208 (4%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFK--DYLDGLS 99
           F  W ++  A A + G++  T +  FA ++  D  +    K    P    K  +Y+D   
Sbjct: 33  FQNWINSFYATAAKSGITQATYRKAFAGVKTPDPAVIE--KANYQPEFKHKIWEYIDSRV 90

Query: 100 SSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL----STL 155
           +      G  +   + R L  +++ +GV   IL+A+W +E+++G  + K   L      L
Sbjct: 91  NPYTRRIGQEMAAKHGRTLDAIERHFGVDRSILLAVWSMESNYGAVLQKDDRLHYVPRAL 150

Query: 156 ATLAY-DCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDA 213
           ATLAY D +RAKF   Q   AL +++ G I+   L G+  G +G  QF+P + + YA+DA
Sbjct: 151 ATLAYADPKRAKFAKTQLIAALKILQSGDITPRELTGSWAGAMGHTQFIPTSYLLYAVDA 210

Query: 214 DEDGKIDLVKSNIDAIASAAKFLAKLGW 241
           D +G  D+  S  DA+A+AA  L K GW
Sbjct: 211 DGNGHRDIWNSVPDALATAANLLRKNGW 238


>gi|330872617|gb|EGH06766.1| type III helper protein HopAJ1 [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
 gi|330943490|gb|EGH45832.1| type III helper protein HopAJ1 [Pseudomonas syringae pv. pisi str.
           1704B]
          Length = 413

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 60/207 (28%), Positives = 106/207 (51%), Gaps = 3/207 (1%)

Query: 36  SDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYL 95
           S +   F +W +  R+ A  +G+   T    F ++  LD T+ +          +  DYL
Sbjct: 37  STSEANFQQWLATFRSNATTKGIDTATLDLAFQNIT-LDPTVHQLDMAQPEFTTAIWDYL 95

Query: 96  DGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTL 155
               + + I QG  L +    +L  +++ YGV   I+ A+W +E+ +G+ +G   ++ +L
Sbjct: 96  SERLTPKNIQQGQELLQKEP-VLNEVERHYGVDAKIIAAIWCIESGYGKDIGSRDVIRSL 154

Query: 156 ATLAYDCRRAKFFTEQFFYALDLVK-KGVISSHALGATFGEIGQFQFLPVNVVKYAIDAD 214
           ATLAY  RR  +   Q   AL +++ K +  +  +G+  G +GQ QF+P   + YA+D +
Sbjct: 155 ATLAYKGRRMDYGATQLMAALHILQNKDIARAQLIGSWAGAMGQTQFIPTTYLDYAVDFN 214

Query: 215 EDGKIDLVKSNIDAIASAAKFLAKLGW 241
            D + D+  S  DA+AS A +L +  W
Sbjct: 215 HDNRRDVWSSRADALASTASYLKRSAW 241


>gi|300310320|ref|YP_003774412.1| membrane-bound lytic peptidoglycan transglycosylase B protein
           [Herbaspirillum seropedicae SmR1]
 gi|300073105|gb|ADJ62504.1| membrane-bound lytic peptidoglycan transglycosylase B protein
           [Herbaspirillum seropedicae SmR1]
          Length = 369

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 76/238 (31%), Positives = 109/238 (45%), Gaps = 15/238 (6%)

Query: 21  QAVTQPKKATTQFICS--DTAD--RFGEWKSAAR---ARAVREGMSPKTAKHLFADLEYL 73
           Q  T PKK   +   S  D  +   F EWK  AR       R   S      LFA   YL
Sbjct: 32  QHKTGPKKVVAKKKTSPEDQGEFVNFNEWKEVARFMDDMVERNHFSRSELNSLFAQTRYL 91

Query: 74  DTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILM 133
           D+ I   +   ++ P ++  Y         I  G+         L   + +YGVP  I+ 
Sbjct: 92  DSAIQLIKPAPSNKPKNWFAYRARFVEPVRINAGVDFWNTYGVALARAEAQYGVPMEIIA 151

Query: 134 ALWGLETHFGETMGKTPLLSTLATLAYD-----CRRAK--FFTEQFFYALDLVKKGVISS 186
            + G+ET +G   G   ++  ++TLA+D      R A+  FF  +    L L ++  I  
Sbjct: 152 GIIGVETVYGRNTGNFRVMDAISTLAFDYPNTPNREARMAFFRGELENTLLLAREAGIDP 211

Query: 187 HAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTK 243
             L G+  G IG  QF+P ++ +YA+D D DGKIDL  S +DAI S A +LA  GW +
Sbjct: 212 LTLRGSYAGAIGWPQFMPGSIREYAVDFDGDGKIDLRNSPVDAIGSVAHYLAVHGWQR 269


>gi|298292685|ref|YP_003694624.1| lytic murein transglycosylase [Starkeya novella DSM 506]
 gi|296929196|gb|ADH90005.1| lytic murein transglycosylase [Starkeya novella DSM 506]
          Length = 455

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 60/172 (34%), Positives = 90/172 (52%), Gaps = 5/172 (2%)

Query: 82  KMVTSPPVSFK--DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLE 139
           K+ T P  S    DY+  L S   I +G      N+++   + + Y V P ++ A+WG+E
Sbjct: 119 KLETQPEFSRTAGDYVTMLVSETRIRKGREAMAQNAQVFEAVGRSYSVDPYVVAAIWGIE 178

Query: 140 THFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVI-SSHALGATFGEIGQ 198
           T++G   G  P+L   ATLA   RR  +F ++F  AL +V KG I  +H  G+  G  G 
Sbjct: 179 TNYGSARGSYPVLEATATLACVGRRKAYFRDEFVAALRIVDKGDIPETHLRGSWAGAFGL 238

Query: 199 FQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWT--KCAGYQ 248
            QF+P    + A+D D DG  ++V S  DA+ S A  L + GW   +  GY+
Sbjct: 239 TQFMPTAFQRDAVDFDGDGHRNVVDSVADAMGSTANKLKRGGWVAGRSWGYE 290


>gi|52424956|ref|YP_088093.1| MltB protein [Mannheimia succiniciproducens MBEL55E]
 gi|52307008|gb|AAU37508.1| MltB protein [Mannheimia succiniciproducens MBEL55E]
          Length = 369

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 47/118 (39%), Positives = 72/118 (61%), Gaps = 1/118 (0%)

Query: 125 YGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVI 184
           +GV    ++ALWG+E+ FG   G   +LS LATLA+D RR   F+++F  A+ ++  G +
Sbjct: 146 FGVQKEFILALWGMESSFGYYQGDYDVLSVLATLAFDGRRETLFSKEFINAMKMLDAGHL 205

Query: 185 S-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
           + S  LG+  G +GQ QF+P + + YA D D+DG  D+  +  D  AS A +L  +GW
Sbjct: 206 NRSKMLGSWAGAMGQTQFMPSSYLNYAADGDKDGTKDIWSNEYDVFASIANYLHTVGW 263


>gi|251789510|ref|YP_003004231.1| lytic murein transglycosylase [Dickeya zeae Ech1591]
 gi|247538131|gb|ACT06752.1| lytic murein transglycosylase [Dickeya zeae Ech1591]
          Length = 435

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 59/205 (28%), Positives = 106/205 (51%), Gaps = 6/205 (2%)

Query: 40  DRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKM--VTSPPVSFKDYLDG 97
           + F +WK+  R  A+ +G++  T    FADL   +  +A  +K   V +P  +   Y++ 
Sbjct: 62  ESFEQWKAKVRQEALSKGITADTFDKAFADLTPDNDVVAATQKQPEVITPVWT---YIEQ 118

Query: 98  LSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLAT 157
             + + IAQG  L K  +++   +++ Y V P +L A   +E+H+G   G   ++ +LAT
Sbjct: 119 RVTPDNIAQGKTLLKQYAKVAARIEQRYQVEPSLLFAFLAIESHYGANTGDKAVVRSLAT 178

Query: 158 LAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADED 216
           L Y   R  F  +    AL +++ G      + G+  G +G  QF+P + ++YA+D D D
Sbjct: 179 LDYYNYRRAFNRQNLIAALRMIQNGDARPEQIKGSWAGAMGMPQFIPTSYLQYAVDFDGD 238

Query: 217 GKIDLVKSNIDAIASAAKFLAKLGW 241
            + D+  S  D +AS A ++ +  W
Sbjct: 239 RRPDIWTSFPDTLASVANYMQQAKW 263


>gi|254510037|ref|ZP_05122104.1| lytic murein transglycosylase [Rhodobacteraceae bacterium KLH11]
 gi|221533748|gb|EEE36736.1| lytic murein transglycosylase [Rhodobacteraceae bacterium KLH11]
          Length = 387

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 69/212 (32%), Positives = 103/212 (48%), Gaps = 10/212 (4%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDR-KMVTSPPVSFKDYLDGLSS 100
           F  +    ++ AV+ G    T    F  ++     +  DR + V   P  F D+   L S
Sbjct: 25  FNSFVKGLKSEAVQRGFDKSTVDAFFKGVQQDSAVLKADRAQGVFQKP--FIDFSRLLIS 82

Query: 101 SEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAY 160
           +  I +G A+      +   +++EYGV   +L+A W  ET +G   G     + L TLA+
Sbjct: 83  ANRINRGKAMSDKYDAVFDRIEQEYGVSRRVLLAFWAFETDYGAVQGDYNTRNALVTLAH 142

Query: 161 DCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYAIDADEDGKI 219
           DCRR + F  Q F A++L  +G    +   GA  GEIG  Q LP +++   +D D DG +
Sbjct: 143 DCRRPELFRPQIFAAIELYSQGNFDPARTTGAWAGEIGMVQMLPQDILDNGVDGDGDGTV 202

Query: 220 DLVKSNIDAIASAAKFLAKLGWTKCAGYQPGE 251
            L  S  DA+ S AK L+ LGW      QPG+
Sbjct: 203 SLRTSAPDALMSGAKMLSHLGW------QPGQ 228


>gi|222149735|ref|YP_002550692.1| lytic murein transglycosylase [Agrobacterium vitis S4]
 gi|221736717|gb|ACM37680.1| lytic murein transglycosylase [Agrobacterium vitis S4]
          Length = 405

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 64/200 (32%), Positives = 103/200 (51%), Gaps = 8/200 (4%)

Query: 57  GMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSR 116
           G+S +T    FA ++  D  + R             DYLD   +   +  G  +   + R
Sbjct: 47  GISAQTYNRAFAGIKDPDPDVLRKAAYQPEFKSEIWDYLDSRVNPYTVKIGREMLAKHGR 106

Query: 117 LLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL----STLATLAY-DCRRAKFFTEQ 171
            L +L+K +GV   IL+A+W +E+++G  + K   L      LATL Y D +R  F  +Q
Sbjct: 107 TLASLEKYFGVDRHILLAIWSMESNYGAVLAKDDRLHYVPQALATLGYADPKRGGFARKQ 166

Query: 172 FFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIA 230
              AL +++ G +S   + G+  G +G  QF+P + + YA+DAD +G  D+  S  DA+A
Sbjct: 167 LIAALKILQNGDVSPKEMTGSWAGAMGHTQFIPTSYLLYAVDADGNGHKDIWNSIPDALA 226

Query: 231 SAAKFLAKLGWT--KCAGYQ 248
           ++A  LAK GW   +  GY+
Sbjct: 227 TSANLLAKNGWDSGRTWGYE 246


>gi|258544103|ref|ZP_05704337.1| membrane-bound lytic murein transglycosylase B [Cardiobacterium
           hominis ATCC 15826]
 gi|258520656|gb|EEV89515.1| membrane-bound lytic murein transglycosylase B [Cardiobacterium
           hominis ATCC 15826]
          Length = 335

 Score = 97.1 bits (240), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 64/210 (30%), Positives = 105/210 (50%), Gaps = 10/210 (4%)

Query: 53  AVREGMSPKTAKHLFADLEYLDTTIARDRKMV--TSPPVSFKDYLDGLSSSEIIAQGIAL 110
           AVR+G      + L   +   D+ + +  +    T P   ++   +  + ++    G+A 
Sbjct: 36  AVRDGYDSDYLQSLLLAVSRDDSVLEKISRPAEKTKPWYEYRKIFEDQARTD---DGVAF 92

Query: 111 KKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDC-RRAKFFT 169
            + N   L+  + +YGV P +++A+ G+ET +G+  G TP+  +L TL  D   RA FF 
Sbjct: 93  WRDNEAALVKAEAQYGVDPAVIVAILGVETRYGKVSGSTPVWQSLLTLCIDYPPRAPFFC 152

Query: 170 EQFFYALDLVKKGVISSHALGATF-GEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDA 228
           EQ  Y L L K+   +  A+  ++ G +G  QF+P +    A+D D DG++DL  S  DA
Sbjct: 153 EQTDYFLRLAKRENKNPLAIKGSYAGAMGMAQFMPSSYYNDAVDYDGDGRVDLWHSPADA 212

Query: 229 IASAAKFLAKLGWTKCAGYQ---PGEKNFA 255
           I S A +L   GW     Y+   P E N +
Sbjct: 213 IGSIAHYLQVRGWQPGGRYKYQLPLEPNIS 242


>gi|115524060|ref|YP_780971.1| lytic murein transglycosylase [Rhodopseudomonas palustris BisA53]
 gi|115518007|gb|ABJ05991.1| lytic murein transglycosylase [Rhodopseudomonas palustris BisA53]
          Length = 414

 Score = 97.1 bits (240), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 88/161 (54%), Gaps = 7/161 (4%)

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
           DY+   S + + A G  L + +   L  +++ +GVP  +++A+WG ET FG        +
Sbjct: 92  DYVKEASIARLAAHGQRLLREHRATLDAIERRFGVPATVVLAIWGRETDFGRHRLPYDAV 151

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATF-GEIGQFQFLPVNVVKYAI 211
             LAT AY  RR + +  +   AL L+  GV++   + +++ G  G  QFLP  + K+ +
Sbjct: 152 RVLATQAYVGRRKEQYRLELIAALKLISDGVVTRADMRSSWAGATGLTQFLPTELAKHGV 211

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPGEK 252
           D D DG+ID+ +S  DA+ASAA+ L   GW      QPG +
Sbjct: 212 DFDRDGRIDIWRSVPDALASAAQQLVNKGW------QPGVR 246


>gi|330815906|ref|YP_004359611.1| hypothetical protein bgla_1g09730 [Burkholderia gladioli BSR3]
 gi|327368299|gb|AEA59655.1| hypothetical protein bgla_1g09730 [Burkholderia gladioli BSR3]
          Length = 408

 Score = 97.1 bits (240), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 64/207 (30%), Positives = 97/207 (46%), Gaps = 14/207 (6%)

Query: 53  AVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKK 112
           A R+G+ P   + LFA   Y  T +   R   +    +++ Y      +  I  G+   +
Sbjct: 101 AARDGLDPARLRALFATANYSATAVKLVRPAPSPSVKNWRVYQSRFLDTIRINAGVKFWR 160

Query: 113 ANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDC--------RR 164
           AN   L     E+GVPP +++ + G+ET +G  MG  P L  L TLA+D         R+
Sbjct: 161 ANQATLQRASAEFGVPPEVIVGIIGVETIYGRYMGNFPALDALTTLAFDYPDTPNRADRQ 220

Query: 165 AKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKS 224
           A F      + +      +  +  +G+  G IG  QFLP ++  YA+D + +G IDL  S
Sbjct: 221 ATFRKNLEDFLVWTRDSQIDPTSVVGSYTGAIGIPQFLPSSIRAYAVDYEGNGHIDLRAS 280

Query: 225 NIDAIASAAKFLAKLGWTKCAGYQPGE 251
             DAI S A +L + GW      QPG 
Sbjct: 281 TADAIGSVANYLKQHGW------QPGR 301


>gi|257092979|ref|YP_003166620.1| lytic murein transglycosylase B [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257045503|gb|ACV34691.1| lytic murein transglycosylase B [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
          Length = 343

 Score = 97.1 bits (240), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 55/158 (34%), Positives = 90/158 (56%), Gaps = 2/158 (1%)

Query: 90  SFKDYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKT 149
           S++ Y +   +S  +  G    + +   L      YGVPP I++A+ G+ET +G+ MG  
Sbjct: 82  SWQRYRERFVNSRRVDGGQRFWQQHEVTLQRAAAIYGVPPEIVVAIIGVETEYGQNMGSF 141

Query: 150 PLLSTLATLAYD-CRRAKFFTEQFFYALDLVKKGVISSHALGATF-GEIGQFQFLPVNVV 207
            +L  L++LA+    RA+FF  +    L L ++  +S  ++  ++ G IG  QF+P +  
Sbjct: 142 GVLEALSSLAFHYPPRAEFFRSELEQFLLLARENGLSPLSIKGSYAGAIGIPQFMPSSQR 201

Query: 208 KYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCA 245
           ++A+D D D +IDL  SN+DAI S A+FL + GW K A
Sbjct: 202 RFAVDFDNDDRIDLRNSNVDAIGSVARFLQQHGWQKDA 239


>gi|329901085|ref|ZP_08272705.1| Membrane-bound lytic murein transglycosylase B precursor
           [Oxalobacteraceae bacterium IMCC9480]
 gi|327549235|gb|EGF33819.1| Membrane-bound lytic murein transglycosylase B precursor
           [Oxalobacteraceae bacterium IMCC9480]
          Length = 266

 Score = 97.1 bits (240), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 70/260 (26%), Positives = 121/260 (46%), Gaps = 19/260 (7%)

Query: 3   FKKYLLISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAAR---ARAVREGMS 59
           F + +  + L + +   + +   P + ++  +  + AD F +W + A       +R G  
Sbjct: 9   FHRAVRCTALTLAFGFASPSQAAPARPSSTHL-GEFAD-FSQWNAVAEFIDLMVMRHGFD 66

Query: 60  PKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLI 119
             T   LF    Y++  +   +      P ++  Y         I+ G+   + N+  L 
Sbjct: 67  RATLTALFRQTAYVERAVQLMKPAPAGRPKNWNAYRARFVEPVRISGGVRFWEDNAAALA 126

Query: 120 NLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD-------CRRAKFFTEQF 172
             + ++GVP  I++A+ G+ET +G   G   ++  + TLA+D         R ++F  + 
Sbjct: 127 RAETQFGVPAEIIVAIIGVETVYGRNTGNFRVMDAITTLAFDYPDTPTRLTRMQYFRGEL 186

Query: 173 FYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIAS 231
              L   ++  I   +L G+  G IG  QF+P ++ +YA+D D DGKIDL  S +DAI S
Sbjct: 187 ENTLLYARESGIDPLSLEGSYAGAIGLTQFMPGSIRQYAVDFDGDGKIDLRNSQVDAIGS 246

Query: 232 AAKFLAKLGWTKCAGYQPGE 251
            A FL K GW      +PGE
Sbjct: 247 VASFLIKHGW------RPGE 260


>gi|320326151|gb|EFW82207.1| type III helper protein HopAJ1 [Pseudomonas syringae pv. glycinea
           str. B076]
 gi|320330685|gb|EFW86662.1| type III helper protein HopAJ1 [Pseudomonas syringae pv. glycinea
           str. race 4]
 gi|330882645|gb|EGH16794.1| type III helper protein HopAJ1 [Pseudomonas syringae pv. glycinea
           str. race 4]
          Length = 413

 Score = 97.1 bits (240), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 60/204 (29%), Positives = 107/204 (52%), Gaps = 9/204 (4%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPP---VSFKDYLDGL 98
           F +W +  R+ A  +G+   T    F ++  LD T+    ++ T+ P    +  DYL   
Sbjct: 43  FQQWLATFRSNATTKGIDTATLDLAFQNIT-LDPTV---HQLDTAQPEFTTTIWDYLSER 98

Query: 99  SSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATL 158
            + +   QG  L +    +L  +++ YGV   I+ A+W +E+ +G+ +G   ++ +LATL
Sbjct: 99  LTPKNTQQGQELLQKEP-VLNEVERHYGVNAKIIAAIWCIESGYGKDIGSRDVIRSLATL 157

Query: 159 AYDCRRAKFFTEQFFYALDLVK-KGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDG 217
           AY  RR  +   Q   AL +++ K +  +  +G+  G +GQ QF+P   + YA+D + D 
Sbjct: 158 AYKGRRMNYGATQLMAALHILQNKDIARAQLIGSWAGAMGQTQFIPTTYLDYAVDFNHDN 217

Query: 218 KIDLVKSNIDAIASAAKFLAKLGW 241
           + D+  S  DA+AS A +L +  W
Sbjct: 218 RRDVWSSRADALASTASYLKRSAW 241


>gi|71734551|ref|YP_273050.1| type III helper protein HopAJ1 [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|71555104|gb|AAZ34315.1| type III helper protein HopAJ1 [Pseudomonas syringae pv.
           phaseolicola 1448A]
          Length = 413

 Score = 97.1 bits (240), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 60/204 (29%), Positives = 107/204 (52%), Gaps = 9/204 (4%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPP---VSFKDYLDGL 98
           F +W +  R+ A  +G+   T    F ++  LD T+    ++ T+ P    +  DYL   
Sbjct: 43  FQQWLATFRSNATTKGIDTATLDLAFQNIT-LDPTV---HQLDTAQPEFTTAIWDYLSER 98

Query: 99  SSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATL 158
            + +   QG  L +    +L  +++ YGV   I+ A+W +E+ +G+ +G   ++ +LATL
Sbjct: 99  LTPKNTQQGQELLQKEP-VLNEVERHYGVNAKIIAAIWCIESGYGKDIGSRDVIRSLATL 157

Query: 159 AYDCRRAKFFTEQFFYALDLVK-KGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDG 217
           AY  RR  +   Q   AL +++ K +  +  +G+  G +GQ QF+P   + YA+D + D 
Sbjct: 158 AYKGRRMNYGATQLMAALHILQNKDIARAQLIGSWAGAMGQTQFIPTTYLDYAVDFNHDN 217

Query: 218 KIDLVKSNIDAIASAAKFLAKLGW 241
           + D+  S  DA+AS A +L +  W
Sbjct: 218 RRDVWSSRADALASTASYLKRSAW 241


>gi|330891787|gb|EGH24448.1| type III helper protein HopAJ1 [Pseudomonas syringae pv. mori str.
           301020]
          Length = 413

 Score = 97.1 bits (240), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 60/204 (29%), Positives = 107/204 (52%), Gaps = 9/204 (4%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPP---VSFKDYLDGL 98
           F +W +  R+ A  +G+   T    F ++  LD T+    ++ T+ P    +  DYL   
Sbjct: 43  FQQWLATFRSNATTKGIDTATLDLAFQNIT-LDPTV---HQLDTAQPEFTTAIWDYLSER 98

Query: 99  SSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATL 158
            + +   QG  L +    +L  +++ YGV   I+ A+W +E+ +G+ +G   ++ +LATL
Sbjct: 99  LTPKNTQQGQELLQKEP-VLNEVERHYGVNAKIIAAIWCIESGYGKDIGSRDVIRSLATL 157

Query: 159 AYDCRRAKFFTEQFFYALDLVK-KGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDG 217
           AY  RR  +   Q   AL +++ K +  +  +G+  G +GQ QF+P   + YA+D + D 
Sbjct: 158 AYKGRRMNYGATQLMAALHILQNKDIARAQLIGSWAGAMGQTQFIPTTYLDYAVDFNHDN 217

Query: 218 KIDLVKSNIDAIASAAKFLAKLGW 241
           + D+  S  DA+AS A +L +  W
Sbjct: 218 RRDVWSSRADALASTASYLKRSAW 241


>gi|150398622|ref|YP_001329089.1| lytic murein transglycosylase [Sinorhizobium medicae WSM419]
 gi|150030137|gb|ABR62254.1| lytic murein transglycosylase [Sinorhizobium medicae WSM419]
          Length = 412

 Score = 97.1 bits (240), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 51/142 (35%), Positives = 82/142 (57%), Gaps = 1/142 (0%)

Query: 103 IIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDC 162
           + A G +L   ++  L  +++ YGVP  I++A+WG E+ FG      P++  LAT A+  
Sbjct: 102 LAATGRSLASTHASTLKRIERTYGVPGTIVLAIWGKESGFGRAKIPHPIMDVLATKAFMS 161

Query: 163 RRAKFFTEQFFYALDLVKKG-VISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDL 221
            R + F  +   AL ++  G V  +   G+  G +GQ QFLP + +KYA+D D DG+ D+
Sbjct: 162 TRPELFRRELIAALHILDSGDVKEAEMRGSWAGAMGQPQFLPTSFLKYAVDFDGDGRRDI 221

Query: 222 VKSNIDAIASAAKFLAKLGWTK 243
             S  D++AS A +LA+ GW +
Sbjct: 222 WNSVPDSLASIASYLAQKGWQR 243


>gi|293604185|ref|ZP_06686593.1| lytic murein transglycosylase B [Achromobacter piechaudii ATCC
           43553]
 gi|292817410|gb|EFF76483.1| lytic murein transglycosylase B [Achromobacter piechaudii ATCC
           43553]
          Length = 384

 Score = 96.7 bits (239), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 54/146 (36%), Positives = 76/146 (52%), Gaps = 6/146 (4%)

Query: 104 IAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD-- 161
           I  G+     N  LL    + +GVP  I+ ++ G+ET +G  MG   +L  LATLA+D  
Sbjct: 136 IGWGVEFYNENRDLLNQAAQRFGVPAPIIASIIGVETLYGRNMGNFRVLDALATLAFDYP 195

Query: 162 ----CRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDG 217
                 RA  F  Q    L LV K  +     G+  G IG  QF+P +++ YA+D D++G
Sbjct: 196 DPNKPERAAMFRGQLADFLTLVMKDKLELETRGSYAGAIGMPQFMPTSIMHYAVDGDDNG 255

Query: 218 KIDLVKSNIDAIASAAKFLAKLGWTK 243
            IDL  +  DAI S   FLA+ GW +
Sbjct: 256 HIDLTDNTQDAIMSVGSFLAQHGWQR 281


>gi|307944460|ref|ZP_07659800.1| lytic murein transglycosylase family protein [Roseibium sp.
           TrichSKD4]
 gi|307772209|gb|EFO31430.1| lytic murein transglycosylase family protein [Roseibium sp.
           TrichSKD4]
          Length = 415

 Score = 96.7 bits (239), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 57/160 (35%), Positives = 90/160 (56%), Gaps = 4/160 (2%)

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
           +YLD   S   + +G  L      +L  ++  YGV    ++A+WG+ET++G  MGK  ++
Sbjct: 93  EYLDSAVSETRVERGRELLVEYRDVLAAIEARYGVDREAVLAIWGMETNYGSFMGKHNVI 152

Query: 153 STLATLAYDC-RRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYA 210
             LATLAY   RR KF+ ++   AL +V+ G +    + G+  G +G  QF+P +   Y+
Sbjct: 153 QALATLAYGAPRRQKFWRKELLKALAIVQGGHVKFEDMEGSWAGAMGHTQFMPTSWNAYS 212

Query: 211 IDADEDGKIDLVKSNIDAIASAAKFLAKLGWT--KCAGYQ 248
           +D D DG+ D+  +  DA+AS A +L K GW   K  GY+
Sbjct: 213 VDFDGDGRRDIWTTIPDALASTAFYLKKHGWQTGKTWGYE 252


>gi|114799549|ref|YP_762022.1| lytic murein transglycosylase [Hyphomonas neptunium ATCC 15444]
 gi|114739723|gb|ABI77848.1| lytic murein transglycosylase [Hyphomonas neptunium ATCC 15444]
          Length = 434

 Score = 96.7 bits (239), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 63/191 (32%), Positives = 97/191 (50%), Gaps = 4/191 (2%)

Query: 52  RAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALK 111
           +++ E +SP T      ++E    T   D+     P     DYL     +  I QG    
Sbjct: 71  KSLLENISPITMWLGSQEVEVQTQTAPSDQAEFAKP---IWDYLSTPLGNTRITQGQQKL 127

Query: 112 KANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQ 171
              S  L  ++ EYGV    L+A+WG+ET+FG  +G+    + LA +A + RR      +
Sbjct: 128 ATTSATLAGIEAEYGVDRQALLAIWGMETNFGGFIGRDDAANALANMAVEGRRRSLGESE 187

Query: 172 FFYALDLVKKGVISSHALGATF-GEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIA 230
            F  + ++K G      L A + G +GQ QF+P   V +A+D D DG+ D+ KS  DA+A
Sbjct: 188 LFALMKILKDGDARRGDLIAGWAGAMGQTQFMPTTYVAHAVDFDGDGRKDVWKSEADALA 247

Query: 231 SAAKFLAKLGW 241
           SAA +LA+ G+
Sbjct: 248 SAANYLARSGY 258


>gi|217973589|ref|YP_002358340.1| lytic murein transglycosylase [Shewanella baltica OS223]
 gi|217498724|gb|ACK46917.1| lytic murein transglycosylase [Shewanella baltica OS223]
          Length = 370

 Score = 96.7 bits (239), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 64/202 (31%), Positives = 94/202 (46%), Gaps = 2/202 (0%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F ++    +  A  +G+S  T    F  ++      A D    T    +   YL      
Sbjct: 70  FSDYLIQLKQEARLQGISQTTLDLAFPQIKLFKKARATDSHQ-TEKTHNLDTYLADTVPE 128

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             +     L K + + L  +  +Y V P  L+ALWGL + FGE  G  P LS  A+LA+ 
Sbjct: 129 WKVDTARVLFKEHEQQLKAIASQYAVQPRFLVALWGLVSDFGEASGDYPALSVTASLAFG 188

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHALGATF-GEIGQFQFLPVNVVKYAIDADEDGKID 220
             R  FF ++F  AL ++ K  I    L + + G +GQ Q +P + + Y  D D DGK D
Sbjct: 189 GEREAFFKKEFMAALSIMDKDHIGFQDLKSRWNGAMGQTQLMPTDYLAYGQDGDGDGKKD 248

Query: 221 LVKSNIDAIASAAKFLAKLGWT 242
           +  +  DA ASAA  L +LGW 
Sbjct: 249 IWHNTQDAFASAAYLLQQLGWN 270


>gi|146338190|ref|YP_001203238.1| putative membrane-bound lytic murein transglycosylase signal
           peptide [Bradyrhizobium sp. ORS278]
 gi|146190996|emb|CAL75001.1| Putative membrane-bound lytic murein transglycosylase, putative
           signal peptide [Bradyrhizobium sp. ORS278]
          Length = 475

 Score = 96.3 bits (238), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 67/212 (31%), Positives = 106/212 (50%), Gaps = 15/212 (7%)

Query: 43  GEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPV---SFKDYLDGLS 99
           G W  AAR    ++     TA  L  DL  +D        ++ + P    S  DYLD L 
Sbjct: 111 GMWPDAARRNITQDNFQRFTA-GLTPDLRIMD--------LLDAQPEFTKSIWDYLDILV 161

Query: 100 SSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLA 159
           +   +A+G  +           ++ YGV   I+ A+WG+E+++   +G   +L + ATLA
Sbjct: 162 NDNRLAKGREVLAKYKPQFDATERAYGVDRFIIAAIWGIESNYSTQIGDRSVLQSTATLA 221

Query: 160 YDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGK 218
              RR  +F ++F  AL+++ +G +    L G+  G  G  QF+P    ++A+DAD DG+
Sbjct: 222 CIGRRQAYFKDEFLSALEILNRGDLRPEQLRGSWAGAFGPTQFMPTAFKRFAVDADGDGR 281

Query: 219 IDLVKSNIDAIASAAKFLAKLGWT--KCAGYQ 248
            D+V +  D IAS A  L K GW   +  GY+
Sbjct: 282 RDVVDNPADLIASTANNLKKDGWQSGQSWGYE 313


>gi|260430767|ref|ZP_05784739.1| lytic murein transglycosylase [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260418208|gb|EEX11466.1| lytic murein transglycosylase [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 410

 Score = 96.3 bits (238), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 52/149 (34%), Positives = 84/149 (56%), Gaps = 1/149 (0%)

Query: 94  YLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLS 153
           Y +  +     A G  + K ++  L  ++ + GVP  I++A+WG E+ FG+   +     
Sbjct: 90  YFNANTVQGTAAAGRRMAKRHAATLRQVEADTGVPGRIILAIWGRESGFGQVPIRHDAFR 149

Query: 154 TLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATF-GEIGQFQFLPVNVVKYAID 212
            LAT A+   RA +FT++   AL +V+ G  S  A+ +++ G +GQ QF+P + + YA D
Sbjct: 150 VLATKAFMSTRAAYFTDELIAALQIVEAGHTSGRAMKSSWAGALGQPQFMPSSFLTYATD 209

Query: 213 ADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
            D DG+ D+  S  D IAS A +LA+ GW
Sbjct: 210 GDGDGRADIWGSAEDTIASIATYLARHGW 238


>gi|254448486|ref|ZP_05061946.1| lytic murein transglycosylase B [gamma proteobacterium HTCC5015]
 gi|198261869|gb|EDY86154.1| lytic murein transglycosylase B [gamma proteobacterium HTCC5015]
          Length = 352

 Score = 96.3 bits (238), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 51/141 (36%), Positives = 79/141 (56%), Gaps = 3/141 (2%)

Query: 104 IAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDC- 162
           IA G    + ++ +L   + EYGVPP ++ A+ G+ET FG   GK P+  +L TLA+D  
Sbjct: 105 IAAGAEFMREHAEILARAEAEYGVPPEMVAAIIGVETRFGRYKGKHPVFDSLVTLAFDGQ 164

Query: 163 -RRAKFFTEQFFYALDLVK-KGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR  FF ++    L L + +G +    +G+  G +G  QF+  +   YA+D D+DG+ID
Sbjct: 165 ERRRAFFRKELKAFLLLCREQGFVPREVVGSYAGAMGMPQFIASSYRAYAVDFDQDGRID 224

Query: 221 LVKSNIDAIASAAKFLAKLGW 241
           L  +  D I S A +  + GW
Sbjct: 225 LFDNVEDVIGSVANYFQRHGW 245


>gi|307292801|ref|ZP_07572647.1| lytic murein transglycosylase [Sphingobium chlorophenolicum L-1]
 gi|306880867|gb|EFN12083.1| lytic murein transglycosylase [Sphingobium chlorophenolicum L-1]
          Length = 345

 Score = 96.3 bits (238), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 61/198 (30%), Positives = 96/198 (48%), Gaps = 6/198 (3%)

Query: 50  RARAVREGMSPKTAKHLFADLEYLDTTIARDRKM----VTSPPVSFKDYLDGLSSSEIIA 105
           RARA+  G+   T   +F  L      +  D+        +P  +F+ Y      +  I 
Sbjct: 43  RARAL--GIRDATLDSVFPGLTPNPRVVQLDQNQPGGGAYAPIPNFEPYRRQHVDAARIG 100

Query: 106 QGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRA 165
           +G     AN   L  ++ E GVP  I++A++G ET++G   G   L+ +LATL+Y+ RR 
Sbjct: 101 RGRTAYIANRARLGRIEAETGVPEEIMVAIYGHETNYGSYTGDFDLIRSLATLSYEGRRR 160

Query: 166 KFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSN 225
             F  +    L ++  GV  S  +G+  G  G  QFLP   ++   D D DG++D+  S 
Sbjct: 161 ALFEPELLATLKMLDNGVPRSRLVGSWAGATGYPQFLPSVYLRLGKDGDGDGRVDIWNSE 220

Query: 226 IDAIASAAKFLAKLGWTK 243
            DA+AS A +    GW +
Sbjct: 221 ADALASIANYFVHAGWRR 238


>gi|153000422|ref|YP_001366103.1| lytic murein transglycosylase [Shewanella baltica OS185]
 gi|151365040|gb|ABS08040.1| lytic murein transglycosylase [Shewanella baltica OS185]
          Length = 370

 Score = 96.3 bits (238), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 51/132 (38%), Positives = 74/132 (56%), Gaps = 1/132 (0%)

Query: 112 KANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQ 171
           K + + L  +  +Y V P  L+ALWGL + FGE  G  P+LS  A+LA+   R  FF ++
Sbjct: 139 KEHEQQLNAIASQYAVQPRFLVALWGLVSDFGEASGDYPVLSVTASLAFGGEREAFFKKE 198

Query: 172 FFYALDLVKKGVISSHALGATF-GEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIA 230
           F  AL ++ +  I    L + + G +GQ Q +P + + Y  D D DGK D+  +  DA A
Sbjct: 199 FMAALSIMDEDHIGFQDLKSRWNGSMGQTQLMPTDYLAYGQDGDGDGKKDIWHNTQDAFA 258

Query: 231 SAAKFLAKLGWT 242
           SAA  L +LGW 
Sbjct: 259 SAAYLLQQLGWN 270


>gi|220921182|ref|YP_002496483.1| lytic murein transglycosylase [Methylobacterium nodulans ORS 2060]
 gi|219945788|gb|ACL56180.1| lytic murein transglycosylase [Methylobacterium nodulans ORS 2060]
          Length = 392

 Score = 96.3 bits (238), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 56/159 (35%), Positives = 85/159 (53%), Gaps = 7/159 (4%)

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
           DYL G  S   +A+G A     + +L  ++    VP  +L+A+WG+E+ FG   G    +
Sbjct: 75  DYLAGAVSPGRVARGKAEAARRADVLAAIEARSSVPAPVLLAVWGMESDFGTGTGTVSTV 134

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAI 211
             LATLA    R+  F ++   AL++++   +    L G+  G +GQ QFLP   ++ A+
Sbjct: 135 RALATLAQAGHRSDLFRDELLAALEILEHHDVGPEGLRGSWAGAMGQTQFLPSVYLRTAV 194

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQPG 250
           D D DG+ D+  S  DA+AS A FL + GW      QPG
Sbjct: 195 DFDGDGRRDIWTSAPDALASIASFLRQAGW------QPG 227


>gi|307942770|ref|ZP_07658115.1| transglycosylase [Roseibium sp. TrichSKD4]
 gi|307773566|gb|EFO32782.1| transglycosylase [Roseibium sp. TrichSKD4]
          Length = 399

 Score = 96.3 bits (238), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 55/165 (33%), Positives = 93/165 (56%), Gaps = 8/165 (4%)

Query: 87  PPVSFK-------DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLE 139
           P V+F+       +Y    S + ++  G  L K +   L  ++  +GVP  I++A+W  E
Sbjct: 75  PKVNFQAEFRAPANYFKESSFNGLVGPGRRLMKKHRTTLAKIESRFGVPGRIVLAIWARE 134

Query: 140 THFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATFG-EIGQ 198
           + +G        +  LAT A+  +R  FF ++   AL ++++G IS  A+ +++G  +GQ
Sbjct: 135 SGYGGAKIPHDAVQVLATRAFMGQRRDFFKQELISALKILQEGHISRSAMKSSWGGAMGQ 194

Query: 199 FQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTK 243
            QF+P + +KYA D + DGK D+ +S+ID +AS A +LAK  W K
Sbjct: 195 PQFMPSSFLKYAADFEGDGKRDIWRSDIDTMASIANYLAKHSWVK 239


>gi|126730963|ref|ZP_01746772.1| probable transglycolase [Sagittula stellata E-37]
 gi|126708679|gb|EBA07736.1| probable transglycolase [Sagittula stellata E-37]
          Length = 399

 Score = 96.3 bits (238), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 48/139 (34%), Positives = 78/139 (56%), Gaps = 1/139 (0%)

Query: 106 QGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRA 165
           +G  + KA++R L   + + GVP  I++ +WG E+++G       +   L T  +   RA
Sbjct: 92  EGRKMAKAHARPLAAAEAQTGVPGRIVLGIWGRESNYGSAAIPHDVFRVLGTKGFMSTRA 151

Query: 166 KFFTEQFFYALDLVKKGVISSHALGATF-GEIGQFQFLPVNVVKYAIDADEDGKIDLVKS 224
            +FT++   AL + + G   S A+ +++ G +GQ QF+P N + YA D D DG  D+ +S
Sbjct: 152 AYFTDELIAALQIAEAGHAPSSAMKSSWAGALGQPQFMPTNFLAYATDGDGDGHADIWRS 211

Query: 225 NIDAIASAAKFLAKLGWTK 243
             D IAS A++L   GW K
Sbjct: 212 EADTIASIARYLQSHGWVK 230


>gi|71065257|ref|YP_263984.1| membrane-bound lytic murein transglycosylase [Psychrobacter
           arcticus 273-4]
 gi|71038242|gb|AAZ18550.1| possible membrane-bound lytic murein transglycosylase
           [Psychrobacter arcticus 273-4]
          Length = 434

 Score = 96.3 bits (238), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 79/279 (28%), Positives = 124/279 (44%), Gaps = 37/279 (13%)

Query: 1   MSFKKYLLI--SLLMMVYPMLAQAVTQPKK---------ATTQFI--------------- 34
           M   K+ L+    L+MV     QA+ QP K         A TQ I               
Sbjct: 1   MRLNKHYLVFFPALVMVGCTSQQAMQQPNKPVRQGNVQIAQTQTIQVKPTPAPVIKPTPV 60

Query: 35  CSDTADRFGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFK-- 92
              + + F +WKS    RA+  G    T  H   D  YL+  +     + +  P   K  
Sbjct: 61  AKPSYNSFSDWKSDFSMRAISSGHDAATV-HRLLDSAYLNQQVI---SLDSGQPEFSKMP 116

Query: 93  -DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPL 151
            +Y+D   S   ++ G          L  L+ +YGV   ++ A+WG+E+ +G   G + +
Sbjct: 117 WEYVDSAVSDGRVSTGKRKFAEQRTYLSQLQSQYGVNAEVVAAIWGMESSYGVVTGNSNI 176

Query: 152 LSTLATLAYDCRRAKFFTEQFFYALDLVKKGVIS-SHALGATFGEIGQFQFLPVNVVKYA 210
            S LA+LAYD RR +F   Q      L+++G +S S   G+  G +G  QF+P   +K  
Sbjct: 177 PSALASLAYDGRRQEFAETQLLSLATLLQRGDVSWSQLEGSWAGGMGHTQFIPDTWLKNG 236

Query: 211 IDADEDGKIDLVKSNIDAIASAAKFLAKLGWTKCAGYQP 249
           +D D +G  +   +  DA+AS A +L+  GW +  G +P
Sbjct: 237 VDGDGNGHRNPWSTG-DALASTANYLSNSGWVR--GLEP 272


>gi|89052848|ref|YP_508299.1| lytic murein transglycosylase [Jannaschia sp. CCS1]
 gi|88862397|gb|ABD53274.1| Lytic murein transglycosylase [Jannaschia sp. CCS1]
          Length = 514

 Score = 95.9 bits (237), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 63/203 (31%), Positives = 105/203 (51%), Gaps = 3/203 (1%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F  W +   ARA+  G+S +T    F  L+     + RDR        +  DYLD   S+
Sbjct: 144 FRAWIAEFEARALAAGISAETFARAFDGLQLNTRVLERDRNQAEFS-RALWDYLDTAVSA 202

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             I  G          L  ++ +Y V   +++A+WGLE+ +G   G   ++  +A+LA+D
Sbjct: 203 TRIRNGREALSEWRTTLGRIEAQYQVEAEVVVAVWGLESAYGAMRGSEGIVEAMASLAFD 262

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR  FF EQ   AL +++ G   +  + G+  G +G  QF+P + +++A D D+DG+ +
Sbjct: 263 GRRQDFFEEQLIAALQILEAGDTRARNMTGSWAGAMGHTQFMPTSYLEFAQDFDDDGRRN 322

Query: 221 LVKSN-IDAIASAAKFLAKLGWT 242
           +   N +DA+AS A +L + GW 
Sbjct: 323 IWSDNPVDALASTAHYLVEHGWV 345


>gi|294011644|ref|YP_003545104.1| membrane-bound lytic murein transglycosylase B [Sphingobium
           japonicum UT26S]
 gi|292674974|dbj|BAI96492.1| membrane-bound lytic murein transglycosylase B [Sphingobium
           japonicum UT26S]
          Length = 345

 Score = 95.9 bits (237), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 66/240 (27%), Positives = 111/240 (46%), Gaps = 10/240 (4%)

Query: 8   LISLLMMVYPMLAQAVTQPKKATTQFICSDTADRFGEWKSAARARAVREGMSPKTAKHLF 67
           ++SLL+ +  ++A  +T    +  + +       F  +  + R +A   G+   T   +F
Sbjct: 5   IMSLLLGLAAVMAGGLTADSVSAQEDVA------FRAYLESLRPKARAMGIRDMTLDSVF 58

Query: 68  ADLEYLDTTIARDRKM----VTSPPVSFKDYLDGLSSSEIIAQGIALKKANSRLLINLKK 123
             L      I  D+        +P  +F+ Y      +  I +G     AN   L   + 
Sbjct: 59  PGLTPNPRVIQLDQNQPGGGAYAPIPNFEPYRRQHVDAARIGRGRTAYLANRARLARTEA 118

Query: 124 EYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKGV 183
           E GVP  I++A++G ET++G   G   L+ +LATL+Y+ RR   F  +    L ++  GV
Sbjct: 119 ETGVPEEIMVAIYGHETNYGAYTGDFDLIRSLATLSYEGRRRALFEPELLATLKMLDNGV 178

Query: 184 ISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTK 243
             S  +G+  G  G  QFLP   ++   D D DG++D+  S  DA+AS A +    GW +
Sbjct: 179 PRSRLVGSWAGATGYPQFLPSVYLRLGRDGDGDGRVDIWNSEADALASIANYFVHAGWRR 238


>gi|33602432|ref|NP_889992.1| membrane-bound lytic murein transglycosylase B precursor
           [Bordetella bronchiseptica RB50]
 gi|33576871|emb|CAE33951.1| membrane-bound lytic murein transglycosylase B precursor
           [Bordetella bronchiseptica RB50]
          Length = 381

 Score = 95.9 bits (237), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 52/146 (35%), Positives = 77/146 (52%), Gaps = 6/146 (4%)

Query: 104 IAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD-- 161
           IA G+    AN  LL    + YGVP  I+ ++ G+ET +G  +G   ++  LATLA+D  
Sbjct: 133 IAWGVEFWNANQDLLNRAAQRYGVPASIIASIIGVETLYGRNVGNFRVVDALATLAFDYP 192

Query: 162 ----CRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDG 217
                 RA  F  Q    + L  +  +     G+  G IG  QF+P ++++YA+D D+DG
Sbjct: 193 DPAKPERADMFRGQLGDFITLALQDKLDPETRGSYAGAIGMPQFMPGSIMRYAVDGDDDG 252

Query: 218 KIDLVKSNIDAIASAAKFLAKLGWTK 243
            IDL  S  DA+ S   FL + GW +
Sbjct: 253 HIDLTNSVADAVMSVGNFLVEHGWQR 278


>gi|118587939|ref|ZP_01545349.1| putative membrane-bound lytic murein transglycosylase [Stappia
           aggregata IAM 12614]
 gi|118439561|gb|EAV46192.1| putative membrane-bound lytic murein transglycosylase [Stappia
           aggregata IAM 12614]
          Length = 413

 Score = 95.9 bits (237), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 70/230 (30%), Positives = 110/230 (47%), Gaps = 25/230 (10%)

Query: 50  RARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPP---VSFKDYLDGLSSSEIIAQ 106
           + +AV  G+ P  A+ + + + + +  I    +  TS P       DY+  L  ++ I  
Sbjct: 52  KKQAVAAGVRPDIAESMLSGVTFDEKVI----RFSTSQPEHKTEIWDYMAFLVDTQRIQD 107

Query: 107 GIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDC---R 163
           G A  K +S  L +++K YGV   +++A+WG+E+ +G   G       LA L   C   R
Sbjct: 108 GKANLKKHSSTLSSIEKRYGVDRHVVLAVWGIESDYGNFRGDFYTPHALANLV--CAGKR 165

Query: 164 RAKFFTEQFFYALDLVKKG-VISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLV 222
           R K+F  +    + +  +G V +   +G+  G  GQ QF+P      A+D D DG+ DLV
Sbjct: 166 RQKYFQGELIKTMQIASRGDVPAKDFVGSWAGAFGQTQFMPSTYNSLAVDFDGDGRKDLV 225

Query: 223 KSNIDAIASAAKFLAKLGWTKCA--GYQ----------PGEKNFAILKHW 260
            S  DA+AS A FL   GW+     GY+           G KN++ L  W
Sbjct: 226 NSVPDALASTANFLKNAGWSNSRPWGYEVKAPKSYSGPSGLKNYSSLSTW 275


>gi|33592116|ref|NP_879760.1| membrane-bound lytic murein transglycosylase B precursor
           [Bordetella pertussis Tohama I]
 gi|33571760|emb|CAE41261.1| membrane-bound lytic murein transglycosylase B precursor
           [Bordetella pertussis Tohama I]
 gi|332381532|gb|AEE66379.1| membrane-bound lytic murein transglycosylase B precursor
           [Bordetella pertussis CS]
          Length = 381

 Score = 95.9 bits (237), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 52/146 (35%), Positives = 77/146 (52%), Gaps = 6/146 (4%)

Query: 104 IAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD-- 161
           IA G+    AN  LL    + YGVP  I+ ++ G+ET +G  +G   ++  LATLA+D  
Sbjct: 133 IAWGVEFWNANQDLLNRAAQRYGVPASIIASIIGVETLYGRNVGNFRVVDALATLAFDYL 192

Query: 162 ----CRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDG 217
                 RA  F  Q    + L  +  +     G+  G IG  QF+P ++++YA+D D+DG
Sbjct: 193 DPAKPERADMFRGQLGDFITLALQDKLDPETRGSYAGAIGMPQFMPGSIMRYAVDGDDDG 252

Query: 218 KIDLVKSNIDAIASAAKFLAKLGWTK 243
            IDL  S  DA+ S   FL + GW +
Sbjct: 253 HIDLTNSVADAVMSVGNFLVEHGWQR 278


>gi|90422295|ref|YP_530665.1| lytic murein transglycosylase [Rhodopseudomonas palustris BisB18]
 gi|90104309|gb|ABD86346.1| Lytic murein transglycosylase [Rhodopseudomonas palustris BisB18]
          Length = 451

 Score = 95.9 bits (237), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 69/221 (31%), Positives = 108/221 (48%), Gaps = 18/221 (8%)

Query: 45  WKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFK---DYLDGLSSS 101
           W  AAR R + +    +    L  DL  +D        ++ S P   K   DYLD L + 
Sbjct: 89  WPDAAR-RGISQDSFQRFTAGLEPDLRIMD--------LMDSQPEFTKAIWDYLDILVND 139

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             +A+G  +           ++ YGV   I+ A+WG+E+++   MG   +L + ATLA  
Sbjct: 140 NRLAKGREVLAKYKPQFDAAERAYGVDRYIIAAIWGIESNYSTQMGDRSVLQSTATLACV 199

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR K+F ++F   L+++ +G +    + G+  G  G  QF+P    ++A+DAD DG+ D
Sbjct: 200 GRRQKYFRDEFLVTLEILHRGDLRPEQMRGSWAGAFGPTQFMPTAFKRFAVDADGDGRRD 259

Query: 221 LVKSNIDAIASAAKFLAKLGWTKCA--GYQ---PGEKNFAI 256
           +V +  D I S A  L K GW   A  GY+   P   NF +
Sbjct: 260 VVDNPADLIFSTANNLKKDGWQSGATWGYEVVLPQNFNFML 300


>gi|89092033|ref|ZP_01164988.1| membrane-bound lytic transglycosylase [Oceanospirillum sp. MED92]
 gi|89083768|gb|EAR62985.1| membrane-bound lytic transglycosylase [Oceanospirillum sp. MED92]
          Length = 392

 Score = 95.5 bits (236), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 53/140 (37%), Positives = 81/140 (57%), Gaps = 2/140 (1%)

Query: 104 IAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDC- 162
           I QG+   + N   L   +++YGVP  I++++ G+ET +G  MG   +L  LATL +D  
Sbjct: 137 IKQGVKFWQDNQESLAKAEQKYGVPAEIIVSIIGVETRYGRIMGSYRVLDALATLGFDYP 196

Query: 163 RRAKFFTEQFFYALDLVKKGVISSHALGATF-GEIGQFQFLPVNVVKYAIDADEDGKIDL 221
           RR+KFF  Q    L LVK+  +   +L  ++ G +G  QF+P +   +AID D+DGK D+
Sbjct: 197 RRSKFFLGQLKEYLHLVKEEKVDFTSLKGSYAGAMGFGQFIPSSYRNFAIDFDQDGKRDI 256

Query: 222 VKSNIDAIASAAKFLAKLGW 241
             +  DAI S A + A+  W
Sbjct: 257 WSNKTDAIGSVANYFAEHKW 276


>gi|189349845|ref|YP_001945473.1| membrane-bound lytic murein transglycosylase B [Burkholderia
           multivorans ATCC 17616]
 gi|189333867|dbj|BAG42937.1| membrane-bound lytic murein transglycosylase B [Burkholderia
           multivorans ATCC 17616]
          Length = 451

 Score = 95.5 bits (236), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 62/197 (31%), Positives = 93/197 (47%), Gaps = 8/197 (4%)

Query: 53  AVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKK 112
           A R G    +   LF+ + Y  T +   R   T P  +++ Y         I  G+   K
Sbjct: 130 ASRNGFDAASLHALFSRVSYSATAVKLVRPAPTPPVKNWRVYRSRFIEPIRINAGVKFWK 189

Query: 113 ANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAY--------DCRR 164
           AN   L    +E+GVPP +++ + G+ET +G  MG   +L  L TLA+        D R+
Sbjct: 190 ANQATLQRASQEFGVPPEVIVGIIGVETIYGRYMGNFRVLDALTTLAFDYPDTSNRDSRQ 249

Query: 165 AKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKS 224
           A F      + +      +  +  LG+  G IG  QFLP ++  YA+D D  G++DL  S
Sbjct: 250 ATFRKNLEDFLVWTRDSQLDPTTVLGSYTGAIGIPQFLPSSIRDYAVDYDGTGRVDLRSS 309

Query: 225 NIDAIASAAKFLAKLGW 241
             DAI S A +L + GW
Sbjct: 310 PADAIGSVANYLKQHGW 326


>gi|149184553|ref|ZP_01862871.1| lytic murein transglycosylase [Erythrobacter sp. SD-21]
 gi|148831873|gb|EDL50306.1| lytic murein transglycosylase [Erythrobacter sp. SD-21]
          Length = 339

 Score = 95.5 bits (236), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 63/201 (31%), Positives = 98/201 (48%), Gaps = 10/201 (4%)

Query: 49  ARARAVREGMSPKTAKHLFADLE------YLDTTIARDRKMVTSPPVSFKDYLDGLSSSE 102
           ARARA  EG+S  T   + A L        LD +          PP++   Y+     S 
Sbjct: 38  ARARA--EGVSEATLSRMTAGLTPNQRVIQLDQSQPGSSSSPGYPPLA--PYIATHVDSA 93

Query: 103 IIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDC 162
            I+ G          L  +++EYGVP  +++A+WG ET +G   G   L   LATLA++ 
Sbjct: 94  RISGGRREFANYHSALSRIEREYGVPAEVVVAIWGHETAYGRVKGGFDLSQALATLAWEG 153

Query: 163 RRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLV 222
           RR   F+ ++   + +  KG   +   G+  G  G  QFLP   ++ A D D DG+ D++
Sbjct: 154 RRRDLFSSEWVDLMKVADKGYSRNELKGSWAGAFGNPQFLPSVYLRLATDGDGDGRADIM 213

Query: 223 KSNIDAIASAAKFLAKLGWTK 243
            +++DA+AS A +    GW +
Sbjct: 214 NNSVDALASIANYFRDAGWRE 234


>gi|325291536|ref|YP_004277400.1| lytic murein transglycosylase [Agrobacterium sp. H13-3]
 gi|325059389|gb|ADY63080.1| lytic murein transglycosylase [Agrobacterium sp. H13-3]
          Length = 440

 Score = 95.5 bits (236), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 56/161 (34%), Positives = 91/161 (56%), Gaps = 7/161 (4%)

Query: 85  TSPPVSFKD-YLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFG 143
           +SP   F +  L GL+     A G +L   ++  L  ++ +YGVP  +++A+WG E+ FG
Sbjct: 116 SSPGAYFSEKRLQGLA-----ATGRSLAATHAATLRRIEAKYGVPGDVVLAIWGRESGFG 170

Query: 144 ETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVKKG-VISSHALGATFGEIGQFQFL 202
                  ++  LAT AY   R + F  +   AL +V+ G + +S  +G+  G +GQ QF+
Sbjct: 171 RAKLPHSVVDVLATKAYMSTRKEMFRTELIDALKIVESGDIAASRMMGSWAGALGQPQFM 230

Query: 203 PVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKLGWTK 243
           P + +KYA+D D DG  D+  S  DA+AS A +L++ GW +
Sbjct: 231 PSSYLKYAVDFDGDGHRDIWNSVPDALASIANYLSQRGWQR 271


>gi|170746489|ref|YP_001752749.1| lytic murein transglycosylase [Methylobacterium radiotolerans JCM
           2831]
 gi|170653011|gb|ACB22066.1| lytic murein transglycosylase [Methylobacterium radiotolerans JCM
           2831]
          Length = 396

 Score = 95.5 bits (236), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 46/125 (36%), Positives = 72/125 (57%), Gaps = 1/125 (0%)

Query: 121 LKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDCRRAKFFTEQFFYALDLVK 180
           ++  YGVP  + MA WG+E+ FG + G  P +  LATLA    R   F ++   AL +++
Sbjct: 104 IEGRYGVPGRMAMAFWGVESDFGASAGSVPTVRALATLAEARHRGGLFRDELLAALTILQ 163

Query: 181 KGVISSHALGATF-GEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAKL 239
           +G I+   +  ++ G +GQ QFLP   + +A+D D DG+ D+  S  D++AS A +L  L
Sbjct: 164 RGDIAPDRMSGSWAGAMGQVQFLPSTYLAHAVDFDGDGRRDIWTSEPDSLASIAAYLKDL 223

Query: 240 GWTKC 244
           GW   
Sbjct: 224 GWNPA 228


>gi|319944235|ref|ZP_08018511.1| peptidoglycan N-acetylmuramoylhydrolase [Lautropia mirabilis ATCC
           51599]
 gi|319742530|gb|EFV94941.1| peptidoglycan N-acetylmuramoylhydrolase [Lautropia mirabilis ATCC
           51599]
          Length = 494

 Score = 95.5 bits (236), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 75/125 (60%), Gaps = 6/125 (4%)

Query: 123 KEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD-CRRAKFFT---EQFFYALDL 178
           +E+GVP  I++A+ G+ET +G   GK P +  L+TLA+D   RA +F    EQF   L  
Sbjct: 250 QEHGVPAEIIVAIIGVETLYGRNTGKFPTIQALSTLAFDFPPRAAYFRKELEQFL--LYC 307

Query: 179 VKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIASAAKFLAK 238
            + G+      G+  G IG  QF+P ++  YA D D DG+IDLV S +DAI S A+FLA 
Sbjct: 308 RENGLDPMAPRGSYAGAIGTPQFMPGSIRSYATDFDGDGRIDLVNSPVDAIGSVARFLAI 367

Query: 239 LGWTK 243
            GW K
Sbjct: 368 HGWQK 372


>gi|33597653|ref|NP_885296.1| membrane-bound lytic murein transglycosylase B precursor
           [Bordetella parapertussis 12822]
 gi|33574081|emb|CAE38405.1| membrane-bound lytic murein transglycosylase B precursor
           [Bordetella parapertussis]
          Length = 381

 Score = 95.5 bits (236), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 52/146 (35%), Positives = 77/146 (52%), Gaps = 6/146 (4%)

Query: 104 IAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD-- 161
           IA G+    AN  LL    + YGVP  I+ ++ G+ET +G  +G   ++  LATLA+D  
Sbjct: 133 IAWGVEFWTANQDLLNRAAQRYGVPASIIASIIGVETLYGRNVGNFRVVDALATLAFDYP 192

Query: 162 ----CRRAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDG 217
                 RA  F  Q    + L  +  +     G+  G IG  QF+P ++++YA+D D+DG
Sbjct: 193 DPAKPERADMFRGQLGDFITLALQDKLDPETRGSYAGAIGMPQFMPGSIMRYAVDGDDDG 252

Query: 218 KIDLVKSNIDAIASAAKFLAKLGWTK 243
            IDL  S  DA+ S   FL + GW +
Sbjct: 253 HIDLTNSVADAVMSVGNFLVEHGWQR 278


>gi|161525418|ref|YP_001580430.1| lytic murein transglycosylase B [Burkholderia multivorans ATCC
           17616]
 gi|160342847|gb|ABX15933.1| lytic murein transglycosylase B [Burkholderia multivorans ATCC
           17616]
          Length = 444

 Score = 95.5 bits (236), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 62/197 (31%), Positives = 93/197 (47%), Gaps = 8/197 (4%)

Query: 53  AVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSSEIIAQGIALKK 112
           A R G    +   LF+ + Y  T +   R   T P  +++ Y         I  G+   K
Sbjct: 123 ASRNGFDAASLHALFSRVSYSATAVKLVRPAPTPPVKNWRVYRSRFIEPIRINAGVKFWK 182

Query: 113 ANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAY--------DCRR 164
           AN   L    +E+GVPP +++ + G+ET +G  MG   +L  L TLA+        D R+
Sbjct: 183 ANQATLQRASQEFGVPPEVIVGIIGVETIYGRYMGNFRVLDALTTLAFDYPDTSNRDSRQ 242

Query: 165 AKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKS 224
           A F      + +      +  +  LG+  G IG  QFLP ++  YA+D D  G++DL  S
Sbjct: 243 ATFRKNLEDFLVWTRDSQLDPTTVLGSYTGAIGIPQFLPSSIRDYAVDYDGTGRVDLRSS 302

Query: 225 NIDAIASAAKFLAKLGW 241
             DAI S A +L + GW
Sbjct: 303 PADAIGSVANYLKQHGW 319


>gi|197106582|ref|YP_002131959.1| peptidoglycan-binding protein [Phenylobacterium zucineum HLK1]
 gi|196480002|gb|ACG79530.1| peptidoglycan-binding protein [Phenylobacterium zucineum HLK1]
          Length = 430

 Score = 95.5 bits (236), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 65/208 (31%), Positives = 103/208 (49%), Gaps = 5/208 (2%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARD-RKMVTSPPVSFKDYLDGLSS 100
           F  W +  + RA+   + P   +   A L         D R+   S PVS   YL G+ +
Sbjct: 57  FDAWAAEFQGRALAADVRPDVLEREMAGLTPDPRVAGLDSRQPEFSKPVSA--YLKGVVT 114

Query: 101 SEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAY 160
           ++  A G   ++A+      ++  YGVP  IL+ +W LE+ FG   G   ++ ++ATLA 
Sbjct: 115 ADRAAIG-QRRRADVTEFAAIEDRYGVPREILLGVWALESGFGAIQGDMDVIRSVATLAA 173

Query: 161 DCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKI 219
             RR  +   +   AL +++ G      L G+  G +GQ QF+P   +  A+D D DG+ 
Sbjct: 174 QGRRRAWAEGELIAALKIIQSGEHPRARLKGSWAGAMGQTQFIPTTFLSTAVDFDGDGRR 233

Query: 220 DLVKSNIDAIASAAKFLAKLGWTKCAGY 247
           D+  S  DA+ASAA  L+K GW +   +
Sbjct: 234 DIWGSRGDALASAANLLSKAGWVRGQSW 261


>gi|192291169|ref|YP_001991774.1| lytic murein transglycosylase [Rhodopseudomonas palustris TIE-1]
 gi|192284918|gb|ACF01299.1| lytic murein transglycosylase [Rhodopseudomonas palustris TIE-1]
          Length = 409

 Score = 95.1 bits (235), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 59/205 (28%), Positives = 106/205 (51%), Gaps = 7/205 (3%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F EW+ A RA+A+ +G+SP+T   +   LE  D ++ ++ +           Y++   S 
Sbjct: 38  FDEWRDAFRAKALAKGVSPRTWDRVMGSLE-PDMSVFKNFQKQPEFNEQLWQYINRRVSD 96

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKT----PLLSTLAT 157
             I  G    + N  L   +++++GV  G L+ALWG+E+ +G+ + +     P+  +LA 
Sbjct: 97  WRITAGREALRKNEALFARIERDFGVERGTLLALWGVESAYGDPLVQQNHMRPVFPSLAA 156

Query: 158 LAY-DCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADE 215
           LA+ + RR  ++  +   AL +V KG  +   + G+  G +G  Q++P   +   ID D 
Sbjct: 157 LAWREPRRRPYWETELINALRIVDKGWSTPEEMRGSWAGAMGHSQWMPEVWLNVGIDYDG 216

Query: 216 DGKIDLVKSNIDAIASAAKFLAKLG 240
           DG++       DA+ S AK+L + G
Sbjct: 217 DGRVSPFGRPDDALGSTAKYLVRRG 241


>gi|19071492|gb|AAL84245.1|AF458045_1 type III effector HopPmaG [Pseudomonas syringae pv. maculicola]
 gi|330962749|gb|EGH63009.1| type III helper protein HopAJ1 [Pseudomonas syringae pv. maculicola
           str. ES4326]
          Length = 413

 Score = 95.1 bits (235), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 58/201 (28%), Positives = 103/201 (51%), Gaps = 3/201 (1%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F +W +  R+ A  +G+   T    F ++  LD T+ +          +  DYL    + 
Sbjct: 43  FQQWLATFRSNATTKGIDTATLDLAFQNIT-LDPTVHQLDMAQPEFTTAIWDYLSERLTP 101

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
           +   QG  L +    +L  +++ YGV   I+ A+W +E+ +G+ +G   ++ +LATLAY 
Sbjct: 102 KNTQQGQELLQKEP-VLNEVERHYGVNAKIIAAIWCIESGYGKDIGSRDVIRSLATLAYK 160

Query: 162 CRRAKFFTEQFFYALDLVK-KGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR  +   Q   AL +++ K +  +  +G+  G +GQ QF+P   + YA+D + D + D
Sbjct: 161 GRRMDYGATQLMAALHILQNKDIARAQLIGSWAGAMGQTQFIPTTYLDYAVDFNHDNRRD 220

Query: 221 LVKSNIDAIASAAKFLAKLGW 241
           +  S  DA+AS A +L +  W
Sbjct: 221 VWSSRADALASTASYLKRSAW 241


>gi|238026545|ref|YP_002910776.1| hypothetical protein bglu_1g08890 [Burkholderia glumae BGR1]
 gi|237875739|gb|ACR28072.1| Hypothetical protein bglu_1g08890 [Burkholderia glumae BGR1]
          Length = 426

 Score = 95.1 bits (235), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 65/198 (32%), Positives = 95/198 (47%), Gaps = 10/198 (5%)

Query: 53  AVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPV-SFKDYLDGLSSSEIIAQGIALK 111
           A R+G  P     LFA   Y  T + R  +   SP V +++ Y      +  I  G+   
Sbjct: 119 AARDGFDPAKLHALFASANYSATAV-RLVRPARSPSVKNWRAYQARFLDAIRINAGVKFW 177

Query: 112 KANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDC--------R 163
           +AN   L     E+GVPP +++ + G+ET +G  MG  P L  L TLA+D         R
Sbjct: 178 RANQATLQRASAEFGVPPEVIVGIIGVETIYGRYMGNFPTLDALTTLAFDYPDTPNRDDR 237

Query: 164 RAKFFTEQFFYALDLVKKGVISSHALGATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVK 223
           +A F      + +      +  +  LG+  G IG  QFLP ++  YA+D + +G IDL  
Sbjct: 238 QATFRKNLEDFLVWTRDSQLDPTSVLGSYTGAIGIPQFLPSSIRSYAVDYEGNGHIDLRA 297

Query: 224 SNIDAIASAAKFLAKLGW 241
           S  DAI S A +L + GW
Sbjct: 298 STADAIGSVANYLKQHGW 315


>gi|92118406|ref|YP_578135.1| lytic murein transglycosylase [Nitrobacter hamburgensis X14]
 gi|91801300|gb|ABE63675.1| Lytic murein transglycosylase [Nitrobacter hamburgensis X14]
          Length = 419

 Score = 95.1 bits (235), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 55/150 (36%), Positives = 83/150 (55%), Gaps = 1/150 (0%)

Query: 93  DYLDGLSSSEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLL 152
           DYL   S + + AQG  L +     L  ++K +GVP  I++A+WG ET +G        +
Sbjct: 97  DYLKEKSIARLAAQGQRLMQTYGPTLNAIEKRFGVPATIILAIWGRETDYGRYALPYDAM 156

Query: 153 STLATLAYDCRRAKFFTEQFFYALDLVKKGVISSHALGATF-GEIGQFQFLPVNVVKYAI 211
             LAT AY  RR + +  +F   L L+++G +S     A++ G  G  QFLP  + K+ +
Sbjct: 157 RVLATQAYVGRRKEQYRTEFIDGLLLLQRGDVSRKNFRASWGGATGLTQFLPSELAKHGV 216

Query: 212 DADEDGKIDLVKSNIDAIASAAKFLAKLGW 241
           D D DG++D+  S  DA+ASAA+ L   GW
Sbjct: 217 DFDGDGRVDIWTSVPDALASAAQQLVNKGW 246


>gi|124266435|ref|YP_001020439.1| putative membrane-bound lytic murein transglycosylase B protein
           [Methylibium petroleiphilum PM1]
 gi|124259210|gb|ABM94204.1| putative membrane-bound lytic murein transglycosylase B protein
           [Methylibium petroleiphilum PM1]
          Length = 366

 Score = 95.1 bits (235), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 61/192 (31%), Positives = 98/192 (51%), Gaps = 17/192 (8%)

Query: 69  DLEYLDTTIARDR------KMVTSPPV----SFKDYLDGLSSSEIIAQGIALKKANSRLL 118
           D  +++ T+A+ R      +++  PP     ++  Y         I  G+A  + N R L
Sbjct: 71  DRAWVEETLAQARFIPGVVRLIQPPPAGTAKNWAAYRARFVEPVRIRAGVAFWRDNERWL 130

Query: 119 INLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYDC------RRAKFFTEQF 172
              +  YGVP  I++ + G+ET + + MG   +L  LATL++D        R+ FF ++ 
Sbjct: 131 REAEARYGVPAAIVVGIVGVETIYAQHMGNFRVLDALATLSFDFPRDARRDRSPFFRDEL 190

Query: 173 FYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADEDGKIDLVKSNIDAIAS 231
              L L ++      AL G+  G IG  QF+P + +KYA+D D DG++DL  S  D I S
Sbjct: 191 ESFLLLCRQQGSDPLALKGSYAGAIGMPQFMPSSWLKYAVDFDGDGRVDLHASAADVIGS 250

Query: 232 AAKFLAKLGWTK 243
            A +LA+ GW +
Sbjct: 251 VANYLAEFGWQR 262


>gi|39935577|ref|NP_947853.1| lytic murein transglycosylase [Rhodopseudomonas palustris CGA009]
 gi|39649430|emb|CAE27952.1| possible membrane-bound lytic transglycosylase [Rhodopseudomonas
           palustris CGA009]
          Length = 409

 Score = 95.1 bits (235), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 59/205 (28%), Positives = 106/205 (51%), Gaps = 7/205 (3%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F EW+ A RA+A+ +G+SP+T   +   LE  D ++ ++ +           Y++   S 
Sbjct: 38  FDEWRDAFRAKALAKGVSPRTWDRVMGSLE-PDMSVFKNFQKQPEFNEQLWQYINRRVSD 96

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKT----PLLSTLAT 157
             I  G    + N  L   +++++GV  G L+ALWG+E+ +G+ + +     P+  +LA 
Sbjct: 97  WRITAGREALRKNEALFARIERDFGVERGTLLALWGVESAYGDPLVQQNHMRPVFPSLAA 156

Query: 158 LAY-DCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAIDADE 215
           LA+ + RR  ++  +   AL +V KG  +   + G+  G +G  Q++P   +   ID D 
Sbjct: 157 LAWREPRRRPYWETELINALRIVDKGWSTPEEMRGSWAGAMGHSQWMPEVWLNVGIDYDG 216

Query: 216 DGKIDLVKSNIDAIASAAKFLAKLG 240
           DG++       DA+ S AK+L + G
Sbjct: 217 DGRVSPFGRPDDALGSTAKYLVRRG 241


>gi|148651983|ref|YP_001279076.1| lytic murein transglycosylase [Psychrobacter sp. PRwf-1]
 gi|148571067|gb|ABQ93126.1| lytic murein transglycosylase [Psychrobacter sp. PRwf-1]
          Length = 445

 Score = 95.1 bits (235), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 58/203 (28%), Positives = 99/203 (48%), Gaps = 3/203 (1%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDGLSSS 101
           F EWKS    RA+ +G S      +    +     I+ D        + + DY D   S 
Sbjct: 80  FSEWKSDFSRRAMSQGYSAYDVSRILDSAQLNQQVISLDSNQAEFVKMPW-DYADSAVSG 138

Query: 102 EIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGKTPLLSTLATLAYD 161
             ++ G +       LL  L+ +YGV   I+ A+WG+E+ +G   G + + S+LATLA++
Sbjct: 139 GRVSSGKSKFNEQRSLLSRLESQYGVNAEIIAAIWGMESSYGAVTGNSYIPSSLATLAFE 198

Query: 162 CRRAKFFTEQFFYALDLVKKGVISSHALGATF-GEIGQFQFLPVNVVKYAIDADEDGKID 220
            RR ++  +Q    + L++ G I    L  ++ G +G  QF+P   +   +D D DG+  
Sbjct: 199 GRRRQWAEDQLLALMQLIQHGDIYPSQLNGSWAGGMGHTQFIPGTWLAQGVDGDGDGRRS 258

Query: 221 LVKSNIDAIASAAKFLAKLGWTK 243
              +  DA++S A +L+  GW +
Sbjct: 259 PWVT-ADALSSTANYLSNSGWMR 280


>gi|27379491|ref|NP_771020.1| transglycolase [Bradyrhizobium japonicum USDA 110]
 gi|27352643|dbj|BAC49645.1| bll4380 [Bradyrhizobium japonicum USDA 110]
          Length = 409

 Score = 95.1 bits (235), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 65/206 (31%), Positives = 109/206 (52%), Gaps = 9/206 (4%)

Query: 42  FGEWKSAARARAVREGMSPKTAKHLFADLEYLDTTIARDRKMVTSPPVSFKDYLDG-LSS 100
           F EW+ + RARA+ +G+S  T +   A +E  D ++ +  +           Y++  +S 
Sbjct: 39  FDEWRESFRARAMAKGISAATWQRAMARVE-PDMSVFKQMRNQPEFHEQVWQYINRRVSD 97

Query: 101 SEIIAQGIALKKANSRLLINLKKEYGVPPGILMALWGLETHFGETMGK----TPLLSTLA 156
             II   IALK  N  LL  +++++GV  G L+ALWG+E+ +G+ + +    TP+  +LA
Sbjct: 98  WRIINGKIALKN-NEALLARIERDFGVERGTLLALWGVESAYGDPLVQQNHMTPVFPSLA 156

Query: 157 TLAY-DCRRAKFFTEQFFYALDLVKKGVISSHAL-GATFGEIGQFQFLPVNVVKYAID