HHsearch alignment of GI: 254780309 and MMDB domain: 1a3c_A_

>1a3c_A (A:) PYRR, pyrimidine operon regulatory protein PYRR; transcription regulation, attenuation protein, RNA-binding protein, pyrimidine biosynthesis; 1.60A {Bacillus subtilis}
Probab=99.01  E-value=7.5e-10  Score=74.30  Aligned_cols=54  Identities=22%  Similarity=0.250  Sum_probs=45.5

Q ss_pred             EEEECCHHHHCCCCCEEEEEEECCCCCHHHHHHHHHHHHCCCCEEEEEEEEEEC
Q ss_conf             088251021002897599992004573889999999997899789999998306
Q gi|254780309|r    4 AFNVPQYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL   57 (59)
Q Consensus         4 af~i~~~~~~~i~gk~vliVDDiitTG~T~~~~~~~L~~~ga~~V~~~~lar~~   57 (59)
                      ...........++||+||||||+++||.|+.++++.|+++|++++..+++....
T Consensus        85 ~~~~~~~~~~~~~gk~VliVDDii~TG~Tl~~~~~~L~~~g~~~v~~~~~~~~~  138 (181)
T 1a3c_A           85 PLVKGADIPVDITDQKVILVDDVLYTGRTVRAGMDALVDVGRPSSIQLAVLVDR  138 (181)
T ss_dssp             CEEEEEECSSCCTTSEEEEEEEEESSSHHHHHHHHHHHHHCCCSEEEEEEEEEC
T ss_pred             CEEECCCCCCCCCCCEEEEEEEEECCCCHHHHHHHHHHHCCCCCEEEEEEEECC
T ss_conf             478614576213597899994223258479999999974289778999999818