HHsearch alignment for GI: 254780309 and conserved domain: TIGR01134

>TIGR01134 purF amidophosphoribosyltransferase; InterPro: IPR005854 Purine nucleotides are synthesised both via the de novo pathway and via the salvage pathway and are vital for cell functions and cell proliferation through DNA and RNA syntheses and ATP energy supply. Amidophosphoribosyltransferase (2.4.2.14 from EC) is the rate-limiting enzyme in the de novo pathway of purine ribonucleotide synthesis and is regulated by feedback inhibition by AMP and GMP . 5-phospho-beta-D-ribosylamine + diphosphate + L-glutamate = L-glutamine + 5-phospho-alpha-D-ribose 1-diphosphate + H2O This family contains sequences which are members of the MEROPS peptidase family C44 (glutamine phosphoribosylpyrophosphate amidotransferase precursor, clan PB(C)) and sequences which are classed as non-peptidase homologs. These are sequences either have been found experimentally to be without peptidase activity, or lack amino acid residues that are believed to be essential for the catalytic activity. ; GO: 0004044 amidophosphoribosyltransferase activity, 0009113 purine base biosynthetic process.
Probab=98.44  E-value=2.2e-07  Score=61.34  Aligned_cols=46  Identities=30%  Similarity=0.403  Sum_probs=40.7

Q ss_pred             HHHHCCCCCEEEEEEECCCCCHHHHHHHHHHHHCCCCEEEEEEEEE
Q ss_conf             0210028975999920045738899999999978997899999983
Q gi|254780309|r   10 YVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSR   55 (59)
Q Consensus        10 ~~~~~i~gk~vliVDDiitTG~T~~~~~~~L~~~ga~~V~~~~lar   55 (59)
T Consensus       353 P~r~~~~GkrVvlVDDSiVRGTTSr~vV~mlR~AGA~EVH~riasP  398 (467)
T TIGR01134       353 PVRSVVEGKRVVLVDDSIVRGTTSRQVVEMLRDAGAREVHVRIASP  398 (467)
T ss_pred             CCHHHHCCCEEEEEECCEECCCHHHHHHHHHHHCCCEEEEEEECCC
T ss_conf             4303336975899942412071378999999872983898762588