HHsearch alignment of GI: 254780309 and MMDB domain: 1cjb_A_

>1cjb_A (A:) Protein (hypoxanthine-guanine phosphoribosyltransferase); malaria, purine salvage, transition state inhibitor; HET: IRP; 2.00A {Plasmodium falciparum}
Probab=98.97  E-value=1.5e-09  Score=72.68  Aligned_cols=49  Identities=24%  Similarity=0.196  Sum_probs=43.4

Q ss_pred             CHHHHCCCCCEEEEEEECCCCCHHHHHHHHHHHHCCCCEEEEEEEEEEC
Q ss_conf             1021002897599992004573889999999997899789999998306
Q gi|254780309|r    9 QYVSKHVAGLKILLIDDVYTTGATAKCAAIALKKAGAMTVSILTFSRSL   57 (59)
Q Consensus         9 ~~~~~~i~gk~vliVDDiitTG~T~~~~~~~L~~~ga~~V~~~~lar~~   57 (59)
                      .....+++||+|+||||+++||.|+.++++.|++.||++|++++++-..
T Consensus       129 ~~~~~~~~Gk~VlIVDDii~tG~Tl~~~~~~L~~~Ga~~v~~~~~~~~~  177 (231)
T 1cjb_A          129 SEDLSCLKGKHVLIVEDIIDTGKTLVKFCEYLKKFEIKTVAIACLFIKR  177 (231)
T ss_dssp             ESCGGGGBTCEEEEEEEEESSSHHHHHHHHHHGGGCBSEEEEEEEEEEC
T ss_pred             CCCCHHHCCCCEEEEEEEHHHHHHHHHHHHHHHHHCCCCCEEEEEEECC
T ss_conf             3571342354169983003278999999999987667740188666504