HHsearch alignment for GI: 254780309 and conserved domain: PRK05793

>PRK05793 amidophosphoribosyltransferase; Provisional.
Probab=98.53  E-value=9.9e-08  Score=63.19  Aligned_cols=49  Identities=33%  Similarity=0.434  Sum_probs=43.4

Q ss_pred             HHHHCCCCCEEEEEEECCCCCHHHHHHHHHHHHCCCCEEEEEEEEEECC
Q ss_conf             0210028975999920045738899999999978997899999983068
Q gi|254780309|r   10 YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK   58 (59)
Q Consensus        10 ~~~~~i~gk~vliVDDiitTG~T~~~~~~~L~~~ga~~V~~~~lar~~~   58 (59)
T Consensus       349 ~~~~~v~gK~vvlvDDSIVRGtT~k~iv~~Lr~aGakeVh~ri~sPpi~  397 (472)
T PRK05793        349 PLKVNVEGKRVVLIDDSIVRGTTSKRLVESLRRAGAKEVHFRVSSPPVK  397 (472)
T ss_pred             EEEECCCCCEEEEEECCCCCCCCHHHHHHHHHHCCCCEEEEEECCCCCC
T ss_conf             2021006986999807705576799999999977999899996899968