HHsearch alignment for GI: 254780309 and conserved domain: PRK07847

>PRK07847 amidophosphoribosyltransferase; Provisional.
Probab=98.51  E-value=1.3e-07  Score=62.54  Aligned_cols=49  Identities=24%  Similarity=0.398  Sum_probs=43.4

Q ss_pred             HHHHCCCCCEEEEEEECCCCCHHHHHHHHHHHHCCCCEEEEEEEEEECC
Q ss_conf             0210028975999920045738899999999978997899999983068
Q gi|254780309|r   10 YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSLK   58 (59)
Q Consensus        10 ~~~~~i~gk~vliVDDiitTG~T~~~~~~~L~~~ga~~V~~~~lar~~~   58 (59)
T Consensus       335 ~i~~~i~gK~vvlVDDSIVRGtT~k~iv~~Lr~aGAkeVh~riasPpi~  383 (489)
T PRK07847        335 PLREVIRGKRLVVVDDSIVRGNTQRALVRMLREAGAAEVHVRIASPPVK  383 (489)
T ss_pred             CCHHEECCCEEEEECCCCCCCCCHHHHHHHHHHCCCCEEEEEECCCCCC
T ss_conf             0264177987999847835667799999999976998899996899857