HHsearch alignment for GI: 254780309 and conserved domain: KOG3367

>KOG3367 consensus.
Probab=98.39  E-value=4.6e-07  Score=59.61  Aligned_cols=48  Identities=17%  Similarity=0.241  Sum_probs=43.6

Q ss_pred             ECCHHHHCCCCCEEEEEEECCCCCHHHHHHHHHHHHCCCCEEEEEEEE
Q ss_conf             251021002897599992004573889999999997899789999998
Q gi|254780309|r    7 VPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFS   54 (59)
Q Consensus         7 i~~~~~~~i~gk~vliVDDiitTG~T~~~~~~~L~~~ga~~V~~~~la   54 (59)
T Consensus       115 ig~d~l~~ltgK~VliVeDIvdTGrTl~~Lls~~~~~k~~~v~vasLL  162 (216)
T KOG3367         115 IGGDDLSTLTGKNVLIVEDIVDTGRTLSTLLSHMKAYKPSMVKVASLL  162 (216)
T ss_pred             ECCCCHHHHCCCCEEEEEEECCCCCHHHHHHHHHHHCCCCCEEEEEEC
T ss_conf             647877773577289997401356107899998886086311432200