HHsearch alignment for GI: 254780309 and conserved domain: PRK02458

>PRK02458 ribose-phosphate pyrophosphokinase; Provisional.
Probab=98.98  E-value=7.7e-10  Score=74.59  Aligned_cols=47  Identities=32%  Similarity=0.396  Sum_probs=42.6

Q ss_pred             HHCCCCCEEEEEEECCCCCHHHHHHHHHHHHCCCCEEEEEEEEEECC
Q ss_conf             10028975999920045738899999999978997899999983068
Q gi|254780309|r   12 SKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK   58 (59)
Q Consensus        12 ~~~i~gk~vliVDDiitTG~T~~~~~~~L~~~ga~~V~~~~lar~~~   58 (59)
T Consensus       213 vgdV~Gr~vIIVDDiIdTGgTl~~aa~~Lk~~GA~~V~~~~THglfs  259 (323)
T PRK02458        213 IGDVSGKKAILIDDILNTGKTFAEAAKILERSGATEIYAVASHGLFA  259 (323)
T ss_pred             CCCCCCCEEEEECCHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCC
T ss_conf             36668966787620232248899999999964997689999764257