HHsearch alignment for GI: 254780309 and conserved domain: COG1040

>COG1040 ComFC Predicted amidophosphoribosyltransferases [General function prediction only].
Probab=99.50  E-value=4e-14  Score=97.74  Aligned_cols=55  Identities=44%  Similarity=0.630  Sum_probs=49.8

Q ss_pred             CCCEEEECCHHHHCCCCCEEEEEEECCCCCHHHHHHHHHHHHCCCCEEEEEEEEEECC
Q ss_conf             9760882510210028975999920045738899999999978997899999983068
Q gi|254780309|r    1 MRNAFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK   58 (59)
Q Consensus         1 l~gaf~i~~~~~~~i~gk~vliVDDiitTG~T~~~~~~~L~~~ga~~V~~~~lar~~~   58 (59)
T Consensus       171 l~~aF~~~~~~~~~---~~vlLvDDV~TTGaTl~~~~~~L~~~Ga~~v~~~~lar~~~  225 (225)
T COG1040         171 LKGAFRLKKGIEEP---KNVLLVDDVYTTGATLKEAAKLLREAGAKRVFVLTLARAPE  225 (225)
T ss_pred             CCCCEECCCCCCCC---CCEEEEECCCCCHHHHHHHHHHHHHCCCCEEEEEEEEECCC
T ss_conf             60563147876767---72899940066679999999999975991699999984589